Basic Information | |
---|---|
Family ID | F035714 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 171 |
Average Sequence Length | 45 residues |
Representative Sequence | VFPLVENPGAVFVPKARLYVVDEDRQVIAGPLVVARRRAYHREW |
Number of Associated Samples | 144 |
Number of Associated Scaffolds | 171 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.12 % |
% of genes near scaffold ends (potentially truncated) | 97.08 % |
% of genes from short scaffolds (< 2000 bps) | 87.13 % |
Associated GOLD sequencing projects | 136 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (23.977 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.444 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.632 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 29.17% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 171 Family Scaffolds |
---|---|---|
PF00886 | Ribosomal_S16 | 54.97 |
PF02978 | SRP_SPB | 36.84 |
PF04286 | DUF445 | 5.85 |
PF08032 | SpoU_sub_bind | 0.58 |
PF05532 | CsbD | 0.58 |
PF13485 | Peptidase_MA_2 | 0.58 |
PF01746 | tRNA_m1G_MT | 0.58 |
COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
---|---|---|---|
COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 54.97 |
COG0541 | Signal recognition particle GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 36.84 |
COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 5.85 |
COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 5.85 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001305|C688J14111_10206541 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300001356|JGI12269J14319_10032310 | All Organisms → cellular organisms → Bacteria | 3445 | Open in IMG/M |
3300002558|JGI25385J37094_10105859 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300002560|JGI25383J37093_10155476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 604 | Open in IMG/M |
3300002909|JGI25388J43891_1081233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
3300004463|Ga0063356_103383395 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300004463|Ga0063356_104993122 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300005174|Ga0066680_10501732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 763 | Open in IMG/M |
3300005332|Ga0066388_101517943 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300005441|Ga0070700_100015843 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4283 | Open in IMG/M |
3300005444|Ga0070694_101366128 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300005446|Ga0066686_10315792 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300005454|Ga0066687_10813049 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
3300005518|Ga0070699_100097839 | All Organisms → cellular organisms → Bacteria | 2571 | Open in IMG/M |
3300005545|Ga0070695_101781541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
3300005553|Ga0066695_10066362 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2173 | Open in IMG/M |
3300005554|Ga0066661_10338390 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300005555|Ga0066692_10326907 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300005559|Ga0066700_10446082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 909 | Open in IMG/M |
3300005561|Ga0066699_10971654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 589 | Open in IMG/M |
3300005569|Ga0066705_10240879 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300005569|Ga0066705_10878709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 532 | Open in IMG/M |
3300005713|Ga0066905_100634602 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300005876|Ga0075300_1008441 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300005876|Ga0075300_1040659 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300005876|Ga0075300_1047565 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300005878|Ga0075297_1004413 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300006034|Ga0066656_10034772 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
3300006755|Ga0079222_10424345 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300006797|Ga0066659_11381969 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300006844|Ga0075428_100231196 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
3300006854|Ga0075425_100354803 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
3300006854|Ga0075425_101155463 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300006881|Ga0068865_100883239 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300007255|Ga0099791_10602993 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300009012|Ga0066710_101109538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1224 | Open in IMG/M |
3300009088|Ga0099830_10278285 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300009089|Ga0099828_10199541 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
3300009089|Ga0099828_11986884 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
3300009090|Ga0099827_10768954 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300009090|Ga0099827_11266156 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300009137|Ga0066709_102254210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 749 | Open in IMG/M |
3300009162|Ga0075423_11491019 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300009822|Ga0105066_1024525 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300009822|Ga0105066_1042923 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300010087|Ga0127492_1054705 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 597 | Open in IMG/M |
3300010111|Ga0127491_1138189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 585 | Open in IMG/M |
3300010112|Ga0127458_1004774 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300010127|Ga0127489_1129090 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
3300010130|Ga0127493_1044708 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300010130|Ga0127493_1167876 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300010301|Ga0134070_10105474 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300010301|Ga0134070_10209873 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300010320|Ga0134109_10068426 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300010320|Ga0134109_10078502 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300010320|Ga0134109_10499665 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
3300010333|Ga0134080_10195177 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300010336|Ga0134071_10709038 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
3300011120|Ga0150983_12140338 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300011270|Ga0137391_11479089 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300011271|Ga0137393_10158090 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
3300011429|Ga0137455_1046739 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300012096|Ga0137389_11045446 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300012174|Ga0137338_1049291 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300012200|Ga0137382_10396338 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300012204|Ga0137374_10395743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1099 | Open in IMG/M |
3300012205|Ga0137362_10831681 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300012211|Ga0137377_11008257 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300012285|Ga0137370_10016367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3648 | Open in IMG/M |
3300012349|Ga0137387_10198133 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300012349|Ga0137387_10771497 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300012349|Ga0137387_11282409 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
3300012355|Ga0137369_10584841 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300012356|Ga0137371_10358528 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300012361|Ga0137360_11909162 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 500 | Open in IMG/M |
3300012373|Ga0134042_1112816 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
3300012374|Ga0134039_1142640 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300012379|Ga0134058_1050034 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
3300012384|Ga0134036_1174836 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300012386|Ga0134046_1127759 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300012395|Ga0134044_1098518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
3300012397|Ga0134056_1101517 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300012398|Ga0134051_1008284 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300012398|Ga0134051_1046497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
3300012399|Ga0134061_1130648 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300012400|Ga0134048_1082579 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300012400|Ga0134048_1102709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
3300012402|Ga0134059_1152653 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300012402|Ga0134059_1393060 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300012403|Ga0134049_1194468 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300012406|Ga0134053_1040781 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
3300012407|Ga0134050_1065096 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
3300012410|Ga0134060_1410854 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300012685|Ga0137397_10495751 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300012922|Ga0137394_10111509 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
3300012927|Ga0137416_10222952 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
3300012927|Ga0137416_11315969 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300012972|Ga0134077_10077623 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300012976|Ga0134076_10520211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
3300012977|Ga0134087_10007734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3589 | Open in IMG/M |
3300014154|Ga0134075_10335624 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300014157|Ga0134078_10011584 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
3300014326|Ga0157380_11696066 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300014873|Ga0180066_1125959 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 528 | Open in IMG/M |
3300014880|Ga0180082_1055211 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300015052|Ga0137411_1061677 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
3300015052|Ga0137411_1302123 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1512 | Open in IMG/M |
3300015054|Ga0137420_1415134 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300015357|Ga0134072_10408912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
3300017654|Ga0134069_1072424 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300017656|Ga0134112_10457745 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
3300017656|Ga0134112_10485829 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
3300017657|Ga0134074_1001859 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 6949 | Open in IMG/M |
3300017928|Ga0187806_1301278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 565 | Open in IMG/M |
3300017961|Ga0187778_10078950 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
3300018072|Ga0184635_10114962 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300018077|Ga0184633_10567522 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
3300018079|Ga0184627_10364613 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300018431|Ga0066655_10020442 | All Organisms → cellular organisms → Bacteria | 3074 | Open in IMG/M |
3300018468|Ga0066662_10763196 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300019259|Ga0184646_1509068 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300019869|Ga0193705_1018302 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
3300021046|Ga0215015_10928763 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2208 | Open in IMG/M |
3300021051|Ga0206224_1012832 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300021307|Ga0179585_1129074 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
3300022531|Ga0242660_1029423 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300024330|Ga0137417_1115569 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300024330|Ga0137417_1216198 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300025155|Ga0209320_10215093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 829 | Open in IMG/M |
3300025312|Ga0209321_10551776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
3300025915|Ga0207693_11220557 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
3300026075|Ga0207708_10697844 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300026304|Ga0209240_1087398 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300026307|Ga0209469_1110362 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300026308|Ga0209265_1018343 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2172 | Open in IMG/M |
3300026310|Ga0209239_1211811 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 686 | Open in IMG/M |
3300026315|Ga0209686_1208146 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
3300026320|Ga0209131_1197630 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300026324|Ga0209470_1121578 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300026326|Ga0209801_1160114 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 943 | Open in IMG/M |
3300026330|Ga0209473_1010212 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4670 | Open in IMG/M |
3300026332|Ga0209803_1036957 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
3300026343|Ga0209159_1031869 | All Organisms → cellular organisms → Bacteria | 2804 | Open in IMG/M |
3300026343|Ga0209159_1137364 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300026507|Ga0257165_1055897 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300026530|Ga0209807_1281204 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 562 | Open in IMG/M |
3300026536|Ga0209058_1045013 | All Organisms → cellular organisms → Bacteria | 2568 | Open in IMG/M |
3300026537|Ga0209157_1298489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 592 | Open in IMG/M |
3300026537|Ga0209157_1335235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
3300027384|Ga0209854_1073328 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 603 | Open in IMG/M |
3300027681|Ga0208991_1009764 | All Organisms → cellular organisms → Bacteria | 2865 | Open in IMG/M |
3300027725|Ga0209178_1090075 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300027846|Ga0209180_10064462 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
3300027846|Ga0209180_10420783 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 755 | Open in IMG/M |
3300027862|Ga0209701_10657144 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
3300027875|Ga0209283_10703073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
3300027882|Ga0209590_10705866 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 645 | Open in IMG/M |
3300027903|Ga0209488_11151279 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
3300027909|Ga0209382_10137393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2841 | Open in IMG/M |
3300028719|Ga0307301_10064213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1140 | Open in IMG/M |
3300031081|Ga0308185_1016567 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300031199|Ga0307495_10250604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
3300032180|Ga0307471_100389014 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300032180|Ga0307471_104154021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
3300032205|Ga0307472_100338392 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300032205|Ga0307472_102487732 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
3300032205|Ga0307472_102566760 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
3300032515|Ga0348332_13163321 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300033158|Ga0335077_12024132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
3300033407|Ga0214472_10610095 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300034090|Ga0326723_0026472 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 23.98% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.04% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.51% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.34% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.92% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.75% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.17% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.17% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.17% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.17% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.17% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.58% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.58% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.58% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.58% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J14111_102065411 | 3300001305 | Soil | VAVIPLVQDPGTVFVPKARLYVVNDAREVLAGPLVVTRRRSY |
JGI12269J14319_100323101 | 3300001356 | Peatlands Soil | VPLVENPGLVFGPKARVFIVDEERRVVAGPLLVARRRSY |
JGI25385J37094_101058591 | 3300002558 | Grasslands Soil | VFPLVENPGAVFTPKARLLVVNEERAVVAGPLVVARRRAY |
JGI25383J37093_101554763 | 3300002560 | Grasslands Soil | VSVFPLVENPGAVFVPKARLFVVDEARRVIAGPLVVARRRAYH |
JGI25388J43891_10812332 | 3300002909 | Grasslands Soil | VLPLVENPGAVFSPKARLLVVNEERRVVAGPLVVARRRAYHR |
Ga0063356_1033833953 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VIPLVESPGTVFTPKARLYVLNEERAVLAGPLVLSRRRSYHREWLLAFEG |
Ga0063356_1049931223 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VVPLVKNPGAVFLPRARLYVVDEERRVIAGPLVVARRRAY |
Ga0066680_105017321 | 3300005174 | Soil | VENPGAVFVPKARLYVVNAERQVVAGPLVVARRRAYHREW |
Ga0066388_1015179433 | 3300005332 | Tropical Forest Soil | LIPLVESPGAVLQPKAEVYVVDEARRVLAGPLFVARRRAYHREWLIGFA |
Ga0070700_1000158435 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VIPLVENVGTLFAPKARLFVLNESREVLAGPLAIARRRSYHRE |
Ga0070694_1013661281 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVFPLVENPGALLVPKARVYVVDEDRKVLAGPLVLARRRAYHREWLLGFE |
Ga0066686_103157921 | 3300005446 | Soil | VAIHPLVENPGSVFAPKARLYVVTEDRKVVAGPLVVARRRAYHRDWLLGFV |
Ga0066687_108130492 | 3300005454 | Soil | VLPLVENPGAVFTPQARLLVVNEDRRVVAGPLVIARRRAYHREWLLGF |
Ga0070699_1000978391 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VFPLVEHPGSVFVPKAQLYVMDEDRKILAGPLVLARRRAYHREWLLGFEGITSR |
Ga0070695_1017815412 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVIPLVANAGAVFGPKAQLYVVDEERRVIAGPLIVARRRAYHREWLLSFVGVTGRAAV |
Ga0066695_100663624 | 3300005553 | Soil | VFPLVENPGAVFTPKARLLVVNEERQIVAGPLVVARRRA |
Ga0066661_103383903 | 3300005554 | Soil | VEVVPLVENPGAVFAPRARLYVVDESQRVLAGPLVLARRRAYHR |
Ga0066692_103269073 | 3300005555 | Soil | VVPLVENPGAVFTPKARLLVVNEERRVVAGPLVVARRRAYHREWLLGFVGVTS |
Ga0066700_104460821 | 3300005559 | Soil | VENPGAVFVPKARLYVVNAERQVVAGPLVVARRRAYHREWLLGF |
Ga0066699_109716541 | 3300005561 | Soil | VVPLVENPGAVFTPKARLLVVTEERRVVAGPLVVARRRAYHREWLLGFVGVTSRAV |
Ga0066705_102408791 | 3300005569 | Soil | VAILPLVENPGQVFAPKTRLYVVDDEHRVLAGPLVVARRR |
Ga0066705_108787091 | 3300005569 | Soil | VVPLVENPGAVFTPHARLLVVTEERRVVAGPLVVARR |
Ga0066905_1006346021 | 3300005713 | Tropical Forest Soil | VIPLVEAPGVVFQPKAEVYVVDEARRVLAGPLFVAR |
Ga0075300_10084413 | 3300005876 | Rice Paddy Soil | VIPLVESPGTVFVPKARLYVLSEDRAVIAGPLVLARRRAYHREWL |
Ga0075300_10406591 | 3300005876 | Rice Paddy Soil | VPLVDTLGAVVQPKAQVWIVDEGRQVLAGPLVVARRRAYHREMLLGFA |
Ga0075300_10475651 | 3300005876 | Rice Paddy Soil | VFPLVEHPGTVFTPKARLLVVNAERQVVAGPLIVARRRAYHR |
Ga0075297_10044131 | 3300005878 | Rice Paddy Soil | VENPGAVFGPKARLLIVDERRQVLAGPLIVTRRRAYHREWLLGFQGITTRAA |
Ga0066656_100347721 | 3300006034 | Soil | VIPLVENPGTVFVPKARVYVLNEERRVLAGPLVVARRRSYHREWLLGFE |
Ga0079222_104243451 | 3300006755 | Agricultural Soil | VDNPGAVFAPKARVLVVNEDREIVAGPLIVARRRAYHREWLLSF |
Ga0066659_113819691 | 3300006797 | Soil | VVPLVENPGAVFTPKARLLVVTEERRVVAGPLVVARRRAYHREWLLGFVGVTSRA |
Ga0075428_1002311964 | 3300006844 | Populus Rhizosphere | VAVIPLVENVGTLFVPKARLYVLNDARQVLAGPLVIARRRSYHREWLLGFEG |
Ga0075425_1003548031 | 3300006854 | Populus Rhizosphere | VAVIPLVENPGTVFVPKARLYVLNEARDVLAGPLVV |
Ga0075425_1011554631 | 3300006854 | Populus Rhizosphere | VAVFPLVENPGALLVPKARVYVVDEDRKVLAGPLVLARRRAYHRE |
Ga0068865_1008832393 | 3300006881 | Miscanthus Rhizosphere | VITLVENVGTLFAPKARLFVLNESREVLAGPLAIA |
Ga0099791_106029931 | 3300007255 | Vadose Zone Soil | VAVFPLVENPGGVFVPKARVFVMDEDRKILAGPLVLARRR |
Ga0066710_1011095381 | 3300009012 | Grasslands Soil | VVPLVENPGAVFTPKARLLVVNEERRVVAGPLVVARRRAYHREW |
Ga0099830_102782853 | 3300009088 | Vadose Zone Soil | VAVFPLVQNPGALLVPKARVYVVDEDRRVLAGPLVLARRRAYH |
Ga0099828_101995411 | 3300009089 | Vadose Zone Soil | VEVFPLVEHPGVVFVPKARLFVVDETRQVLAGPLVVARRRAYHRAWLLGFEGIT |
Ga0099828_119868842 | 3300009089 | Vadose Zone Soil | VQPLVQNPGAVFAPQARLYVVDEDRRVIAGPLTVARRRSYHREWLLGLAGVTREAAE |
Ga0099827_107689541 | 3300009090 | Vadose Zone Soil | VIPLVENPGVVFVPKARLYVLNEEREVVAGPLVLARRRAYHREW |
Ga0099827_112661563 | 3300009090 | Vadose Zone Soil | VSVIPLVESPGAVFQPKAELYVVDEARRVLAGPLIVARRRA |
Ga0066709_1022542103 | 3300009137 | Grasslands Soil | VIPLVENPGTVFVPKARLYVLNEARAVLAGPLVVTRRRSYHREWLL |
Ga0075423_114910193 | 3300009162 | Populus Rhizosphere | VSVLPLVEAPGAVFQPKAEVYVVDDGRRIVAGPLVVTRRRAYHREW |
Ga0105066_10245251 | 3300009822 | Groundwater Sand | VEKLGALFQPKAQVFVVDEARRVIAGPLVLARRRAYHRE |
Ga0105066_10429233 | 3300009822 | Groundwater Sand | VENPGTVFVPKARLYVLNEAREVLAGPLVVTRRRAYHREWLLGFEGI |
Ga0127492_10547051 | 3300010087 | Grasslands Soil | VENPGTVFVPKARVYILDEARAVLAGPLVVTRRRSYHREWLLGFEGVTSRA |
Ga0127491_11381891 | 3300010111 | Grasslands Soil | VAIHPLVENPGTVFAPRARLYVVTEDRKVVAGPLVVARRRAYHRDWLLGF |
Ga0127458_10047741 | 3300010112 | Grasslands Soil | VAVFPLVENPGAVFTPKARLLVVNEERQVVAGPLVVARRRA |
Ga0127489_11290903 | 3300010127 | Grasslands Soil | VSIFPLVENPGAVFVPQTRLYVVNEARQVVAGPLIV |
Ga0127493_10447083 | 3300010130 | Grasslands Soil | VAIHPLVENPGSVFAPKARLYVVTEDRKVVAGPLVVARRRAYHRDWLLGFVGVTSRAAV |
Ga0127493_11678761 | 3300010130 | Grasslands Soil | VIPLVENPGVVFVPKARLYVLNEEREVVAGPLVLARRRAYHREWL |
Ga0134070_101054743 | 3300010301 | Grasslands Soil | VIPLVEKPGTVFVPKVRLYVLNEEREVLAGPLVVSRRRGYH |
Ga0134070_102098731 | 3300010301 | Grasslands Soil | VSIFPLVENPGAVFVPQTRLYVVNEARQVVAGPLIVARR |
Ga0134109_100684263 | 3300010320 | Grasslands Soil | VAVIPLVEHPGTVFVPKARLYVLNEARVVLAGPLIVTRRRSYH |
Ga0134109_100785021 | 3300010320 | Grasslands Soil | VAVFSLVENPGAVFTPKARLLVVNEERHVVAGPLVVA |
Ga0134109_104996652 | 3300010320 | Grasslands Soil | VAVIPLVENPGTVFVPKARVYVLSEARQVLAGPLVVARRRAYQRE |
Ga0134080_101951773 | 3300010333 | Grasslands Soil | VAIHPLVENPGTVFAPRARLYVVTEDRKVVAGPLVVARR |
Ga0134071_107090383 | 3300010336 | Grasslands Soil | VENPGGVFTPKARVYVMDEDRKILAGPLVLARRRAYHREWLL |
Ga0150983_121403383 | 3300011120 | Forest Soil | VAIFPLVADPGSLLVPKARLFVVDETRKVLAGPLILGRRRAYHREWLLGF |
Ga0137391_114790891 | 3300011270 | Vadose Zone Soil | VFPLVENPGAVFTPKARLLVVNEERHVVAGPLVVAR |
Ga0137393_101580904 | 3300011271 | Vadose Zone Soil | VEVFPLVEHPGVVFVPKARLFVVDETRRVLAGPLVVARRR |
Ga0137455_10467391 | 3300011429 | Soil | VAILPLVKNPGAVFVPKARLYVVDEERRVIAGPLV |
Ga0137389_110454461 | 3300012096 | Vadose Zone Soil | VEVFPLVGHAGTVFVPKARLFVVDEARRVLAGPLVVARRRAYHR |
Ga0137338_10492911 | 3300012174 | Soil | VDKVGALLQPKAQVFVVDEARRVIAGPLVLARRRAYHREWLLGFA |
Ga0137382_103963383 | 3300012200 | Vadose Zone Soil | VEKPGTVFVPKARLYVLDEDRKVVAGPLVIARRRS |
Ga0137374_103957431 | 3300012204 | Vadose Zone Soil | VANPGAVFVPKAHVYVMDEERRVLAGPLVVTRRRAYHREWLLGFEGITSRAAVEG |
Ga0137362_108316811 | 3300012205 | Vadose Zone Soil | VFVPKARVYVLNEARAVLAGPLVVARRRAYHHEWLLGFEG |
Ga0137377_110082573 | 3300012211 | Vadose Zone Soil | VAVIPLVEKPGTVFVPKARLYVLDEDRKVLAGPLVVTRRR |
Ga0137370_100163671 | 3300012285 | Vadose Zone Soil | VAVVPLVENPGAVFTPQARLLVVTEERRVVAGPLVVARRRAYHREWLLGFVGVTS |
Ga0137387_101981331 | 3300012349 | Vadose Zone Soil | VAVFPLVQNPGALLVPKARVYVVDEDRRVLAGPLVLARRRAYHREWLLGFEGVTA |
Ga0137387_107714973 | 3300012349 | Vadose Zone Soil | VFVPKARVYVLNEERAVLAGPLVVARRRAYHREWLLGFEGVTSRA |
Ga0137387_112824092 | 3300012349 | Vadose Zone Soil | VAVIPLVETPGTVFVPKARLYVLNEAREVLAGPLVVSRRRAYHR |
Ga0137369_105848411 | 3300012355 | Vadose Zone Soil | VAVFPLVEHPGSVFVPTAQLYVVDEERKVLAGPLVLARR |
Ga0137371_103585281 | 3300012356 | Vadose Zone Soil | VAVIPLVENPGAVFGPQARLFVLDAERRVIAGPLV |
Ga0137360_119091623 | 3300012361 | Vadose Zone Soil | VFPLVENPGAVFTPKARLLVVNEERQVVAGPLIVA |
Ga0134042_11128161 | 3300012373 | Grasslands Soil | VAVFPLVENPGAVFTPKARLLVVNEERHVVAGPLEVAVFP |
Ga0134039_11426401 | 3300012374 | Grasslands Soil | VAVVPLVENPGAVFTPQARLLVVTEERRVVAGPLVVARRRAYHREWLLGFV |
Ga0134058_10500341 | 3300012379 | Grasslands Soil | VSIFPLLENPGAVFVPQTRLYVVNEARQVVAGPLIVARRRAYHRSGCS |
Ga0134036_11748361 | 3300012384 | Grasslands Soil | VAVFPLVENPGAVFTPKARLLVVNEERHVVAGPLVVARRRA |
Ga0134046_11277591 | 3300012386 | Grasslands Soil | VFPLVENPGAVFVPRARLYVVNEERQVVAGPLIVARR |
Ga0134044_10985181 | 3300012395 | Grasslands Soil | VENPGAVFVPKARLYVVNAERQVVAGPLVVARRRAYHREWLLGFLGVTSRAVVE |
Ga0134056_11015172 | 3300012397 | Grasslands Soil | VAVIPLVEKPGTVFVPKARLYVLDEDRKVLAGPLVVTRRRAYHRNGYSASRV* |
Ga0134051_10082843 | 3300012398 | Grasslands Soil | VAVIPLVEKPGTVFVPKARLYVLNDAREVLAGPLVVT |
Ga0134051_10464973 | 3300012398 | Grasslands Soil | VAVIPLVENPGAVFGPQARLFVLDAERRVIAGPLVIARRRAYHREWLLGFV |
Ga0134061_11306481 | 3300012399 | Grasslands Soil | VIPLVENPGTVFVPRARVYVLDDARSVLAGPLVVARRRAYHR |
Ga0134048_10825792 | 3300012400 | Grasslands Soil | VAVIPLVENPGTVFVPKARLYVLNEARDVLGVRWW* |
Ga0134048_11027091 | 3300012400 | Grasslands Soil | VENPGAVFVPKARLYVVNAERQVVAGPLVVARRRAYHREWLLGFLGVTSRAVV |
Ga0134059_11526531 | 3300012402 | Grasslands Soil | VSIFPLVENPGAVFVPQTRLYVVNEARQVVAGPLIVARRRA |
Ga0134059_13930601 | 3300012402 | Grasslands Soil | VSVFPLVENPGAVFVPKARLFVVNEARQVIAGPLVVA |
Ga0134049_11944683 | 3300012403 | Grasslands Soil | VENPGAVFVPKARLYVVNAERQVVAGPLVVARRRAYHREWLL |
Ga0134053_10407811 | 3300012406 | Grasslands Soil | VAVIPLVEKPGTVFVPKARLYVLDEDRKVLAGPLVVTRRRAYHREW |
Ga0134050_10650961 | 3300012407 | Grasslands Soil | VEKPGTVFVPKARLYVLDEDRKVVAGPLGIARRRSYHREWLLGFEGVTS |
Ga0134060_14108541 | 3300012410 | Grasslands Soil | VEHPGTVFVPKARLFVVDERRQVIAGPLIVTRRRSYHREWLLGFQ |
Ga0137397_104957513 | 3300012685 | Vadose Zone Soil | VEHPGRVFVAKARVYVLNEERQVLAGPLVLSRRRA |
Ga0137394_101115092 | 3300012922 | Vadose Zone Soil | VFPLVANPGALLVPKARVYVVDEDRKVLAGPLVLARRRAYHREWLLGF* |
Ga0137416_102229523 | 3300012927 | Vadose Zone Soil | VEKPGTVFVPKARLYVLDEDRKVVAGPLVIARRRSYHREWLLGF |
Ga0137416_113159693 | 3300012927 | Vadose Zone Soil | VEKPGTVFVPKARLYVLDEDRKVLAGPLVVTRRRAYHREWLLGF |
Ga0134077_100776233 | 3300012972 | Grasslands Soil | VFPLVENPGAVFVPRARLYVVNEERQVVAGPLIVAR |
Ga0134076_105202111 | 3300012976 | Grasslands Soil | VEKPGTVFVPKARLYVLDEERKVLAGPLVVTRRRAYHREWLLGFEGVTSR |
Ga0134087_100077345 | 3300012977 | Grasslands Soil | VPLVENPGAVFTPQARLLVVTEERRVVAGPLVVARRRAYHR |
Ga0134075_103356241 | 3300014154 | Grasslands Soil | VIPLVENPGTVFVPKARVYILDEARAVLAGPLVVTRRRSYHREWL |
Ga0134078_100115844 | 3300014157 | Grasslands Soil | VAVVPLVENPGAVFTPQARLLVVTEERRVVAGPLVVARRRAYH |
Ga0157380_116960661 | 3300014326 | Switchgrass Rhizosphere | VIPLVENVGTLFAPKARLFVLNESREVLAGPLAIARRRSYHREWLIGFEGITSRA |
Ga0180066_11259591 | 3300014873 | Soil | QGGEVAVVPLVEKLGALFQPKAQVFVVDEARRVIAGPLVLARRRAYHREWLLGFAGVT* |
Ga0180082_10552111 | 3300014880 | Soil | VIPLVENPGTVFVPKARVYVLNDAREVLAGPLVIARRRAYH |
Ga0137411_10616773 | 3300015052 | Vadose Zone Soil | VENPGTVFVPKARLYVLNEERTVLAGPLVVARRRSYHREWLLGFE |
Ga0137411_13021231 | 3300015052 | Vadose Zone Soil | VEKPGTVFVPKARLYVLDEDRKVLAGPLVVTGAVP |
Ga0137420_14151341 | 3300015054 | Vadose Zone Soil | VIPLVEKPGAVFVPKMRLYVLSEEREVLAGPLVVSRRRGYHREMLLAFEGIT |
Ga0134072_104089123 | 3300015357 | Grasslands Soil | VFVPRARLYVVNEERQVVAGPLIVARRRAYHREWLLGFVGV |
Ga0134069_10724243 | 3300017654 | Grasslands Soil | VSIFPLVENPGTVFVPQTRLYVVNEARQVVAGPLIVARRRAY |
Ga0134112_104577452 | 3300017656 | Grasslands Soil | VFPLVENPGAMFTPKARLLIVSEDRQVMAGPLIVARRRAYHREWLLSFVGVTSRAVV |
Ga0134112_104858291 | 3300017656 | Grasslands Soil | VIPLVEKPGTVFVPKARLYVLDADRKVLAGPLVVTRRRAYHREW |
Ga0134074_10018591 | 3300017657 | Grasslands Soil | VENPGAVFVPKARLYVVNAERQVVAGPLVVARRRAYHREWLLGFLGV |
Ga0187806_13012783 | 3300017928 | Freshwater Sediment | VVPLVENPGSVFGPKARVFIVDDERRVVAGPLLVARRRAYHRTWLLGFVGVSSRAA |
Ga0187778_100789501 | 3300017961 | Tropical Peatland | VIPLVDGPGAVFQPKAEVYVVDEARRVVAGPLFVARRRAYHREWLIGFAG |
Ga0184635_101149623 | 3300018072 | Groundwater Sediment | VFPLVEHPGSVFVPKAQLFVMDEDRKILAGPLVLAQRRAYHRERLLGFEGVT |
Ga0184633_105675223 | 3300018077 | Groundwater Sediment | VVPRVEKLGALFQPKAQVFVVDEARRVIAGPLVLARRRAYHR |
Ga0184627_103646133 | 3300018079 | Groundwater Sediment | VFPLVANPGAVLVPKATLYVVDETRRTVAGPLVVTRRRAYHREWLLGFQGVTS |
Ga0066655_100204421 | 3300018431 | Grasslands Soil | VENPGAVFVPKARLYVVNAERQVVAGPLVVARRRAYHREWLLGFLGVTSRA |
Ga0066662_107631963 | 3300018468 | Grasslands Soil | VENPGTVFVPKARLYVLNEARDVLAGPLVVARRRSYHREWLLGFE |
Ga0184646_15090683 | 3300019259 | Groundwater Sediment | VIPLVANPGTVFVPKARVYVLNEEREVLAGPLVLSRRRA |
Ga0193705_10183023 | 3300019869 | Soil | VFPLVEHPGSVFVPKARVYVMDEDRKILAGPLVLARRRAYHREWLLGFEGITSR |
Ga0215015_109287631 | 3300021046 | Soil | VAVLPLVENPGAVFTPKARLLVINAERQVVAGPLV |
Ga0206224_10128323 | 3300021051 | Deep Subsurface Sediment | VVPLVDKLGALFQPKAQVFVVDEARRVIAGPLILARRRAYHREWLLGFSGVTSREAVE |
Ga0179585_11290741 | 3300021307 | Vadose Zone Soil | VIPLVENPGTVFVPKARLYVLNEERTVLAGPLVVARRR |
Ga0242660_10294233 | 3300022531 | Soil | VAIFPLVADPGSLLVPKARLFVVDETRKVLAGPLILGRRRAYHREWLL |
Ga0137417_11155691 | 3300024330 | Vadose Zone Soil | VIPLVEKPGTVFVPKARLYVLDEDRKVLAGPLVVTRRRAYHREWLLSASRV |
Ga0137417_12161981 | 3300024330 | Vadose Zone Soil | VFPLVENPGAVFTPKARLLVVNEERQVVAGPLRQVVAGPLVVARRRSYHREWLLSFVGVKSR |
Ga0209320_102150934 | 3300025155 | Soil | VFPLVENPGAVFTARAQVYVLDADRRVVAGPLILTRRRGYHREWL |
Ga0209321_105517761 | 3300025312 | Soil | VFPLVENPGAVFVPQAKLYVVDERRQVIAGPLLVTRRRGYQREWLLAFQGITT |
Ga0207693_112205571 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPLVENPGAVFTPKARLFVVNEERRVVAGPLVVARRR |
Ga0207708_106978443 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VIPLVENVGTLFAPKARLFVLNESREVLAGPLAIARRRSYHREWLLGFEGITS |
Ga0209240_10873981 | 3300026304 | Grasslands Soil | VIPLVENPGTVFVPKARLYVLNEARAVLAGPLVVTRRRSYHREWLLGFE |
Ga0209469_11103623 | 3300026307 | Soil | VAIHPLVENPGTVFAPRARLYVVTEDRKVVAGPLVVARRRAYHRDW |
Ga0209265_10183431 | 3300026308 | Soil | VVPLVENPGAVFTPQARLLVVTEERRVVAGPLVVARRRAYHRAWLL |
Ga0209239_12118111 | 3300026310 | Grasslands Soil | VQPLVRNPGAVFVPQARLYVVDEDRRVIAGPLTVARRRSYHREWLLALAGV |
Ga0209686_12081461 | 3300026315 | Soil | VIPLVENPGSVFVPKARLYVLNEDRAVIAGPLVVARRRAYHR |
Ga0209131_11976303 | 3300026320 | Grasslands Soil | VFPLVENPGGVFTPKARVYVMDEDRKILAGPLVLARRR |
Ga0209470_11215783 | 3300026324 | Soil | VVPLVENPGAVFTPQARLLVVTEERRVVAGPLVVARRRAYHREWLLGFVGVTSRAV |
Ga0209801_11601143 | 3300026326 | Soil | VIPLVEKPGTVFVPKARLYVLDEDRKVLAGPLVVTRRRAYHREWLLGFEGVTSRD |
Ga0209473_10102126 | 3300026330 | Soil | VAVFPLVENPGAVFTPKTRLLVVNEERHVVAGPLVVARRR |
Ga0209803_10369574 | 3300026332 | Soil | VAIHPLVENPGTVFAPRARLYVVTEDRKVVAGPLVVARRRAYHRDWLLGVV |
Ga0209159_10318694 | 3300026343 | Soil | VFPLVENPGAVFTPKARLLVVNEERQVVAGPLVVARR |
Ga0209159_11373643 | 3300026343 | Soil | VIPLVEKPGTVFVPKARLYVVDEDRKVLAGPLVVTRRRAYHRE |
Ga0257165_10558971 | 3300026507 | Soil | VIPLVENPGTVFVPKARVYVLNEERTVLAGPLVVARRRSYHREW |
Ga0209807_12812041 | 3300026530 | Soil | VVPLVENPGAVFTPQARLLVVTEERRVVAGPLVVARRRAYHREWLLGFVGVTSR |
Ga0209058_10450131 | 3300026536 | Soil | VIPLVEKPGTVFVPKVRLYVLNEEREVLAGPLVVSRRRGYHREWLLAFE |
Ga0209157_12984891 | 3300026537 | Soil | VAIHPLVENPGTVFAPRARLYVVTEDRKVVAGPLVVARRRAY |
Ga0209157_13352351 | 3300026537 | Soil | VIPLVEKPGTVFVPKARLYVLDEDRKVLAGPLVVTRRRAYHREWLLGFEGVTSR |
Ga0209854_10733283 | 3300027384 | Groundwater Sand | VVPLVQNPGAVFVPKAQVYVVDENRTVLAGPLVVTRRRAYHREWLLGFEGI |
Ga0208991_10097646 | 3300027681 | Forest Soil | VIPLVEKPGTVFVPKARLYVLDEDRKVLAGPLVVTRRRAYHREW |
Ga0209178_10900751 | 3300027725 | Agricultural Soil | VAVYPLVENPGAVFAPKARVLVVNEEREVVAGPLIVARRRAYHRGWLLSFVGVTSRAVVE |
Ga0209180_100644624 | 3300027846 | Vadose Zone Soil | VIPLVEKPGTVFVPKARLYVLDEDRKVLAGPLVVTRRRAYHREWLLGFEGVTS |
Ga0209180_104207833 | 3300027846 | Vadose Zone Soil | VFPLVQNPGALLVPKARVYVVDEDRRVLAGPLVLARRRAYHREW |
Ga0209701_106571441 | 3300027862 | Vadose Zone Soil | VEVFPLVEHPGVVFVPKARLFVVDETRQVLAGPLVVARRRAYHRAWLLGFEGITSRAV |
Ga0209283_107030732 | 3300027875 | Vadose Zone Soil | VFPLVENPGAVFVPKARLYVVDEDRQVIAGPLVVARRRAYHREW |
Ga0209590_107058661 | 3300027882 | Vadose Zone Soil | VFPLVEHPGAVFAPKARLFVVDAARRVLAGPLVVTRRRAYHRAWLLGFEGIT |
Ga0209488_111512793 | 3300027903 | Vadose Zone Soil | VAVFPLVENPGGVFTPKARVYVMDEDRKILAGPLVL |
Ga0209382_101373931 | 3300027909 | Populus Rhizosphere | VFPLVENPGGVFVPKARVYVMDEDRKILAGPLVLARRRAYHREWLLGF |
Ga0307301_100642133 | 3300028719 | Soil | VFVPKARLYVLDEDRKVVAGPLVIARRRSYHREWL |
Ga0308185_10165672 | 3300031081 | Soil | VFPLVEHPGSVFVPKAQLFVMDEDRKILAGPLVLARRRAYHRE |
Ga0307495_102506041 | 3300031199 | Soil | VIPLIENVGTLFAPKARLFVLDESREVLAGPLAIARRRSYHREWLLSFEGIT |
Ga0307471_1003890141 | 3300032180 | Hardwood Forest Soil | VLPLVENPGAVFTPKARLFVVNEEHRVVAGPLVVARRRA |
Ga0307471_1041540211 | 3300032180 | Hardwood Forest Soil | VQPLVKNPGAVFAPQARLYVVDEDRRVIAGPLTVARRRSYH |
Ga0307472_1003383921 | 3300032205 | Hardwood Forest Soil | VFPLVENPGAVFTPKARLLVVNEERHVVAGPLVVA |
Ga0307472_1024877321 | 3300032205 | Hardwood Forest Soil | VIPLVEAPGTVFQPKAEVYVVDEARRVLAGPLFVARRRAYHREWLIGFAGV |
Ga0307472_1025667602 | 3300032205 | Hardwood Forest Soil | VIPLVENVGTVFMPKARLYVVNEAREVLAGPLVVARRRSYHR |
Ga0348332_131633211 | 3300032515 | Plant Litter | VVPLVENPGAVFAPQACLFVLDADQRVVAGPLIVARRRSYHRAWLLGFVGVTSR |
Ga0335077_120241322 | 3300033158 | Soil | VAIFPLVADPGNLLVPKAKAFVVDETRKVLAGPLILGRRRAYHREWLLGFEGVSS |
Ga0214472_106100953 | 3300033407 | Soil | VAVIPLVANPGAIFGPKAQVYVLDENRAVLAGPLVIARRRAYHQEWLLG |
Ga0326723_0026472_3_140 | 3300034090 | Peat Soil | VVPLVKNPGAVFVPKARLYVVDEERRVIAGPLVVARRRAYHREYLL |
⦗Top⦘ |