NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F035476

Metagenome Family F035476

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035476
Family Type Metagenome
Number of Sequences 172
Average Sequence Length 76 residues
Representative Sequence MKNITTTQQEFVSTAKEMFGENTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Number of Associated Samples 135
Number of Associated Scaffolds 172

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.76 %
% of genes near scaffold ends (potentially truncated) 32.56 %
% of genes from short scaffolds (< 2000 bps) 73.84 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.233 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(30.233 % of family members)
Environment Ontology (ENVO) Unclassified
(77.326 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.698 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.38%    β-sheet: 8.11%    Coil/Unstructured: 63.51%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 172 Family Scaffolds
PF07728AAA_5 15.70
PF01165Ribosomal_S21 2.91
PF08406CbbQ_C 2.33
PF05118Asp_Arg_Hydrox 1.74
PF14090HTH_39 1.16
PF02511Thy1 1.16
PF05050Methyltransf_21 1.16

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 172 Family Scaffolds
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 2.91
COG0714MoxR-like ATPaseGeneral function prediction only [R] 2.33
COG3555Aspartyl/asparaginyl beta-hydroxylase, cupin superfamilyPosttranslational modification, protein turnover, chaperones [O] 1.74
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 1.16

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.58 %
UnclassifiedrootN/A24.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10016517All Organisms → Viruses → Predicted Viral3645Open in IMG/M
3300000149|LPaug09P1610mDRAFT_c1004901Not Available2018Open in IMG/M
3300000149|LPaug09P1610mDRAFT_c1011120All Organisms → Viruses → Predicted Viral1201Open in IMG/M
3300000168|LPjun09P1210mDRAFT_c1014890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239624Open in IMG/M
3300000265|LP_A_09_P04_10DRAFT_1003872All Organisms → Viruses → Predicted Viral4000Open in IMG/M
3300000947|BBAY92_10112341Not Available723Open in IMG/M
3300000949|BBAY94_10072138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239953Open in IMG/M
3300000973|BBAY93_10086075Not Available803Open in IMG/M
3300001450|JGI24006J15134_10003488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED2398429Open in IMG/M
3300001450|JGI24006J15134_10033822All Organisms → Viruses → Predicted Viral2215Open in IMG/M
3300001450|JGI24006J15134_10050980Not Available1691Open in IMG/M
3300001589|JGI24005J15628_10007933Not Available5035Open in IMG/M
3300001589|JGI24005J15628_10089512Not Available1060Open in IMG/M
3300001589|JGI24005J15628_10099469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239980Open in IMG/M
3300002242|KVWGV2_10287484Not Available1194Open in IMG/M
3300004097|Ga0055584_101223479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239783Open in IMG/M
3300005057|Ga0068511_1079106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239569Open in IMG/M
3300005430|Ga0066849_10259710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239668Open in IMG/M
3300005432|Ga0066845_10399768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239532Open in IMG/M
3300005934|Ga0066377_10125869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239773Open in IMG/M
3300006166|Ga0066836_10328468Not Available918Open in IMG/M
3300006190|Ga0075446_10012999All Organisms → Viruses → Predicted Viral2893Open in IMG/M
3300006193|Ga0075445_10048485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1695Open in IMG/M
3300006193|Ga0075445_10183399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239738Open in IMG/M
3300006332|Ga0068500_1429121Not Available948Open in IMG/M
3300006735|Ga0098038_1177541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239698Open in IMG/M
3300006735|Ga0098038_1185136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239680Open in IMG/M
3300006735|Ga0098038_1283145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239517Open in IMG/M
3300006737|Ga0098037_1089128Not Available1077Open in IMG/M
3300006737|Ga0098037_1138029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239825Open in IMG/M
3300006749|Ga0098042_1173619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239522Open in IMG/M
3300006789|Ga0098054_1144870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239879Open in IMG/M
3300006900|Ga0066376_10050657All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M2672Open in IMG/M
3300006947|Ga0075444_10047324All Organisms → Viruses → Predicted Viral2052Open in IMG/M
3300007283|Ga0066366_10448528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239565Open in IMG/M
3300007555|Ga0102817_1045497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239962Open in IMG/M
3300007863|Ga0105744_1119500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239653Open in IMG/M
3300007963|Ga0110931_1100754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239871Open in IMG/M
3300009077|Ga0115552_1320984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239616Open in IMG/M
3300009172|Ga0114995_10587647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239608Open in IMG/M
3300009172|Ga0114995_10717826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239547Open in IMG/M
3300009193|Ga0115551_1407342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239584Open in IMG/M
3300009422|Ga0114998_10391851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239649Open in IMG/M
3300009425|Ga0114997_10147129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED2391396Open in IMG/M
3300009428|Ga0114915_1088141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239938Open in IMG/M
3300009472|Ga0115554_1347842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239583Open in IMG/M
3300009481|Ga0114932_10010904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M6956Open in IMG/M
3300009481|Ga0114932_10840729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239531Open in IMG/M
3300009526|Ga0115004_10959535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239512Open in IMG/M
3300009550|Ga0115013_10355033Not Available922Open in IMG/M
3300009550|Ga0115013_10404507Not Available871Open in IMG/M
3300009593|Ga0115011_10062916Not Available2554Open in IMG/M
3300009703|Ga0114933_10012581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED2396943Open in IMG/M
3300009703|Ga0114933_10053699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium2939Open in IMG/M
3300009703|Ga0114933_10282179Not Available1105Open in IMG/M
3300009705|Ga0115000_10865122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239553Open in IMG/M
3300010148|Ga0098043_1210738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239536Open in IMG/M
3300010153|Ga0098059_1011837All Organisms → Viruses → Predicted Viral3644Open in IMG/M
3300011258|Ga0151677_1011270All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300011258|Ga0151677_1040273Not Available1075Open in IMG/M
3300012920|Ga0160423_10473777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239852Open in IMG/M
3300012920|Ga0160423_11221800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239501Open in IMG/M
3300012928|Ga0163110_10206374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1395Open in IMG/M
3300012928|Ga0163110_10924931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239691Open in IMG/M
3300012952|Ga0163180_10340699Not Available1078Open in IMG/M
3300012952|Ga0163180_10368787All Organisms → Viruses → Predicted Viral1041Open in IMG/M
3300012953|Ga0163179_10005971Not Available8056Open in IMG/M
3300012953|Ga0163179_10326235All Organisms → Viruses → Predicted Viral1223Open in IMG/M
3300012954|Ga0163111_10412216Not Available1228Open in IMG/M
3300017709|Ga0181387_1084203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239645Open in IMG/M
3300017714|Ga0181412_1010295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED2392841Open in IMG/M
3300017714|Ga0181412_1105976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239658Open in IMG/M
3300017717|Ga0181404_1009722All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M2549Open in IMG/M
3300017717|Ga0181404_1070321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239869Open in IMG/M
3300017721|Ga0181373_1048979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239769Open in IMG/M
3300017725|Ga0181398_1006767All Organisms → Viruses → Predicted Viral2985Open in IMG/M
3300017725|Ga0181398_1057463Not Available937Open in IMG/M
3300017726|Ga0181381_1034372Not Available1132Open in IMG/M
3300017726|Ga0181381_1047534Not Available944Open in IMG/M
3300017730|Ga0181417_1125295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239621Open in IMG/M
3300017731|Ga0181416_1138884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239585Open in IMG/M
3300017732|Ga0181415_1050272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239949Open in IMG/M
3300017734|Ga0187222_1054857Not Available926Open in IMG/M
3300017743|Ga0181402_1076291Not Available880Open in IMG/M
3300017744|Ga0181397_1045886Not Available1218Open in IMG/M
3300017745|Ga0181427_1156684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239551Open in IMG/M
3300017746|Ga0181389_1153174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239612Open in IMG/M
3300017748|Ga0181393_1186576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239506Open in IMG/M
3300017750|Ga0181405_1100861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239727Open in IMG/M
3300017760|Ga0181408_1028857Not Available1519Open in IMG/M
3300017762|Ga0181422_1015226All Organisms → Viruses → Predicted Viral2550Open in IMG/M
3300017763|Ga0181410_1211399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239529Open in IMG/M
3300017767|Ga0181406_1001105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED23910022Open in IMG/M
3300017771|Ga0181425_1014560Not Available2620Open in IMG/M
3300017776|Ga0181394_1202395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239604Open in IMG/M
3300017782|Ga0181380_1064171All Organisms → Viruses → Predicted Viral1299Open in IMG/M
3300017783|Ga0181379_1273754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239578Open in IMG/M
3300020165|Ga0206125_10042964All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M2282Open in IMG/M
3300020238|Ga0211492_1094436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239522Open in IMG/M
3300020240|Ga0211494_1028431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED2391180Open in IMG/M
3300020240|Ga0211494_1052282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239823Open in IMG/M
3300020246|Ga0211707_1001287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M4252Open in IMG/M
3300020253|Ga0211685_1003309All Organisms → Viruses → Predicted Viral2685Open in IMG/M
3300020257|Ga0211704_1077505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239500Open in IMG/M
3300020294|Ga0211520_1077913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239521Open in IMG/M
3300020296|Ga0211474_1028634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239922Open in IMG/M
3300020296|Ga0211474_1074583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239502Open in IMG/M
3300020312|Ga0211542_1023908Not Available1258Open in IMG/M
3300020335|Ga0211690_1127963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239535Open in IMG/M
3300020349|Ga0211511_1049312Not Available1050Open in IMG/M
3300020349|Ga0211511_1079387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239780Open in IMG/M
3300020378|Ga0211527_10075037Not Available1014Open in IMG/M
3300020379|Ga0211652_10008660Not Available3088Open in IMG/M
3300020381|Ga0211476_10264324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239593Open in IMG/M
3300020382|Ga0211686_10002859Not Available9142Open in IMG/M
3300020382|Ga0211686_10403121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239553Open in IMG/M
3300020385|Ga0211677_10042051All Organisms → Viruses → Predicted Viral2141Open in IMG/M
3300020385|Ga0211677_10210536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239803Open in IMG/M
3300020388|Ga0211678_10024646All Organisms → Viruses → Predicted Viral3059Open in IMG/M
3300020396|Ga0211687_10149909Not Available963Open in IMG/M
3300020404|Ga0211659_10018579Not Available3432Open in IMG/M
3300020404|Ga0211659_10522672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239505Open in IMG/M
3300020406|Ga0211668_10052462All Organisms → Viruses → Predicted Viral1812Open in IMG/M
3300020408|Ga0211651_10100252All Organisms → Viruses → Predicted Viral1197Open in IMG/M
3300020413|Ga0211516_10245096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239814Open in IMG/M
3300020430|Ga0211622_10342013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239641Open in IMG/M
3300020431|Ga0211554_10423546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239614Open in IMG/M
3300020436|Ga0211708_10298359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239655Open in IMG/M
3300020438|Ga0211576_10001938Not Available15271Open in IMG/M
3300020438|Ga0211576_10188204All Organisms → Viruses → Predicted Viral1104Open in IMG/M
3300020438|Ga0211576_10298622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239838Open in IMG/M
3300020442|Ga0211559_10178409Not Available1007Open in IMG/M
3300020445|Ga0211564_10071586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1729Open in IMG/M
3300020445|Ga0211564_10598842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239535Open in IMG/M
3300020447|Ga0211691_10413609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239545Open in IMG/M
3300020450|Ga0211641_10338753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239731Open in IMG/M
3300020451|Ga0211473_10108445Not Available1420Open in IMG/M
3300020452|Ga0211545_10038309All Organisms → Viruses → Predicted Viral2349Open in IMG/M
3300020454|Ga0211548_10274520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239821Open in IMG/M
3300020455|Ga0211664_10574656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239511Open in IMG/M
3300020457|Ga0211643_10499316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239598Open in IMG/M
3300020465|Ga0211640_10052669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2394Open in IMG/M
3300020469|Ga0211577_10581848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239669Open in IMG/M
3300020474|Ga0211547_10050284All Organisms → Viruses → Predicted Viral2242Open in IMG/M
3300020475|Ga0211541_10045363All Organisms → Viruses → Predicted Viral2211Open in IMG/M
3300021185|Ga0206682_10056302Not Available2116Open in IMG/M
3300021960|Ga0222715_10593929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239573Open in IMG/M
(restricted) 3300024255|Ga0233438_10336024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239568Open in IMG/M
3300024344|Ga0209992_10033579All Organisms → Viruses → Predicted Viral2590Open in IMG/M
3300024344|Ga0209992_10380600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239561Open in IMG/M
3300024346|Ga0244775_11437454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239529Open in IMG/M
3300025102|Ga0208666_1082289Not Available826Open in IMG/M
3300025120|Ga0209535_1034692All Organisms → Viruses → Predicted Viral2333Open in IMG/M
3300025137|Ga0209336_10006606All Organisms → Viruses → Predicted Viral4990Open in IMG/M
3300025137|Ga0209336_10010449All Organisms → Viruses → Predicted Viral3706Open in IMG/M
3300025137|Ga0209336_10044404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED2391411Open in IMG/M
3300025168|Ga0209337_1032405All Organisms → Viruses → Predicted Viral2882Open in IMG/M
3300026258|Ga0208130_1184411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239541Open in IMG/M
3300026321|Ga0208764_10026268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M3198Open in IMG/M
3300027779|Ga0209709_10035058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium3066Open in IMG/M
3300027906|Ga0209404_10083990Not Available1858Open in IMG/M
3300028194|Ga0257106_1091647Not Available1102Open in IMG/M
3300028194|Ga0257106_1188806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239711Open in IMG/M
3300028197|Ga0257110_1183182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239821Open in IMG/M
3300028197|Ga0257110_1267401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239630Open in IMG/M
3300029787|Ga0183757_1039256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239908Open in IMG/M
3300031519|Ga0307488_10591044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239646Open in IMG/M
3300031630|Ga0308004_10361012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239546Open in IMG/M
3300031644|Ga0308001_10011916All Organisms → Viruses → Predicted Viral3777Open in IMG/M
3300032006|Ga0310344_11106310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239661Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine30.23%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine24.42%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater15.70%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface4.07%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine2.91%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.91%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.74%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.74%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.74%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.16%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.58%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.58%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.58%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine0.58%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.58%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.58%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.58%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.58%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.58%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.58%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.58%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.58%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.58%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.58%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.58%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000149Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10mEnvironmentalOpen in IMG/M
3300000168Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10mEnvironmentalOpen in IMG/M
3300000265Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10EnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002242Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey matEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005430Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69EnvironmentalOpen in IMG/M
3300005432Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78EnvironmentalOpen in IMG/M
3300005934Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_BEnvironmentalOpen in IMG/M
3300006166Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91EnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006332Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200mEnvironmentalOpen in IMG/M
3300006336Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500mEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006900Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_AEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007283Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_BEnvironmentalOpen in IMG/M
3300007514Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020238Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068)EnvironmentalOpen in IMG/M
3300020240Marine microbial communities from Tara Oceans - TARA_B000000477 (ERX556046-ERR598982)EnvironmentalOpen in IMG/M
3300020246Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105)EnvironmentalOpen in IMG/M
3300020253Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945)EnvironmentalOpen in IMG/M
3300020257Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX555911-ERR599048)EnvironmentalOpen in IMG/M
3300020294Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153)EnvironmentalOpen in IMG/M
3300020296Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140)EnvironmentalOpen in IMG/M
3300020312Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977)EnvironmentalOpen in IMG/M
3300020335Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035)EnvironmentalOpen in IMG/M
3300020349Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859)EnvironmentalOpen in IMG/M
3300020378Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020381Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020406Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024)EnvironmentalOpen in IMG/M
3300020408Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118)EnvironmentalOpen in IMG/M
3300020413Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092)EnvironmentalOpen in IMG/M
3300020430Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)EnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020445Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087)EnvironmentalOpen in IMG/M
3300020447Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159)EnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020452Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020455Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020465Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300020475Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300026258Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes)EnvironmentalOpen in IMG/M
3300026321Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031630Marine microbial communities from water near the shore, Antarctic Ocean - #38EnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M
3300032006Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1001651743300000115MarineMKNIETKQKEFVAVAKEMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPEFRIGRGQYNLPTFAETVSESTDELQSEIVNDSE*
LPaug09P1610mDRAFT_100490123300000149MarineMKNIETKQKEFVSVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFAETMSESTDEIQSEIVNDSE*
LPaug09P1610mDRAFT_101112023300000149MarineMKNITTTQQEFVSTAKEMFGDNTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
LPjun09P1210mDRAFT_101489023300000168MarineMKNIETLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFEEVNTENDSE*
LP_A_09_P04_10DRAFT_100387263300000265MarineMKNIETKQKEFVAVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFAETMSESTDEIQSEIVNDSE*
BBAY92_1011234123300000947Macroalgal SurfaceAKEMFGDDTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYKLPTFEESMAQTNTESDSE*
BBAY94_1007213833300000949Macroalgal SurfaceMKNLTTTQQEFVSTAKEMFGDDTTQVSRQDVIKMINDKGVKYPVWLLKTPTYRIGRGQYTLPTFDDVAETTTTESDSE*
BBAY93_1008607513300000973Macroalgal SurfaceVSTAKEMFGDDTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
JGI24006J15134_1000348833300001450MarineMKNITDTQKNFVSTAKEMFGESTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEESIAQAQTTTESDSE*
JGI24006J15134_1003382223300001450MarineMKNIETLQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE*
JGI24006J15134_1005098023300001450MarineMKNIETLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVNTENDSE*
JGI24005J15628_1000793333300001589MarineMKNITTQQEFVSTAKEMFGDNTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
JGI24005J15628_1008951213300001589MarineKNIETKQKEFVAVAKEMFGDTTTQVSRKDVVQMINTKGVQYPVWLLKSPEFRIGRGQYSLPTFAETISESTDEIQSEIVNDSE*
JGI24005J15628_1009946923300001589MarineMKNIDTLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVNTENDSE*
KVWGV2_1028748423300002242Marine SedimentMKNLTTTQQEFVSTAKEMFGDDTSQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0055584_10122347923300004097Pelagic MarineMKNITDTQKNFVSTAKEMFGESTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEESIAQVQTTTESDSE*
Ga0068511_107910623300005057Marine WaterMKNLTTTQQEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE*
Ga0066849_1025971013300005430MarineMKNIESVQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKTPTYRIGRGQYKLPTFDEVQNETTTESDSE*
Ga0066845_1039976813300005432MarineMKNLTTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0066377_1012586913300005934MarineMKNLTTTQKEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE*
Ga0066836_1032846813300006166MarineIMKNITTTQKEFVSTAKEMFGENTTQLTRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDDVVTEATETTEASSESVSE*
Ga0075446_1001299933300006190MarineMKNIEIKQKEFVAVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFAETMSESTDEIQSEIVNDSE*
Ga0075445_1004848523300006193MarineMKNIETLQKTFVGIAKDMFGETKTKVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVQNETTTELDSE*
Ga0075445_1018339913300006193MarineKQKEFVAVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFAETMSESTDEIQSEIVNDSE*
Ga0068500_142912123300006332MarineMKNLSTTQQEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE*
Ga0068502_191774723300006336MarineMDNIKLLNTQKEFVSVAKEMFGENTTKVSRKDVVKMIKDKSIKYPVWLLKSPTYRIGRGQYNLP
Ga0098038_117754123300006735MarineMKNLTTTQQEFVSTAKEMFGDNTTKVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0098038_118513633300006735MarineEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEQSMAQDQTTTESDSE*
Ga0098038_128314513300006735MarineKQVYLKSCLIERKYIMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0098037_108912823300006737MarineMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0098037_113802923300006737MarineMKNLTTTQQEFVSTAKEMFGDDTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0098042_117361923300006749MarineMKNLTTTQQEFVSTAKEMFGENTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0098054_114487023300006789MarineMKNLTTTQQEFVSTAKEMFGDDTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDDVVTEATETTEASSESVSE*
Ga0066376_1005065713300006900MarineMKNIETLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVQNETTTELDSE*
Ga0075444_1004732413300006947MarineGKYIMKNIEIKQKEFVAVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYILPTFTETMSESTDEIQSEIVNDSE*
Ga0066366_1044852813300007283MarineMKNLTTTQQEFVSTAKEMFGDDTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTE
Ga0105020_119205513300007514MarineSVAKDMFGENTTKVSRKEVVQMINDRSIKYPVWLLKSPTYRIGRGQYNLPTFEDAMSTETESVVEETVVNDTE*
Ga0102817_104549713300007555EstuarineMKNIETLQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGSGQYKLPTFDD
Ga0105744_111950023300007863Estuary WaterMKNIETKQKEFVAVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFAETMSESTDEIQSEIVNDS
Ga0110931_110075413300007963MarineMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQITTESDSE*
Ga0115552_132098423300009077Pelagic MarineMKNITTQQEFVSTAKEMFGENTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0114995_1058764723300009172MarineMKNIDTLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTLDEVNTQNDSE*
Ga0114995_1071782623300009172MarineMKNIETKQKEFVSVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFEETVSESADEIQSEIVNDSE*
Ga0115551_140734213300009193Pelagic MarineMKNIETLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDE
Ga0114998_1039185113300009422MarineMKNIDTLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVQNETTTELDSE*
Ga0114997_1014712913300009425MarineMKNIETKQKEFVSVAKEMFGDTTTQVSRKDVVQMISTKGVQYPVWLLKSPTYRIGRGQYSLPTFEETVSESADEIQSEIVNDSE*
Ga0114915_108814123300009428Deep OceanMKNIETLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVNTQNDSE*
Ga0115554_134784223300009472Pelagic MarineMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTAESDSE*
Ga0114932_1001090433300009481Deep SubsurfaceMKNIETKQKEFVAVAKEMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPTYRIGRGQYNLPTFEETISESTDELQSEIVNDSE*
Ga0114932_1084072913300009481Deep SubsurfaceMKNIVDTQKNFVSVAKEMFGEDTNEVSSQDVIKMINDKGVKYPVWLLKSPAYRIGRGKYSLPTFEQSM
Ga0115004_1095953523300009526MarineIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTLDEVNTQNDSE*
Ga0115013_1035503313300009550MarineSCLIERKYIMKNLTTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0115013_1040450713300009550MarineMKNIVDTQKNFVSVAKEMFGENTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEQSMAQDQTTTESDSE*
Ga0115011_1006291623300009593MarineMKNITTTQKEFVSTAKEMFGENTTQLTRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDDVVTEATETTEASSESVSE*
Ga0114933_1001258133300009703Deep SubsurfaceMKNIETKQKEFVAVAKDMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPTYRIGRGQYNLPTFEETISESTDELQSEIVNDSE*
Ga0114933_1005369923300009703Deep SubsurfaceMKNIITTQKEFVSTAKEMFGENTTQVSRKDVIKMINDKGVKYPVWLLKTPTYRIGRGQYTLPTFDDVAETTTTESDSE*
Ga0114933_1028217933300009703Deep SubsurfaceMKNIVDTQKNFVSVAKEMFGENTTEVSRQDVIKMINDKGVKYPVWLLKSPAYRIGRGKYSLPTFEQSMAQDQITTESDSE*
Ga0115000_1086512223300009705MarineMKDIYTLQKTFVGIAKEVFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTLDEVNTQNDSE*
Ga0098043_121073813300010148MarineMIAYKNNNKLHYERKYIMKNLTTTQQEFVSTAKEMFGDDTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE*
Ga0098059_101183723300010153MarineMKNITTTQQEFVSTAKEMFGENTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0151677_101127023300011258MarineMKNIETVQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE*
Ga0151677_104027313300011258MarineMKNLTTTQQEFVSTAKEMFGENTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQTTTESDSE*
Ga0160423_1047377723300012920Surface SeawaterMKNLTTTQQEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQTTTESDSE*
Ga0160423_1122180013300012920Surface SeawaterTTQQEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIKRGQYKLPTFEESMAQTNTESDSE*
Ga0163110_1020637423300012928Surface SeawaterMKNLTTTQKEFVSVAKEMFGDNTTQVSRHDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESD
Ga0163110_1092493123300012928Surface SeawaterLIEREYIMKNLTTTQKEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE*
Ga0163180_1034069923300012952SeawaterMKNLTTTQQEFVSTAKEMFGDDTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0163180_1036878723300012952SeawaterKQKEFVAVAKEMFGENTTQVSRKDVVQMINSKGVQYPVWLLKSPTYRIGRGQYNLPTFEETISESTDELQSEIVNDSE*
Ga0163179_10005971123300012953SeawaterMKNIESVQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE*
Ga0163179_1032623523300012953SeawaterMKNIETKQKEFVAVAKEMFGENTTQVSRKDVVQMINRKGVQYPVWLLKSPTYRIGRGQYNLPTFEETISESTDELQSEIVNDSE*
Ga0163111_1041221623300012954Surface SeawaterKNLTTTQQEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE*
Ga0181387_108420323300017709SeawaterMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTAESDSE
Ga0181412_101029533300017714SeawaterMKNITTTQQEFVSTAKEMFGENTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTAESDSE
Ga0181412_110597613300017714SeawaterMKNIETKQKEFVAVAKEMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPEFRIGRGQYKLPTFDDVQNETTTESDSE
Ga0181404_100972223300017717SeawaterMKNITTQQEFVSTAKEMFGENTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTAESDSE
Ga0181404_107032123300017717SeawaterMKNIETKQKEFVAVAKEMFGDTTTQVSRKDVVQMINTKGVQYPVWLLKSPEFRIGRGQYNLPTFAETVSESTDELQSEIVNDSE
Ga0181373_104897913300017721MarineMKNLTTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQITTESDSE
Ga0181398_100676713300017725SeawaterMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPT
Ga0181398_105746313300017725SeawaterNITDTQKNFVSTAKEMFGESTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0181381_103437213300017726SeawaterNITTQQEFVSTAKEMFGDNTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0181381_104753413300017726SeawaterNITTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEESIAQVQTTTESDSE
Ga0181417_112529513300017730SeawaterSCLIERKYIMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0181416_113888413300017731SeawaterMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTES
Ga0181415_105027223300017732SeawaterMKNIETKQKEFVAVAKEMFGDTTTQVSRKDVVQMINTKGVQYPVWLLKSPEFRIGRGQYNLPTFAETISESTDELQSEIVNDSE
Ga0187222_105485713300017734SeawaterNFVSTAKEMFGESTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEESIAQVQTTTESDSE
Ga0181402_107629123300017743SeawaterMKNITTTQQEFVSAAKEMFGDDTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0181397_104588623300017744SeawaterMKNITTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0181427_115668413300017745SeawaterGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE
Ga0181389_115317423300017746SeawaterMKNITTQQEFVSTAKEMFGENTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0181393_118657623300017748SeawaterVQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE
Ga0181405_110086113300017750SeawaterTTQQEFVSTAKEMFGDNTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0181408_102885723300017760SeawaterMKNIETKQKEFVAVAKEMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPEFRIGRGQYSLPTFAETMSESTDEIQSEIVNDSE
Ga0181422_101522633300017762SeawaterMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTKSDSE
Ga0181410_121139913300017763SeawaterMKNIDTLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0181406_1001105123300017767SeawaterMKNITDTQKNFVSTAKEMFGESTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEESIAQVQTTTESD
Ga0181425_101456013300017771SeawaterKSCLIERKYIMKNITTQQEFVSTAKEMFGENTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTIESDSE
Ga0181394_120239523300017776SeawaterMKNIESVQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFEEVNTENDSE
Ga0181380_106417123300017782SeawaterMKNITTQQEFVSTAKEMFGENTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFD
Ga0181379_127375413300017783SeawaterIMKNIESVQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE
Ga0206125_1004296423300020165SeawaterMKNITTTQQEFVSTAKEMFGENTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0211492_109443613300020238MarineMKNIETKQKEFVAVAKEMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPEFRIGRGQYNLPTFAETISESTDELQSEIVNDSE
Ga0211494_102843123300020240MarineMKNITTTQQEFVSTAKEMFGDNTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0211494_105228223300020240MarineMKNIETKQKEFVAVAKEMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPTYRIGRGQYNLPTFAETISESTDELQSEIVNDSE
Ga0211707_100128763300020246MarineMKNLTTTQKEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE
Ga0211685_100330913300020253MarineMKNIETKQKEFVAVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFAETMSESTDEIQSEIVNDSE
Ga0211704_107750513300020257MarineMKNLTTTQQEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE
Ga0211520_107791313300020294MarineMKNIETKQKEFVAVAKEMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPTYRIGRGQYNLPTFEETISESTDELQSEIVNDSE
Ga0211474_102863413300020296MarineMKNIETKQKEFVAVAKEMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPTYRIGRGQYNLPTF
Ga0211474_107458313300020296MarineMKNLTTTQQEFVSTAKEMFGDDTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDS
Ga0211542_102390823300020312MarineMKNIVDTQKNFVSVAKEMFGENTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEQSMAQDQTTTESDSE
Ga0211690_112796313300020335MarineMKNIETLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFEEVNTENDSE
Ga0211511_104931233300020349MarineKEMFGENTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEESIAQVQTTTESDSE
Ga0211511_107938723300020349MarineMKNLTTTQQEFVSTAKEMFGDDTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0211527_1007503723300020378MarineMKNITTTQKEFVSVAKDMFGENTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYKLPTFEESMAQTNTESDSE
Ga0211652_1000866063300020379MarineNYVKQVYLQSCLIERKYIMKNITTTQQEFVSTAKEMFGENTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0211476_1026432433300020381MarineMKNIVDTQKNFVSVAKEMFGENTTEVSRQDVIKMINDKGVKYPVWLLKSPAYRIGRGKYSLPTFEQSMAQDQITTESDSE
Ga0211686_1000285943300020382MarineMKNIEIKQKEFVAVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFAETMSESTDEIQSEIVNDSE
Ga0211686_1040312113300020382MarineMKNIETLQKTFVGIAKDMFGETKTKVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVQNETTTESDSE
Ga0211677_1004205123300020385MarineMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0211677_1021053633300020385MarineMKNITDTQKNFVSTAKEMFGESTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEESIAQVQTTTESDSE
Ga0211678_1002464623300020388MarineMKNIESVQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDNVQNETTTESDSE
Ga0211687_1014990913300020396MarineMKNIETLQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE
Ga0211659_1001857933300020404MarineMKNLTTTQQEFVSTAKEMFGDNTTKVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0211659_1052267213300020404MarineFVSTAKEMFGDNTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIKRGQYKLPTFEESMAQTNTESDSE
Ga0211668_1005246223300020406MarineMKNLSTTQQEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE
Ga0211651_1010025223300020408MarineMKNLTTTQQEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQTTTESDSE
Ga0211516_1024509633300020413MarineMKNITDTQKNFVSTAKEMFGENTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEESIAQVQTTTESDSE
Ga0211622_1034201313300020430MarineTTQKEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE
Ga0211554_1042354613300020431MarineMKNIETKQKEFVAVAKEMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPEFRIGRGQYNLPTFAETVSESTDELQSEIVNDSE
Ga0211708_1029835923300020436MarineMKNITTTQKEFVSVAKDMFGDNTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYKLPTFEESMAQTNTESDSE
Ga0211576_1000193843300020438MarineMKNITDTQKNFVSTAKEMFGESTTEVSRQDVIKMINDKGIKYPVWLLKSPTYRIGRGKYSLPTFEESIAQVQTTTESDSE
Ga0211576_1018820423300020438MarineMKNIETVQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE
Ga0211576_1029862213300020438MarineMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQ
Ga0211559_1017840913300020442MarineLTTTQQEFVSVAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQTTTESDSE
Ga0211564_1007158613300020445MarineMKNITTTQKEFVSTAKEMFGENTTQLTRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDDVVTEATETTEASIESVSE
Ga0211564_1059884223300020445MarineMKNIESVQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKTPTYRIGRGQYKLPTFDEVQNETTTESDSE
Ga0211691_1041360923300020447MarineMKNIETLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVNTENDSE
Ga0211641_1033875323300020450MarineMKNLTTTQQEFVSTAKEMFGDNTTKVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTE
Ga0211473_1010844523300020451MarineMKNIESVQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVQNETTTESDSE
Ga0211545_1003830923300020452MarineMKNIESVQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE
Ga0211548_1027452013300020454MarineMKNIESVQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE
Ga0211664_1057465613300020455MarineMKNLSTTQQEFVSVAKEMFGDNTTKVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTE
Ga0211643_1049931623300020457MarineMKNITTTQKEFVSTAKEMFGDNTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIKRGQYKLPTFEESMAQTNTESDSE
Ga0211640_1005266933300020465MarineMKNIITTQKEFVSTAKEMFGENTTQVSRKDVIKMINDKGVKYPVWLLKTPTYRIGRGQYTLPTFDDVAETTTTESDSE
Ga0211577_1058184823300020469MarineMKNITTQQEFVSTAKEMFGENTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0211547_1005028423300020474MarineMKNITTTQQEFVSTAKEMFGDDTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0211541_1004536333300020475MarineMKNIESVQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTELDSE
Ga0206682_1005630233300021185SeawaterLIERKYIMKNIETLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVNTENDSE
Ga0222715_1059392923300021960Estuarine WaterNITTQQEFVSTAKEMFGENTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
(restricted) Ga0233438_1033602423300024255SeawaterYKKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDDVQNETTTESDSE
Ga0209992_1003357913300024344Deep SubsurfaceMKNIETKQKEFVAVAKDMFGENTTQVSRKDVVQMINTKGVQYPVWLLKSPTYRIGRGQYNLPTFEETISESTDELQSEIVNDSE
Ga0209992_1038060013300024344Deep SubsurfaceMKNLTTTQQEFVSTAKEMFGDDTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0244775_1143745413300024346EstuarineMKNIETVQKTFVGIAKDMFGETKSEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLP
Ga0208666_108228913300025102MarineQVYLKSCLIERKYIMKNITTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0209535_103469223300025120MarineMKNIETKQKEFVSVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFEETVSESADEIQSEIVND
Ga0209336_1000660633300025137MarineMKNITTTQQEFVSTAKEMFGDNTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTAESDSE
Ga0209336_1001044923300025137MarineMKNIETKQKEFVSVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFEETVSESADEIQSEIVNDSE
Ga0209336_1004440423300025137MarineMKNITDTQKNFVSTAKEMFGESTTEVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGKYSLPTFEESIAQAQTTTESDSE
Ga0209337_103240513300025168MarineMKNITTTQQEFVSTAKEMFGDNTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTT
Ga0208130_118441113300026258MarineMKNLTTTQQEFVSTAKEMFGDNTTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0208764_1002626883300026321MarineEYIMKNITTTQKEFVSTAKEMFGENTTQLTRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDDVVTEATETTEASSESVSE
Ga0209709_1003505823300027779MarineMKNIDTLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTLDEVNTQNDSE
Ga0209404_1008399033300027906MarineMKNITTTQKEFVSTAKEMFGENTTQLTRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDDVVTEATETTEASSESVSE
Ga0257106_109164723300028194MarineLKREYIMKNIETKQKEFVAVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFAETMSESTDEIQSEIVNDSE
Ga0257106_118880613300028194MarineMKNITTTQQEFVSTAKEMFGENTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYSLPTFDQTTTESDSE
Ga0257110_118318223300028197MarineMKNIETKQKEFVAVAKEMFGDTTTQVSRKDVVQMINTKGVQYPVWLLKSPEFRIGRGQYSLPTFAETISESTDEIQSEIVNDSE
Ga0257110_126740123300028197MarineQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVNTENDSE
Ga0183757_103925623300029787MarineMKNLTTTQQEFVSTAKEMFGDDTTQVSRQEVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE
Ga0307488_1059104413300031519Sackhole BrineMKNIDTLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTFDEVNTENDSG
Ga0308004_1036101213300031630MarineMKNIETLQKTFVGIAKDMFGETKTEVSRKEVIQMINDKGAKYPVWLLKSPTYRIGRGQYKLPTLDEVNTQNDSE
Ga0308001_1001191673300031644MarineKQKEFVAVAKEMFGDTTTQVSRKDVVQMITTKGVQYPVWLLKSPEYRIGRGQYSLPTFAETMSESTDEIQSEIVNDSE
Ga0310344_1110631023300032006SeawaterMKNLTTTQQEFVSVAKEMFGVITTQVSRQDVIKMINDKGVKYPVWLLKSPTYRIGRGQYTLPTFDQVTTESDSE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.