Basic Information | |
---|---|
Family ID | F035938 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 171 |
Average Sequence Length | 39 residues |
Representative Sequence | FTVNGPLSTTRESEAAPSKRVKEMVEASAKIERVGATD |
Number of Associated Samples | 149 |
Number of Associated Scaffolds | 171 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.25 % |
% of genes near scaffold ends (potentially truncated) | 92.40 % |
% of genes from short scaffolds (< 2000 bps) | 78.95 % |
Associated GOLD sequencing projects | 143 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.327 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.637 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.655 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.895 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.21% β-sheet: 0.00% Coil/Unstructured: 78.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 171 Family Scaffolds |
---|---|---|
PF02817 | E3_binding | 64.33 |
PF00364 | Biotin_lipoyl | 18.13 |
PF00375 | SDF | 4.09 |
PF01593 | Amino_oxidase | 1.17 |
PF07883 | Cupin_2 | 1.17 |
PF13624 | SurA_N_3 | 0.58 |
PF08240 | ADH_N | 0.58 |
PF01070 | FMN_dh | 0.58 |
PF13563 | 2_5_RNA_ligase2 | 0.58 |
PF00557 | Peptidase_M24 | 0.58 |
PF08447 | PAS_3 | 0.58 |
PF14310 | Fn3-like | 0.58 |
PF08327 | AHSA1 | 0.58 |
PF03466 | LysR_substrate | 0.58 |
PF00589 | Phage_integrase | 0.58 |
PF10343 | Q_salvage | 0.58 |
PF04542 | Sigma70_r2 | 0.58 |
COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
---|---|---|---|
COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 64.33 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.58 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.58 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.58 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.58 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.58 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.33 % |
Unclassified | root | N/A | 35.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001141|JGI12638J13249_103599 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300001178|JGI12646J13576_105863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300001471|JGI12712J15308_10198166 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300004009|Ga0055437_10154990 | Not Available | 713 | Open in IMG/M |
3300004152|Ga0062386_100619260 | Not Available | 885 | Open in IMG/M |
3300005176|Ga0066679_10040622 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
3300005332|Ga0066388_102418407 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300005541|Ga0070733_10400209 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300005542|Ga0070732_10352348 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300005557|Ga0066704_10143421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1598 | Open in IMG/M |
3300005598|Ga0066706_11422578 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005764|Ga0066903_103808296 | Not Available | 811 | Open in IMG/M |
3300005921|Ga0070766_10756367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 660 | Open in IMG/M |
3300005950|Ga0066787_10031441 | Not Available | 960 | Open in IMG/M |
3300006050|Ga0075028_100578345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300006052|Ga0075029_100877704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300006086|Ga0075019_10737141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300006162|Ga0075030_100332944 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300006172|Ga0075018_10407827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 692 | Open in IMG/M |
3300006173|Ga0070716_101105457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300006173|Ga0070716_101236927 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300006176|Ga0070765_100037542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3843 | Open in IMG/M |
3300006176|Ga0070765_100555105 | Not Available | 1081 | Open in IMG/M |
3300006755|Ga0079222_10083053 | Not Available | 1623 | Open in IMG/M |
3300006800|Ga0066660_10729379 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300006800|Ga0066660_11294721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300007788|Ga0099795_10119492 | Not Available | 1052 | Open in IMG/M |
3300007982|Ga0102924_1105478 | Not Available | 1409 | Open in IMG/M |
3300009088|Ga0099830_10068595 | All Organisms → cellular organisms → Bacteria | 2564 | Open in IMG/M |
3300009088|Ga0099830_10892874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300009636|Ga0116112_1006822 | All Organisms → cellular organisms → Bacteria | 5100 | Open in IMG/M |
3300009637|Ga0116118_1177226 | Not Available | 677 | Open in IMG/M |
3300009638|Ga0116113_1073166 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300009683|Ga0116224_10219910 | Not Available | 908 | Open in IMG/M |
3300010048|Ga0126373_11474591 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300010339|Ga0074046_10799463 | Not Available | 551 | Open in IMG/M |
3300010360|Ga0126372_10127455 | Not Available | 1982 | Open in IMG/M |
3300010361|Ga0126378_10801977 | Not Available | 1051 | Open in IMG/M |
3300010366|Ga0126379_10333278 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
3300010366|Ga0126379_13257803 | Not Available | 544 | Open in IMG/M |
3300010376|Ga0126381_101554568 | Not Available | 956 | Open in IMG/M |
3300010379|Ga0136449_101985919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
3300010401|Ga0134121_13104135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. 12-65-5 | 512 | Open in IMG/M |
3300011120|Ga0150983_10113765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300011270|Ga0137391_10045448 | All Organisms → cellular organisms → Bacteria | 3733 | Open in IMG/M |
3300012189|Ga0137388_11362240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300012201|Ga0137365_11102118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300012203|Ga0137399_10885436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300012359|Ga0137385_11152760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300012685|Ga0137397_10101514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2109 | Open in IMG/M |
3300012685|Ga0137397_10727651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300012918|Ga0137396_10190775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1505 | Open in IMG/M |
3300014164|Ga0181532_10310166 | Not Available | 892 | Open in IMG/M |
3300014201|Ga0181537_10072017 | All Organisms → cellular organisms → Bacteria | 2345 | Open in IMG/M |
3300014495|Ga0182015_11042466 | Not Available | 505 | Open in IMG/M |
3300014501|Ga0182024_12474400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300015054|Ga0137420_1347815 | Not Available | 4296 | Open in IMG/M |
3300015168|Ga0167631_1036693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 798 | Open in IMG/M |
3300016270|Ga0182036_11032088 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300016319|Ga0182033_11248424 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300016341|Ga0182035_10632811 | Not Available | 927 | Open in IMG/M |
3300017925|Ga0187856_1291132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300017926|Ga0187807_1204393 | Not Available | 640 | Open in IMG/M |
3300017933|Ga0187801_10269453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300017995|Ga0187816_10174375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
3300018047|Ga0187859_10142870 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300018062|Ga0187784_10950666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300018090|Ga0187770_10312020 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300018468|Ga0066662_12346209 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300020579|Ga0210407_11162958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300020581|Ga0210399_10130657 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
3300020581|Ga0210399_10904669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 715 | Open in IMG/M |
3300020581|Ga0210399_11219219 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300020582|Ga0210395_10864149 | Not Available | 673 | Open in IMG/M |
3300021170|Ga0210400_10702646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
3300021171|Ga0210405_10067172 | Not Available | 2829 | Open in IMG/M |
3300021171|Ga0210405_10596729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
3300021171|Ga0210405_10927341 | Not Available | 660 | Open in IMG/M |
3300021178|Ga0210408_10027066 | All Organisms → cellular organisms → Bacteria | 4546 | Open in IMG/M |
3300021180|Ga0210396_10047596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3935 | Open in IMG/M |
3300021180|Ga0210396_10800691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
3300021384|Ga0213876_10037163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2569 | Open in IMG/M |
3300021401|Ga0210393_10086637 | All Organisms → cellular organisms → Bacteria | 2485 | Open in IMG/M |
3300021401|Ga0210393_10452680 | Not Available | 1048 | Open in IMG/M |
3300021402|Ga0210385_11330005 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300021403|Ga0210397_10571202 | Not Available | 862 | Open in IMG/M |
3300021405|Ga0210387_11098641 | Not Available | 694 | Open in IMG/M |
3300021406|Ga0210386_11088022 | Not Available | 679 | Open in IMG/M |
3300021406|Ga0210386_11100103 | Not Available | 675 | Open in IMG/M |
3300021407|Ga0210383_10116991 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
3300021420|Ga0210394_10220946 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
3300021432|Ga0210384_11379443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300021433|Ga0210391_10122424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2047 | Open in IMG/M |
3300021433|Ga0210391_11115070 | Not Available | 612 | Open in IMG/M |
3300021474|Ga0210390_10440990 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300021477|Ga0210398_10102625 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
3300021478|Ga0210402_10310176 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
3300021559|Ga0210409_10993880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300021560|Ga0126371_13419247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300022557|Ga0212123_10361088 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300025862|Ga0209483_1215818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300025910|Ga0207684_10117574 | Not Available | 2278 | Open in IMG/M |
3300025922|Ga0207646_10320550 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300025998|Ga0208651_1025663 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300026285|Ga0209438_1083155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
3300026310|Ga0209239_1190344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300026547|Ga0209156_10134563 | Not Available | 1205 | Open in IMG/M |
3300026550|Ga0209474_10294170 | Not Available | 963 | Open in IMG/M |
3300026557|Ga0179587_10734754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300027045|Ga0207726_1012205 | Not Available | 1438 | Open in IMG/M |
3300027047|Ga0208730_1045984 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300027063|Ga0207762_1006765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2224 | Open in IMG/M |
3300027527|Ga0209684_1078128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300027605|Ga0209329_1021663 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300027605|Ga0209329_1148289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300027667|Ga0209009_1016981 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
3300027725|Ga0209178_1157401 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300027768|Ga0209772_10293044 | Not Available | 516 | Open in IMG/M |
3300027882|Ga0209590_10189769 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300027903|Ga0209488_10024207 | All Organisms → cellular organisms → Bacteria | 4412 | Open in IMG/M |
3300027905|Ga0209415_10271403 | Not Available | 1498 | Open in IMG/M |
3300027908|Ga0209006_10413758 | Not Available | 1134 | Open in IMG/M |
3300028047|Ga0209526_10825827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300028906|Ga0308309_10041646 | All Organisms → cellular organisms → Bacteria | 3246 | Open in IMG/M |
3300029883|Ga0311327_10501429 | Not Available | 744 | Open in IMG/M |
3300029914|Ga0311359_11110239 | Not Available | 524 | Open in IMG/M |
3300029939|Ga0311328_10489004 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300029943|Ga0311340_11139598 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300029999|Ga0311339_11093609 | Not Available | 739 | Open in IMG/M |
3300030520|Ga0311372_12355782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300030862|Ga0265753_1113057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300030878|Ga0265770_1056177 | Not Available | 723 | Open in IMG/M |
3300030940|Ga0265740_1012616 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300030940|Ga0265740_1044666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300031239|Ga0265328_10259055 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300031474|Ga0170818_102402768 | Not Available | 543 | Open in IMG/M |
3300031546|Ga0318538_10509777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300031679|Ga0318561_10612301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300031708|Ga0310686_112690834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2004 | Open in IMG/M |
3300031719|Ga0306917_10191895 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300031796|Ga0318576_10287755 | Not Available | 776 | Open in IMG/M |
3300031798|Ga0318523_10208859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 976 | Open in IMG/M |
3300031823|Ga0307478_10778504 | Not Available | 801 | Open in IMG/M |
3300031846|Ga0318512_10113661 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
3300031910|Ga0306923_11818897 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300031942|Ga0310916_11483837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300031946|Ga0310910_10076136 | All Organisms → cellular organisms → Bacteria | 2434 | Open in IMG/M |
3300031962|Ga0307479_10228324 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
3300031962|Ga0307479_10988171 | Not Available | 811 | Open in IMG/M |
3300032001|Ga0306922_10004811 | All Organisms → cellular organisms → Bacteria | 12835 | Open in IMG/M |
3300032160|Ga0311301_11405283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
3300032180|Ga0307471_100026565 | All Organisms → cellular organisms → Bacteria | 4372 | Open in IMG/M |
3300032180|Ga0307471_101751092 | Not Available | 774 | Open in IMG/M |
3300032782|Ga0335082_11218648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 620 | Open in IMG/M |
3300032783|Ga0335079_10633220 | Not Available | 1125 | Open in IMG/M |
3300032892|Ga0335081_10362692 | Not Available | 1882 | Open in IMG/M |
3300032892|Ga0335081_11996116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 619 | Open in IMG/M |
3300032955|Ga0335076_10667234 | Not Available | 921 | Open in IMG/M |
3300033158|Ga0335077_11641311 | Not Available | 610 | Open in IMG/M |
3300034199|Ga0370514_085830 | Not Available | 800 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.64% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.77% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.68% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.09% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.51% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.51% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.34% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.34% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.92% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.75% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.75% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.75% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.75% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.17% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.17% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.17% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.17% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.17% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.58% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.58% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.58% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.58% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.58% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.58% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.58% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.58% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001141 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 | Environmental | Open in IMG/M |
3300001178 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025998 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12638J13249_1035992 | 3300001141 | Forest Soil | NGPLPTTRESESEPSRDVKEMIEASARMERVTVGD* |
JGI12646J13576_1058631 | 3300001178 | Forest Soil | GAHYFTVNGQLPTIRETEARPSEHVLDMIEASAKTERVGVSD* |
JGI12712J15308_101981662 | 3300001471 | Forest Soil | TVNGPLPTTRESEAPPSARVLEMIEASAKTERLEVSG* |
Ga0055437_101549901 | 3300004009 | Natural And Restored Wetlands | AGTPYVTVNGPLPTQREHDPPPSRRVVEMVEASAKTERVGVTK* |
Ga0062386_1006192602 | 3300004152 | Bog Forest Soil | VAGAHYFTVNGPLSTTRETEAAPSKHVKEMVAASAKVERVGVTD* |
Ga0066679_100406223 | 3300005176 | Soil | YVTVDGPLETTREHEAAPSQRVVQMVEASAKTERVVVSK* |
Ga0066388_1024184072 | 3300005332 | Tropical Forest Soil | YFTVNGPLPTTRESESQPTQHIKEMIEASARNERVGVGD* |
Ga0070733_104002091 | 3300005541 | Surface Soil | HYHTVHGPLPTTRESEAAPSARVLDMIEASAKTERVGVTD* |
Ga0070732_103523481 | 3300005542 | Surface Soil | VNGPLPTVRENDPGPSRHVVEMVEASARTEKVGATD* |
Ga0066704_101434215 | 3300005557 | Soil | TVDGPLPTTRETESAPSRRVMEMIEASAKGERVEVGD* |
Ga0068857_1009383631 | 3300005577 | Corn Rhizosphere | ITVDGPLATTREHDPTPSRRVVEMVEASARVEKAGVSS* |
Ga0066706_114225782 | 3300005598 | Soil | YFTVNGPLPTTRESESEPSRDVKEMIEASARMERVTVGD* |
Ga0066903_1038082961 | 3300005764 | Tropical Forest Soil | AGQRYYTVNGPLPTTRESETASNARVRELVEAGARSEGEGA* |
Ga0070766_107563672 | 3300005921 | Soil | HYFTVDGPLETTREHDGPPSQRVVEMVEASARVEQVVSR* |
Ga0066787_100314411 | 3300005950 | Soil | AGAHYVTVNGPLAATRETEAPPSEHVLEIIAASKKKEKGVVP* |
Ga0070717_113810521 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VEGPLPTEREHDPPPSRRVVEMVEASAQLEKAGVSS* |
Ga0075028_1005783452 | 3300006050 | Watersheds | PLPTTREHEAAPSAHVVEMVEASAQVERVEVAVK* |
Ga0075029_1008777041 | 3300006052 | Watersheds | GPLSTTRENEAAPSKHVREMVAASAKKEGVAVTD* |
Ga0075019_107371412 | 3300006086 | Watersheds | VNGPLATTREQEAAPSQRVVEMIEESAKTERVGVES* |
Ga0075030_1003329441 | 3300006162 | Watersheds | AHYYTVNGPLPTTRESEAEPSQHVKEMIEASARTERVVVGD* |
Ga0075018_104078271 | 3300006172 | Watersheds | YFTVNGPLPTVRETEAAPSRNVVEMVEASARTEQVGVSR* |
Ga0070716_1011054571 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AHYVTVDGPLAADRENETTPSRRVKEMVEASAKTERVGAD* |
Ga0070716_1012369273 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DGPLPTTREHEAPPSQRIIEMVEASAKIEGVAAKD* |
Ga0070765_1000375421 | 3300006176 | Soil | VAGAHYFTVNGPMSMTRESEAAPSKRVKEMVEASAKIERVGATD* |
Ga0070765_1005551052 | 3300006176 | Soil | TVNGPLSTTRETEAPPSKRVKEMVAESAKKEQVGATD* |
Ga0079222_100830531 | 3300006755 | Agricultural Soil | NGPLPTTREHESAPSKRVLEMIEASAKTEQVPELTSTD* |
Ga0066660_107293791 | 3300006800 | Soil | GPLPTTRESESEPSRDVKEMIEASARMERVTVGD* |
Ga0066660_112947211 | 3300006800 | Soil | AGAHYFTVNGPLSTTRENEAPPSRRVKEMVAASAKVEGVAATD* |
Ga0099795_101194922 | 3300007788 | Vadose Zone Soil | VNGPLPTTRETEAEPSRRVLEMIETSAKTERLGVSG* |
Ga0102924_11054782 | 3300007982 | Iron-Sulfur Acid Spring | FTVNGPLATARETEAAPSQRVVDMVEASAKTERVGVTD* |
Ga0099830_100685953 | 3300009088 | Vadose Zone Soil | NGPLSTTREHEAPPSKKVKEMVAASAKAEGVAATD* |
Ga0099830_108928742 | 3300009088 | Vadose Zone Soil | TVDGPLETTREHEAAPSQRVVEMVEASAKTERVTVSK* |
Ga0116112_10068221 | 3300009636 | Peatland | GAHYFTVNGPLPTIRETEAPPSARVLDMIEASAKTERVGVSG* |
Ga0116118_11772262 | 3300009637 | Peatland | GGPLPTTREHEAPPSRHVVDMVEASAIIEPIGVGD* |
Ga0116113_10731662 | 3300009638 | Peatland | QRYYTVNGPLPTTRETEAAPSRHVREMVEESAKSEGIGVAD* |
Ga0116224_102199101 | 3300009683 | Peatlands Soil | GPLSTTRENEAAPNDHVVKMVKASAKKEGVAASD* |
Ga0126373_114745911 | 3300010048 | Tropical Forest Soil | AGAHYFTVNGPLPTARESEAAPSQRVIDMVETSAKTERVGVTE* |
Ga0074046_107994631 | 3300010339 | Bog Forest Soil | GALPTTRESEAPPSERVLEMIEASAKTERVGVSS* |
Ga0126372_101274554 | 3300010360 | Tropical Forest Soil | VDGPLPMTRETESAPSRRVMDMIEASARGERVEVGD* |
Ga0126378_108019772 | 3300010361 | Tropical Forest Soil | GPLSTTRENEQPPSRRVKEMVEASAKAEGVAATD* |
Ga0126379_103332781 | 3300010366 | Tropical Forest Soil | VNGPLSTTRENEAPPSRHVVEMVEASAKIERVGATD* |
Ga0126379_132578032 | 3300010366 | Tropical Forest Soil | MNGPLPTTRESEAPASSRVLEMIEASAKTERVGVSD* |
Ga0126381_1015545682 | 3300010376 | Tropical Forest Soil | YFTVNGALSTTREHETPPSERVVEMVEASAKKEGVAATD* |
Ga0136449_1019859191 | 3300010379 | Peatlands Soil | NGPLPTTRESESAPSRHVLDMIEASAKTERVGVAD* |
Ga0134121_131041351 | 3300010401 | Terrestrial Soil | GPLPTVRENDPGPSRHVVEMVEASARTEKVGATD* |
Ga0150983_101137651 | 3300011120 | Forest Soil | HTVDGPLATTRENEAAPSKHVVRMVEASAKREGVAATD* |
Ga0137391_100454481 | 3300011270 | Vadose Zone Soil | AHYFTVNGPLSTTRENEAPPSKRVKEMVAASAKAEGVAATD* |
Ga0137388_113622401 | 3300012189 | Vadose Zone Soil | YHTVNGPLPTTRESESAPSERVLEMIEASAKTERVGVSG* |
Ga0137365_111021181 | 3300012201 | Vadose Zone Soil | HYFTLKGSLPTTREHEAPPSERIVEMIEAGAKTERVGVAE* |
Ga0137399_108854362 | 3300012203 | Vadose Zone Soil | TVDGPLETTREHEATPSQRVVQMVEASAKTERVVVSK* |
Ga0137385_111527601 | 3300012359 | Vadose Zone Soil | VDGPLPTTRETEAAPSRRVMEMIEASAKGERVEVGD* |
Ga0137397_101015141 | 3300012685 | Vadose Zone Soil | TVDGPLSTTREHEAAPNSQVKEMVAGAKREGVAATD* |
Ga0137397_107276512 | 3300012685 | Vadose Zone Soil | VNGPLSTTRENEAPPSRRVKEMVAASAKVEGVAATD* |
Ga0137396_101907753 | 3300012918 | Vadose Zone Soil | AGAHYFTVNGPLSTTRENEALPSRRVKEMVAASAKAEGVAATD* |
Ga0181532_103101661 | 3300014164 | Bog | GPLSTSRENEQAPSRRVVEMVEASAKIEGVEATD* |
Ga0181537_100720173 | 3300014201 | Bog | FTVNGPLPTTRETEAPASEKVLDMIEASAKTERVGVSD* |
Ga0182015_110424661 | 3300014495 | Palsa | VNGPLPTTRETEAEPSRRVREMVEASAKIERLGVTD* |
Ga0182024_124744001 | 3300014501 | Permafrost | GPLPTTRESEAPPSERVIDMIEASAKTEQVGVSD* |
Ga0181525_100136397 | 3300014654 | Bog | HYFTVDGPLPTTREHDPAPSDRVVEMVEASARIEQAVSR* |
Ga0137420_134781511 | 3300015054 | Vadose Zone Soil | VAGAPYVSVDGPLETTREHEAAPSQRVVQMVEASAKRSASSFQK* |
Ga0167631_10366933 | 3300015168 | Glacier Forefield Soil | AHYFTVDGQLPTTREHEAEPSRRVVEMVEARAKIEGVAATD* |
Ga0182036_110320881 | 3300016270 | Soil | HYFTVSGPLSTTREHEAPPSERVLEMVEASAKREGVAATD |
Ga0182033_112484241 | 3300016319 | Soil | VNGPLPTTREIEGGPSQSVRELIESSAQTERVGADD |
Ga0182035_106328111 | 3300016341 | Soil | AHYFTVNGPLSTTRENEAPPSRHVVEMVEASAKIERVGATD |
Ga0187856_12911322 | 3300017925 | Peatland | VNGPLATTRETEAAPSKRVVEMVEASAKTERVGVTD |
Ga0187807_12043931 | 3300017926 | Freshwater Sediment | TVNGPLPTTRESEASPSERVLEMIETSAKTERVGVSD |
Ga0187801_102694532 | 3300017933 | Freshwater Sediment | FTVNGPLPTTRETEAAPSQRVIDMIESSAKSERVGVSD |
Ga0187782_116918482 | 3300017975 | Tropical Peatland | AGTQYFTVKGPLPTVRETEPTPNLNVVEMVEASARTEQVGVSR |
Ga0187816_101743751 | 3300017995 | Freshwater Sediment | AHYFTVNGPLPTARESEAAPSQRVVEMVEASAKTERVGVTD |
Ga0187859_101428701 | 3300018047 | Peatland | VNGPLPTTRETEAPASEKVLDMIEASAKTERVGVSD |
Ga0187784_109506662 | 3300018062 | Tropical Peatland | GAHYFTVHGPLPTARETEAPPSQRIIERVEASARTERVVVPDV |
Ga0187770_103120202 | 3300018090 | Tropical Peatland | VNGPLPTTRESEAPASTRVLEMIEASAKTERVGVTR |
Ga0066662_123462091 | 3300018468 | Grasslands Soil | GAHYCPVNGPLPSTRESEAAPSRDVKELIEASAKSERVTVGD |
Ga0210407_111629581 | 3300020579 | Soil | YFTVNGPLSTTRENEAAPSAHVKEMVAGAKREGVAASD |
Ga0210399_101306571 | 3300020581 | Soil | HYFTVNGPLSTTRENEAAPTKKVKEMVAASAKAEGVAATD |
Ga0210399_109046692 | 3300020581 | Soil | HTVNGPLPTTRDSEAPPSAHVLEMIEASAKTERVEV |
Ga0210399_112192192 | 3300020581 | Soil | FTVNGPLPTTRESESAPSQHVREMIEASAKTERVGVGD |
Ga0210395_108641491 | 3300020582 | Soil | MVAGAHYFTVNGPMSATRESEAAPSKRVKEMVEASAKIERVGAAD |
Ga0210400_107026461 | 3300021170 | Soil | YVTVDGPLATTREHEAAPSQRVVEMVETSAKTERVVVSK |
Ga0210405_100671721 | 3300021171 | Soil | HYFTVNGPLSTTREHEAAPSRRVKEMVEASAKIEGVAATD |
Ga0210405_105967292 | 3300021171 | Soil | YFTVNGPLSTTRENEAPPSSRVVKMVEASAKAEGVAATD |
Ga0210405_109273412 | 3300021171 | Soil | GAHYFTVNGPMSATRESEAAPSKRIKEMVEASAKIERVGATD |
Ga0210408_100270661 | 3300021178 | Soil | EGPLPTTREHEAPPNKRIVQMVEDSAKIEGVAATD |
Ga0210396_100475964 | 3300021180 | Soil | HTVSGPLPMLRENEQAPSKRVKEMVEASAKHEGVAATD |
Ga0210396_108006911 | 3300021180 | Soil | HYFTVDGPLSTTRELEAAPNTHVKEMVAGAKREGVAATD |
Ga0213876_100371633 | 3300021384 | Plant Roots | LTVEGPLPTARENEAPPSQRIVEMVEASSKSEGVAARS |
Ga0210393_100866373 | 3300021401 | Soil | AHYFTVNGPLSTTRESEAAPSKRVVEMVEASAKKEGVGATD |
Ga0210393_104526801 | 3300021401 | Soil | HYFTVNGPLSTTRETEAPPSKRVKEMVAESAKKEQVGATD |
Ga0210385_113300052 | 3300021402 | Soil | YYTVNGPLPTIRESEAPASDRVLDMIEASAKTERVGVSS |
Ga0210397_105712022 | 3300021403 | Soil | VNGPLSTTRENEALPSRRVVEMVEACAKKEGVGTTD |
Ga0210387_110986412 | 3300021405 | Soil | MVAGAHYFTVNGPLSTTRENQAQPSKRVKEMVAGAKREGVAATD |
Ga0210386_110880222 | 3300021406 | Soil | VAGAHYFTVNGPLSATRESEAAPSKRVKEMVEASAKIERVGATD |
Ga0210386_111001031 | 3300021406 | Soil | FTVNGPLSTTRESEAAPSKRVKEMVEASAKIERVGATD |
Ga0210383_101169913 | 3300021407 | Soil | FTVNGPLPTTRENESAPSRRVVEMIEESSRTERVGVSD |
Ga0210394_102209463 | 3300021420 | Soil | HYHTVNGPLPATRETEAPPSARVLDMIEASAKTERVGVSD |
Ga0210384_113794432 | 3300021432 | Soil | GAHYFTVNGPLSTTRENEAAPSKHVKEMVAGAKREGVAASD |
Ga0210384_114266341 | 3300021432 | Soil | YHTVNGPLPTLREHDPAPSQRIVEMVEASARAEQVGVSD |
Ga0210391_101224244 | 3300021433 | Soil | YTVNGPLPTTRETEASASDRVREMIEAGAKTERVGVPG |
Ga0210391_111150701 | 3300021433 | Soil | AGAHYFTVNGPLSTTRESEAAPSKRVKEMVEASAKIERVGATD |
Ga0210390_104409902 | 3300021474 | Soil | YYTVNGPLPTTRESESAPSERVLEMIETSAKTERVGV |
Ga0210398_101026253 | 3300021477 | Soil | GAHYFTVNGPLSTTRENEAAPSAHVKEMVAGAKREGVAASD |
Ga0210398_105245161 | 3300021477 | Soil | HYFTVDGPLPTTREHDPEPSQRVVEMVEASARTEQVVSR |
Ga0210402_103101763 | 3300021478 | Soil | TVEGPLPTVRENEATPSQRVVEMVEASAKIEGVAATD |
Ga0210409_109938801 | 3300021559 | Soil | VDGPLDTTREHEAAPSQRVVEMVEASAKTERVVVSK |
Ga0126371_134192471 | 3300021560 | Tropical Forest Soil | VNGPLSTTRENEQPPSRRVKEMVEASAKAEGVAATD |
Ga0212123_103610881 | 3300022557 | Iron-Sulfur Acid Spring | VNGPLPTIRETEAPASERVIEMIESSAKTERVGVTD |
Ga0209483_12158182 | 3300025862 | Arctic Peat Soil | YMSVKGPLPTVRENEAPPSQHVVEMIEASAKTERVGVTD |
Ga0207684_101175743 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLSNNTVNGPLPTTRESEAPASKHVLDMIEASAKTEKIGV |
Ga0207646_103205502 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TVNGPLPTTREHEATPSQRVVEMIEASAKTERVGVSD |
Ga0208651_10256632 | 3300025998 | Rice Paddy Soil | FTVKGPLPTTREHESAPSQRVLEMIEASAKTEQVPELTSTD |
Ga0209438_10831551 | 3300026285 | Grasslands Soil | TVDGPLETTREHEATPSQRVVQMVEASAKTERVVVSK |
Ga0209239_11903442 | 3300026310 | Grasslands Soil | FTVNGPLPTTREHEPAPSPRVVEMIEASSKTERVGVAD |
Ga0209156_101345631 | 3300026547 | Soil | HTVNGPLSTTRENEQPPSRRVKEMVEASAKAEGVAATD |
Ga0209474_102941702 | 3300026550 | Soil | TVKGPLSTTRELEAAPNRDVVELIAAGAKTEKVGTP |
Ga0179587_107347542 | 3300026557 | Vadose Zone Soil | SYVTVDGPLDTTREHEAAPSQRVVEMVEASAKPERVVVSK |
Ga0207781_10034281 | 3300026890 | Tropical Forest Soil | TVNGPLETTRENEPALNQEVKEMIATVARHEGVAATD |
Ga0207741_10266862 | 3300026941 | Tropical Forest Soil | AGAHYHTVNGPLETTRENEPALNQEVKEMIATVARHEGVAATD |
Ga0207726_10122052 | 3300027045 | Tropical Forest Soil | TVNGPLSTARENEAPPSRHVVEMVEASAKIERVGATD |
Ga0208730_10459842 | 3300027047 | Forest Soil | NGPLPTIRETEAAPSEKVLDMIEASAKTERVGVSD |
Ga0207762_10067653 | 3300027063 | Tropical Forest Soil | VNGPLPTTRESEASPSERVVEMIEASAKTERVGVSG |
Ga0207762_10711552 | 3300027063 | Tropical Forest Soil | DKLMVAGAHYHTVNGPLETTRENEPALNQEVKEMIATVARHEGVAATD |
Ga0209684_10781281 | 3300027527 | Tropical Forest Soil | GAHYFTVNGPLSTTRENEAPPSRHVVEMVEASAKIERVGATD |
Ga0209329_10216632 | 3300027605 | Forest Soil | YFTVNGPLATTRETEAAPSKRVKEMVAASARTERVGVTD |
Ga0209329_11482891 | 3300027605 | Forest Soil | LVAGAHYFTVNGQLPTIRETEARPSEHVLDMIEASAKTERVGVSD |
Ga0209009_10169813 | 3300027667 | Forest Soil | LMVAGAHYHTVSGPLPMLRENEQAPSKRVKEMVEASAKHEGVAATD |
Ga0209178_11574011 | 3300027725 | Agricultural Soil | HYFTVNGPLPTIRETEAAPSQRVLEMVEAGAKTEGVGVR |
Ga0209772_102930441 | 3300027768 | Bog Forest Soil | FTVNGPMSATRESESAPSKRVKEMVEASAKIERVGVTD |
Ga0209590_101897691 | 3300027882 | Vadose Zone Soil | TVNGPLSTTRENEAPPSRRVKEMVAASAKVEGVAATD |
Ga0209488_100242071 | 3300027903 | Vadose Zone Soil | NGPMPTIRETEAPPSEKVLDMIEASAKTERVGVSG |
Ga0209415_102714032 | 3300027905 | Peatlands Soil | VNGPLSTTRENEAAPSRRVVEMVEASAKKEGVGATD |
Ga0209006_104137582 | 3300027908 | Forest Soil | HTVNGPLPTTRETEASPSERVLEMIETSAKTERVGVSG |
Ga0209526_108258272 | 3300028047 | Forest Soil | HYHTVNGPLQTTREHEAPPTKRVRELIEASAKTERVGVTD |
Ga0308309_100416461 | 3300028906 | Soil | HYHTVNGPLPTTRESEAEPSQHVKEMIEASAKTERVTVGD |
Ga0311327_105014291 | 3300029883 | Bog | AGSHYVTVNGPLPTVRETEAPPSEHVLDMIEASAKTERVGVSG |
Ga0311359_111102392 | 3300029914 | Bog | YFTVDGPLPTTRETESSPSVHVKEMIDASAKTERVVMAD |
Ga0311328_104890042 | 3300029939 | Bog | YFTVNGPLSTTRETEAAPSERVLDMIDASAKTERVGVSD |
Ga0311340_111395983 | 3300029943 | Palsa | TVNGPLPTTRETEAAPSRHVREMVEESAKSEGIGVAD |
Ga0311339_110936092 | 3300029999 | Palsa | RYYTVNGPLPTTRELEAPPSRHVREMVEASAKSEGVAVSSDD |
Ga0311372_123557822 | 3300030520 | Palsa | AHYFTVNGPLPTVRETEATASERVIEMIESSAKTERVGVTD |
Ga0265753_11130571 | 3300030862 | Soil | GAHYHTVSGPLPMLRENEQAPSKRVKEMVEASAKHEGVAATD |
Ga0265770_10561772 | 3300030878 | Soil | AHYFTVNGPLATARETEAAPSQRVVDMVEASAKTERVGVTD |
Ga0265740_10126161 | 3300030940 | Soil | HYFTVNGPLPTIRETEAPASERVIEMIESSAKTERVGVTD |
Ga0265740_10446662 | 3300030940 | Soil | VAGAHYFTVNGPLSATRESETAPSKRVKEMIEASAKIERVGATD |
Ga0265328_102590552 | 3300031239 | Rhizosphere | GQRYYTVNGPLPTTRETEAAPSRHVREMVEESAKSEGIGVAD |
Ga0170818_1024027681 | 3300031474 | Forest Soil | VNGPLATTRETEAAPSKRVKEMVTASARTERVGVTD |
Ga0318538_105097771 | 3300031546 | Soil | GAHYFTVNGPLSTARENEAPPSRHVVEMVEASAKIERVGATD |
Ga0318561_106123011 | 3300031679 | Soil | YTVNGPLSTTRENEQPPSRRVKEMVESSAKAEGVAATD |
Ga0310686_1126908343 | 3300031708 | Soil | VHGPLATTRENEAAPSQRVVEMIETSARTERVTVPD |
Ga0306917_101918951 | 3300031719 | Soil | VNGPLPTTRESEAPPSERVLERIEASAKNERVGVSSSRSR |
Ga0307477_102365271 | 3300031753 | Hardwood Forest Soil | TQYHTVNGPLPTLREHDPAPSQRIVEMVEASARAEQVGVSD |
Ga0318576_102877552 | 3300031796 | Soil | FTVNGPLSTTRENEAPPSRHVVEMVEASAKIERVGATD |
Ga0318523_102088592 | 3300031798 | Soil | YHTVEGPLPTEREQEAPPSQRIVEMVEASARNEGVGVTR |
Ga0307478_107785042 | 3300031823 | Hardwood Forest Soil | FTVNGPLSTTRENEAAPSRRVKEMVEASAKIEGVAATD |
Ga0318512_101136612 | 3300031846 | Soil | VNGPLSTTRENEAPPSRHVVEMVEASAKIERVGATD |
Ga0306923_118188972 | 3300031910 | Soil | VNGPLPTTRESEGEPSQSVRELIESSAQTERIGAAD |
Ga0310916_114838371 | 3300031942 | Soil | LMVAGAHYFTVNGPLSTTRENEQVPSKLVVAMVEASAKKEGVAATD |
Ga0310910_100761363 | 3300031946 | Soil | VNGALSTTRENEALPSRRVVEMVEASAKKEGVGAAD |
Ga0307479_102283241 | 3300031962 | Hardwood Forest Soil | AHYYTVNGPLPTTRETEGSRSERVLEMIETSAKTERVGVSG |
Ga0307479_109881712 | 3300031962 | Hardwood Forest Soil | AHYHTVNGPLSTTRENEAPPSSRVKEMVAAGAKVEGVAATD |
Ga0306922_100048111 | 3300032001 | Soil | VNGPLSTARENEAPPSRHVLEMVEASAKIERVGATD |
Ga0311301_114052831 | 3300032160 | Peatlands Soil | NGPLPTTRESESAPSRHVLDMIEASAKTERVGVAD |
Ga0307471_1000265651 | 3300032180 | Hardwood Forest Soil | MVAGAHDHTVNGPLATTRENEAPPSRRVKEMVAASAKVEGVAATD |
Ga0307471_1017510922 | 3300032180 | Hardwood Forest Soil | YFTVNGPLSTTREAEAAPSKRVKEMIAASAKTERVGVTD |
Ga0306920_1005856731 | 3300032261 | Soil | LMVAGAHYYTVNGPLETTRENEATPNQEVKEMIQAVAKHEGVAATD |
Ga0335082_112186482 | 3300032782 | Soil | TQYHTVNGPLPTLREHDPAPSRRVVEMIEASAQTERVGATD |
Ga0335079_106332202 | 3300032783 | Soil | HYFTVNGPLPTTRESEAAPSQRVLEMVEAGAKKEGVGVR |
Ga0335081_103626923 | 3300032892 | Soil | NGPLPTTRENENEPSQRVVEMIEASSKAERVEVGD |
Ga0335081_119961161 | 3300032892 | Soil | HYFTVDGPLATTREHDGPPSDRVVEMVEASARIEQAVTR |
Ga0335076_106672342 | 3300032955 | Soil | HYFTVNGPLPTTRESEAPASSHVLEMIEASAKTEKVGV |
Ga0335077_116413111 | 3300033158 | Soil | NGPLPTTRESEAPPSERVLDMIEASAKSERVGVSS |
Ga0370514_085830_659_796 | 3300034199 | Untreated Peat Soil | LVAGAHYFTVNGPLSTTRESEAAPSKRVKEMVEASAKIERVGATD |
⦗Top⦘ |