NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036407

Metagenome / Metatranscriptome Family F036407

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036407
Family Type Metagenome / Metatranscriptome
Number of Sequences 170
Average Sequence Length 41 residues
Representative Sequence MAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA
Number of Associated Samples 126
Number of Associated Scaffolds 170

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.94 %
% of genes near scaffold ends (potentially truncated) 20.59 %
% of genes from short scaffolds (< 2000 bps) 75.88 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.118 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.529 % of family members)
Environment Ontology (ENVO) Unclassified
(34.706 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.353 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.48%    β-sheet: 0.00%    Coil/Unstructured: 95.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 170 Family Scaffolds
PF05193Peptidase_M16_C 10.00
PF03544TonB_C 8.24
PF02954HTH_8 2.94
PF00158Sigma54_activat 2.35
PF03729DUF308 1.76
PF04264YceI 1.76
PF00990GGDEF 1.76
PF06202GDE_C 1.18
PF00115COX1 1.18
PF00753Lactamase_B 1.18
PF00106adh_short 0.59
PF11066DUF2867 0.59
PF13470PIN_3 0.59
PF00989PAS 0.59
PF13477Glyco_trans_4_2 0.59
PF13561adh_short_C2 0.59
PF13432TPR_16 0.59
PF11752DUF3309 0.59
PF00571CBS 0.59
PF07228SpoIIE 0.59
PF00174Oxidored_molyb 0.59
PF13186SPASM 0.59
PF01451LMWPc 0.59
PF00486Trans_reg_C 0.59
PF13620CarboxypepD_reg 0.59
PF01494FAD_binding_3 0.59
PF04389Peptidase_M28 0.59
PF01149Fapy_DNA_glyco 0.59
PF17152CHASE8 0.59
PF01161PBP 0.59
PF02321OEP 0.59
PF01058Oxidored_q6 0.59
PF13520AA_permease_2 0.59
PF04253TFR_dimer 0.59
PF030614HBT 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 170 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 8.24
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 1.76
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 1.76
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.18
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.18
COG3408Glycogen debranching enzyme (alpha-1,6-glucosidase)Carbohydrate transport and metabolism [G] 1.18
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.59
COG0377NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductaseEnergy production and conversion [C] 0.59
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.59
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.59
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.59
COG1740Ni,Fe-hydrogenase I small subunitEnergy production and conversion [C] 0.59
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 0.59
COG1941Coenzyme F420-reducing hydrogenase, gamma subunitEnergy production and conversion [C] 0.59
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.59
COG3260Ni,Fe-hydrogenase III small subunitEnergy production and conversion [C] 0.59
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.12 %
UnclassifiedrootN/A25.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908043|A2_c1_ConsensusfromContig72252Not Available692Open in IMG/M
2199352024|deeps__Contig_160151Not Available582Open in IMG/M
3300001545|JGI12630J15595_10098839All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300001593|JGI12635J15846_10672727Not Available598Open in IMG/M
3300001686|C688J18823_10025550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4010Open in IMG/M
3300002245|JGIcombinedJ26739_100365695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1323Open in IMG/M
3300002245|JGIcombinedJ26739_100810436All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300002245|JGIcombinedJ26739_100892788All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300002568|C688J35102_120280553All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300002910|JGI25615J43890_1021999All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1052Open in IMG/M
3300004479|Ga0062595_100000460All Organisms → cellular organisms → Bacteria7638Open in IMG/M
3300004479|Ga0062595_100024995All Organisms → cellular organisms → Bacteria → Acidobacteria2346Open in IMG/M
3300004479|Ga0062595_101375409Not Available641Open in IMG/M
3300004479|Ga0062595_102256654All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300005171|Ga0066677_10386846All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.800Open in IMG/M
3300005174|Ga0066680_10032251All Organisms → cellular organisms → Bacteria2974Open in IMG/M
3300005175|Ga0066673_10020408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3040Open in IMG/M
3300005175|Ga0066673_10068713All Organisms → cellular organisms → Bacteria1834Open in IMG/M
3300005177|Ga0066690_10906410All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005181|Ga0066678_10241236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1166Open in IMG/M
3300005293|Ga0065715_10667242Not Available656Open in IMG/M
3300005332|Ga0066388_100930842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1443Open in IMG/M
3300005332|Ga0066388_105550654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83639Open in IMG/M
3300005332|Ga0066388_105793635Not Available625Open in IMG/M
3300005332|Ga0066388_107357038All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83553Open in IMG/M
3300005434|Ga0070709_10208844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1387Open in IMG/M
3300005436|Ga0070713_102270505All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83525Open in IMG/M
3300005437|Ga0070710_10747360Not Available694Open in IMG/M
3300005439|Ga0070711_100780592Not Available809Open in IMG/M
3300005445|Ga0070708_100008386All Organisms → cellular organisms → Bacteria8297Open in IMG/M
3300005446|Ga0066686_10043503All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2707Open in IMG/M
3300005467|Ga0070706_102016595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae522Open in IMG/M
3300005471|Ga0070698_100225469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1807Open in IMG/M
3300005536|Ga0070697_100293839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1396Open in IMG/M
3300005602|Ga0070762_10391054Not Available894Open in IMG/M
3300005602|Ga0070762_10850794Not Available619Open in IMG/M
3300005610|Ga0070763_10085921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales1564Open in IMG/M
3300005610|Ga0070763_10293954Not Available891Open in IMG/M
3300005614|Ga0068856_100593429All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300005764|Ga0066903_100270550All Organisms → cellular organisms → Bacteria → Acidobacteria2650Open in IMG/M
3300005764|Ga0066903_102058785All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300005841|Ga0068863_102501549All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300005993|Ga0080027_10085195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1173Open in IMG/M
3300006028|Ga0070717_10689175All Organisms → cellular organisms → Bacteria → Acidobacteria928Open in IMG/M
3300006034|Ga0066656_10172748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1364Open in IMG/M
3300006050|Ga0075028_100001215All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9367Open in IMG/M
3300006050|Ga0075028_100320575All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300006050|Ga0075028_100380330All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300006050|Ga0075028_100996700All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83521Open in IMG/M
3300006059|Ga0075017_100799941All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300006162|Ga0075030_100043075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3800Open in IMG/M
3300006172|Ga0075018_10419661All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae684Open in IMG/M
3300006175|Ga0070712_100869956Not Available776Open in IMG/M
3300006175|Ga0070712_101251839Not Available646Open in IMG/M
3300006176|Ga0070765_100001848All Organisms → cellular organisms → Bacteria13121Open in IMG/M
3300006176|Ga0070765_100747071All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300009038|Ga0099829_10006312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7313Open in IMG/M
3300009038|Ga0099829_10863990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae751Open in IMG/M
3300009088|Ga0099830_10100073All Organisms → cellular organisms → Bacteria → Acidobacteria2162Open in IMG/M
3300009089|Ga0099828_10606085All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300009098|Ga0105245_10386762All Organisms → cellular organisms → Bacteria → Acidobacteria1394Open in IMG/M
3300009792|Ga0126374_10145296All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300010046|Ga0126384_10338204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1250Open in IMG/M
3300010046|Ga0126384_10588753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium972Open in IMG/M
3300010047|Ga0126382_10769781Not Available817Open in IMG/M
3300010048|Ga0126373_10042683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3999Open in IMG/M
3300010048|Ga0126373_10109003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2574Open in IMG/M
3300010048|Ga0126373_11484606All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300010048|Ga0126373_13047746Not Available522Open in IMG/M
3300010358|Ga0126370_10041096All Organisms → cellular organisms → Bacteria2872Open in IMG/M
3300010358|Ga0126370_10208398All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300010358|Ga0126370_12177168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300010359|Ga0126376_12716865Not Available544Open in IMG/M
3300010360|Ga0126372_10116079All Organisms → cellular organisms → Bacteria2055Open in IMG/M
3300010360|Ga0126372_11032779All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium836Open in IMG/M
3300010366|Ga0126379_10000489All Organisms → cellular organisms → Bacteria21859Open in IMG/M
3300010366|Ga0126379_10791268All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300010375|Ga0105239_10341357Not Available1690Open in IMG/M
3300010376|Ga0126381_100153003All Organisms → cellular organisms → Bacteria3031Open in IMG/M
3300010376|Ga0126381_100770992All Organisms → cellular organisms → Bacteria → Acidobacteria1379Open in IMG/M
3300010401|Ga0134121_13053139Not Available515Open in IMG/M
3300010857|Ga0126354_1042128Not Available522Open in IMG/M
3300011270|Ga0137391_10223822All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300011270|Ga0137391_10285876All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300011270|Ga0137391_10518608All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300011270|Ga0137391_10909430Not Available720Open in IMG/M
3300012189|Ga0137388_10638819All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300012189|Ga0137388_10815926All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300012189|Ga0137388_11264535Not Available676Open in IMG/M
3300012202|Ga0137363_10396018All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300012208|Ga0137376_11511178All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300012209|Ga0137379_10479743All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300012209|Ga0137379_10678324All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium936Open in IMG/M
3300012363|Ga0137390_10072988All Organisms → cellular organisms → Bacteria3364Open in IMG/M
3300012685|Ga0137397_10196916All Organisms → cellular organisms → Bacteria1498Open in IMG/M
3300012924|Ga0137413_10495943All Organisms → cellular organisms → Bacteria → Acidobacteria897Open in IMG/M
3300012930|Ga0137407_10000974All Organisms → cellular organisms → Bacteria18814Open in IMG/M
3300012930|Ga0137407_10563366All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300012958|Ga0164299_10168573All Organisms → cellular organisms → Bacteria → Acidobacteria1232Open in IMG/M
3300012984|Ga0164309_10833684Not Available745Open in IMG/M
3300013297|Ga0157378_10214164All Organisms → cellular organisms → Bacteria1828Open in IMG/M
3300014969|Ga0157376_11308139Not Available755Open in IMG/M
3300015087|Ga0167637_1014320All Organisms → cellular organisms → Bacteria → Acidobacteria1161Open in IMG/M
3300017792|Ga0163161_11561005Not Available581Open in IMG/M
3300017966|Ga0187776_11043540Not Available603Open in IMG/M
3300017993|Ga0187823_10010341All Organisms → cellular organisms → Bacteria → Acidobacteria2215Open in IMG/M
3300018468|Ga0066662_10054807All Organisms → cellular organisms → Bacteria2566Open in IMG/M
3300018482|Ga0066669_10237457All Organisms → cellular organisms → Bacteria → Acidobacteria1430Open in IMG/M
3300019887|Ga0193729_1226298All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300019888|Ga0193751_1030060All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2556Open in IMG/M
3300019888|Ga0193751_1033418All Organisms → cellular organisms → Bacteria2380Open in IMG/M
3300020199|Ga0179592_10390060All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300020579|Ga0210407_10071340All Organisms → cellular organisms → Bacteria → Acidobacteria2609Open in IMG/M
3300020583|Ga0210401_10123263All Organisms → cellular organisms → Bacteria2430Open in IMG/M
3300021080|Ga0210382_10545981Not Available514Open in IMG/M
3300021171|Ga0210405_10129247All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300021344|Ga0193719_10012453All Organisms → cellular organisms → Bacteria3581Open in IMG/M
3300021401|Ga0210393_11115072Not Available637Open in IMG/M
3300021406|Ga0210386_11475674Not Available568Open in IMG/M
3300021407|Ga0210383_11115009All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300021420|Ga0210394_10848258All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300021432|Ga0210384_10786075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300021478|Ga0210402_11233682Not Available675Open in IMG/M
3300021560|Ga0126371_10023440All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5714Open in IMG/M
3300021560|Ga0126371_13275633All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300024288|Ga0179589_10438981Not Available601Open in IMG/M
3300025509|Ga0208848_1042981All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300025900|Ga0207710_10057399All Organisms → cellular organisms → Bacteria → Acidobacteria1758Open in IMG/M
3300025906|Ga0207699_10398185All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300025910|Ga0207684_10003772All Organisms → cellular organisms → Bacteria14644Open in IMG/M
3300025915|Ga0207693_10617786Not Available843Open in IMG/M
3300025916|Ga0207663_10505310Not Available939Open in IMG/M
3300025927|Ga0207687_10434430All Organisms → cellular organisms → Bacteria → Acidobacteria1086Open in IMG/M
3300025961|Ga0207712_12131499Not Available501Open in IMG/M
3300026281|Ga0209863_10055371All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300026304|Ga0209240_1055869All Organisms → cellular organisms → Bacteria1482Open in IMG/M
3300026312|Ga0209153_1005001All Organisms → cellular organisms → Bacteria → Acidobacteria4144Open in IMG/M
3300026351|Ga0257170_1028809Not Available746Open in IMG/M
3300026514|Ga0257168_1000586All Organisms → cellular organisms → Bacteria → Proteobacteria3908Open in IMG/M
3300026551|Ga0209648_10019147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5984Open in IMG/M
3300027651|Ga0209217_1046927All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300027651|Ga0209217_1180363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300027660|Ga0209736_1155714Not Available606Open in IMG/M
3300027727|Ga0209328_10100951All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300027846|Ga0209180_10060282All Organisms → cellular organisms → Bacteria2109Open in IMG/M
3300027874|Ga0209465_10589921Not Available551Open in IMG/M
3300027884|Ga0209275_10463783Not Available719Open in IMG/M
3300027889|Ga0209380_10009668All Organisms → cellular organisms → Bacteria5647Open in IMG/M
3300027894|Ga0209068_10000083All Organisms → cellular organisms → Bacteria56073Open in IMG/M
3300027894|Ga0209068_10015578All Organisms → cellular organisms → Bacteria → Acidobacteria3657Open in IMG/M
3300027894|Ga0209068_10372095All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300027910|Ga0209583_10782950Not Available506Open in IMG/M
3300028047|Ga0209526_10215331All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300028047|Ga0209526_10357231All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300029636|Ga0222749_10039143All Organisms → cellular organisms → Bacteria2051Open in IMG/M
3300030991|Ga0073994_10051369Not Available1423Open in IMG/M
3300031231|Ga0170824_125874587All Organisms → cellular organisms → Bacteria → Acidobacteria1028Open in IMG/M
3300031474|Ga0170818_101706552All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300031708|Ga0310686_108813543Not Available1343Open in IMG/M
3300031720|Ga0307469_10015587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3938Open in IMG/M
3300031720|Ga0307469_11415301Not Available663Open in IMG/M
3300031753|Ga0307477_10021465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4411Open in IMG/M
3300031753|Ga0307477_10208672All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300031754|Ga0307475_10346390All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300031754|Ga0307475_10489778All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300031771|Ga0318546_10935550Not Available610Open in IMG/M
3300032180|Ga0307471_101214048All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300032205|Ga0307472_100931860Not Available807Open in IMG/M
3300032205|Ga0307472_102236187Not Available552Open in IMG/M
3300032770|Ga0335085_10000642All Organisms → cellular organisms → Bacteria92819Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.24%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds6.47%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.47%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.53%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.35%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.18%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.18%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.18%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.18%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.18%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.59%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.59%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.59%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.59%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.59%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.59%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.59%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002910Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010857Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015087Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026351Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-BEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A2_c1_002272802124908043SoilMAQVIEFYIPARFKPKVKWIPLEQRGKILAFPVDLKKSA
deeps_029483102199352024SoilRVWRDRRMAMAQVIEFYIPSRFKSRVKWIPSERRGRVLAFPTAIKKSA
JGI12630J15595_1009883923300001545Forest SoilGRVMAQVIEFYIPERFKVKVKWIPAEQRGKIITFPTDLKKSA*
JGI12635J15846_1067272723300001593Forest SoilMAQVIEFYIPTRFKPKVKWVPVAQRGKIIVFPTDLKKSA*
C688J18823_1002555043300001686SoilMMKLWRVWRDRRMAMAQVIEFYIPSRFKPRVKWIPSDRRGRVIAFPAAIKKSA*
JGIcombinedJ26739_10036569523300002245Forest SoilMAQVIEFYIPERFKVKVKWXPAEQRGKIITFPTDLKKSA*
JGIcombinedJ26739_10081043623300002245Forest SoilMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA*
JGIcombinedJ26739_10089278823300002245Forest SoilMAQVIEFYIPARFKPKVKWVPVEQRGKILVFPAELKKSA*
C688J35102_12028055323300002568SoilMAQVIEFYIPSRFKAKVKWIPLEQRGKIIAFPIDFKKSA*
JGI25615J43890_102199923300002910Grasslands SoilMARVIEFYIPARFKPKAKREIQEQRGKVIAFPSDLKKPA*
Ga0062595_10000046063300004479SoilMAQVIEFYIPTRFQRRMKWVPPTQRGKILQFPGELKKSA*
Ga0062595_10002499523300004479SoilMAQVIEFYIPARFKPKVKWVPLEQRGKILLFSADLKKSA*
Ga0062595_10137540923300004479SoilVILQYEGWTAVDRRMVMAEVIEFYIPARFKQKVRWIPPEQRGKVIAFPTELKKSA*
Ga0062595_10225665423300004479SoilMAQVIEFYIPTRFKPKVRWIPAEQRGKLLAFPTDLKKSA*
Ga0066677_1038684613300005171SoilMAHVIEFYIPARFNTKPKGVTQEKRGKVIAFPSDRKKSA*
Ga0066680_1003225143300005174SoilMAHVIEFYIPARFSTKPKGVTQEKRGKVIAFPSDRKKSA*
Ga0066673_1002040823300005175SoilMAQVIEFYIPASFKRKVKWIPAEQRGKIIFFPSDLKKSA*
Ga0066673_1006871343300005175SoilDRRGDMAQVIEFYIPTRFQRRMKWVPPTQRGKILQFPGELKKSA*
Ga0066690_1090641023300005177SoilETCLIALDRRVVMAQVIEFYVPAKFHKKVKWVPPEQRGRMIEFPAEIKKSA*
Ga0066678_1024123623300005181SoilMAYVIEFYIPARFSTKPKGVTQEKRGKVIAFPSDRKKSA*
Ga0065715_1066724213300005293Miscanthus RhizosphereMMEEVRWTAVDRRMVMAQVIEFYIPARFKPKVKWVPLEQRGKILLFSADLKKSA*
Ga0066388_10093084223300005332Tropical Forest SoilMAQVIEFYIPERFKKRVKWVPAENRGKVLSFPVDIKKTA*
Ga0066388_10555065413300005332Tropical Forest SoilMLFRIRGFMAQVIEFYIPTRFKQKVKWIPPQERGKIIDSPSQLNKWA*
Ga0066388_10579363513300005332Tropical Forest SoilMAQVIEFYVPARFQRKVKWIPPTQRGKILQFPGELKRSA*
Ga0066388_10735703813300005332Tropical Forest SoilMAQVIEFYIPTRFKQKVKWVPPEQRGKIIDFPSDLKKSA*
Ga0070709_1020884423300005434Corn, Switchgrass And Miscanthus RhizosphereMAEVIEFYIPARFKQKVRWIPPEQRGKVIAFPTELKKSA*
Ga0070713_10227050513300005436Corn, Switchgrass And Miscanthus RhizosphereMVMAEVIEFYIPARFKQKVRWIPPEQRGKVIAFPTELKKSA*
Ga0070710_1074736023300005437Corn, Switchgrass And Miscanthus RhizosphereMMEEVRWTAVDRRMVMAQVIEFYIPARFKPKVKWVPLEQRGKILLFSTDLKKSA*
Ga0070711_10078059213300005439Corn, Switchgrass And Miscanthus RhizosphereMAQVIEFYIPARFKPRMKWIPPEQRGKIITFPTDLKKSA*
Ga0070708_10000838623300005445Corn, Switchgrass And Miscanthus RhizosphereMAQVIEFYIPASFKSKVKWIPPEQRGKVITFPTDLKKSA*
Ga0066686_1004350343300005446SoilMAHVIEFYIPARFKTKPKGVTQEQRGKVIAFPSDRKKSA*
Ga0070706_10201659513300005467Corn, Switchgrass And Miscanthus RhizosphereVAHVIEFYIPARFKTKPKGVTQEQRGKVIAFPSDRKKSA*
Ga0070698_10022546923300005471Corn, Switchgrass And Miscanthus RhizosphereVAHVIEFYIPARFKTKPKGVTQEQRGKVIAFPADRKKSA*
Ga0070697_10029383913300005536Corn, Switchgrass And Miscanthus RhizosphereMMEEVRWTAVDRRMVMAQVIEFYIPARFKPKVKWLPLEQRGKIILFPTDLKKSA*
Ga0070762_1039105423300005602SoilMAHVIEFYIPARFKTKPNGATQEQREKVIAFPSDRKKSA*
Ga0070762_1085079413300005602SoilMAPVIEFYIPARFKPKVKWVPQEQPEKVIAFPSDLKKSA*
Ga0070763_1008592133300005610SoilMAPVIEFYIPARFKPKVKWVPQEQREQVIAFPSDLKKSA*
Ga0070763_1029395413300005610SoilMAHVIQFYIPTRFKQKVKWVPQEQRGKIIAFPSDLKKSA*
Ga0068856_10059342923300005614Corn RhizosphereMAQVIEFYIPSRFKAKEKWIPLEQRGKIIAFPIDFKKSA*
Ga0066903_10027055023300005764Tropical Forest SoilMAQVIEFYIPARFQRRVKWVPPAQRGKILQFPGELKKSA*
Ga0066903_10205878523300005764Tropical Forest SoilMALVIEFYIPKRFKQKVKWVPPQERGKIIDFPSDLKKSA*
Ga0068863_10250154923300005841Switchgrass RhizosphereMAQVIEFYIPSRFKAKVKWIPLEQRGKVIAFPIDFKKSA*
Ga0080027_1008519523300005993Prmafrost SoilMAQVIEYYIPTRFKPKAKWVPAEQRGKIIVFPTDLKKSA*
Ga0070717_1068917513300006028Corn, Switchgrass And Miscanthus RhizosphereVDRRMVMAEVIEFYIPARFKQKVRWIPPEQRGKVIAFPTELKKSA*
Ga0066656_1017274823300006034SoilMAHVIVFYIPARFKTKPKGVTQEQRGKVIAFPSDRKKSA*
Ga0075028_10000121543300006050WatershedsMAQVIEFYIPARFKSKVKWIPLEQRGKILSFPADLKKSA*
Ga0075028_10032057523300006050WatershedsMAQVIEFYIPARFKPKVKWIPLEQRGKILAFPVDLKKSA*
Ga0075028_10038033023300006050WatershedsMAQVIEFYIPATFKQKVKWIPPEQRGKIISFPADLKKSA*
Ga0075028_10099670013300006050WatershedsMAQVIEFYIPSRFKVKVKWIPLEQRGKIIAFPVDFKKSA*
Ga0075017_10079994113300006059WatershedsEYYIPTRFKPKVKWVPAEQRGKIIVFPTDLKKSA*
Ga0075030_10004307543300006162WatershedsMAQLIEFYIPARFKPKVKWVPVEQRGKIIAFPTDLKKSA*
Ga0075018_1041966113300006172WatershedsMMKEAKRAAVDRRMVMAQVIEFYIPSRFKPKIKWVSMEQRGKIIAFPTDLKKSA*
Ga0070712_10086995623300006175Corn, Switchgrass And Miscanthus RhizosphereMAQVIEFYIPARFKPRIKWIPPEQRGKIITFPTDLKKSA*
Ga0070712_10125183913300006175Corn, Switchgrass And Miscanthus RhizosphereMMEEVRWTAVDRRMVMAQVIEFYIPTRFKPKVKWIPVEQRGRIIAFPADLKKSA*
Ga0070765_10000184833300006176SoilMAWEIEFHVPTSFKPKAKWVPQDQRGKIIAFTPDLKKSA*
Ga0070765_10074707123300006176SoilMDRRMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA*
Ga0099829_1000631223300009038Vadose Zone SoilMAQVIEFYIPARFKPKVKWMPLEQRGKILWFPADLKKSA*
Ga0099829_1086399023300009038Vadose Zone SoilMAQVIEFYIPTRFKPKVKWTPPEQRGKILAFAADLKKSA*
Ga0099830_1010007323300009088Vadose Zone SoilMAQVIEFYIPARFKPKVKWIPLEQRGKILWFPADLKKSA*
Ga0099828_1060608523300009089Vadose Zone SoilMAHVIEFYIPARFKTKPKGVTQEQRGKVIAFTSYRKKSA*
Ga0105245_1038676213300009098Miscanthus RhizosphereMAQVIEFYIPARFKPKVKWIPPEQRGKILAFPVDLKKSA*
Ga0126374_1014529613300009792Tropical Forest SoilMAQVIEFYIPTRFKQKVKWVPQGQRGRIIAFRSDFKKS
Ga0126384_1033820423300010046Tropical Forest SoilMAQVIEFYIPARFKQKVKWVPPEQRGKIIDFPSDLKKSA*
Ga0126384_1058875313300010046Tropical Forest SoilVRLFRRSEDVMAQVIEFYIPTRFKQKVKWVPQGQRGRIIVFRSDLKRSA*
Ga0126382_1076978113300010047Tropical Forest SoilMKLWHVWRDRRMVMARVIEFYIPDRFKPRVKWIPREQRGRVIAFPGVIRKSA*
Ga0126373_1004268323300010048Tropical Forest SoilMAQVIEFYIPTRFKQKVKWVPQGQRGRIIAFRSDFKKSA*
Ga0126373_1010900323300010048Tropical Forest SoilMAQVIEFYIPMRFKQKMKWVPQQQRGKIIDFPSKLKKSA*
Ga0126373_1148460613300010048Tropical Forest SoilQVIEFYIPTRFKQKVKWVPPEQRGKIIDFPSDLKKSA*
Ga0126373_1304774613300010048Tropical Forest SoilMAQVIEIYIPPGFKRKMKWVPPEQRGKIIVFPSDLKKSA*
Ga0126370_1004109613300010358Tropical Forest SoilMAQVIEFYIPTRFKQKVKWVPQGQRGRIIVFRSDLKRSA*
Ga0126370_1020839823300010358Tropical Forest SoilVRPFRRSEDVMAQVIEFYIPTRFKQKVKWVPQRQRGRIIAFRSDFKKSA*
Ga0126370_1217716813300010358Tropical Forest SoilLWNVYEMARLIEFYIPGRFQRKVKWIPPNQRGKLIEFFVKKSA*
Ga0126376_1271686513300010359Tropical Forest SoilMAQVIEFYIPARFKQKVKWVPPERRGKIIDFPSDLKKSA*
Ga0126372_1011607923300010360Tropical Forest SoilMAQVIEFYIPARFKQNVKWVPPEQRGKIIDFPSDLKKSA*
Ga0126372_1103277913300010360Tropical Forest SoilMAQVIEFYIPARFQRRVKWVPPAQRGKILQFPGELKKS
Ga0126379_10000489213300010366Tropical Forest SoilMAQVIEFYIPTRFKQKVKWVPQRQRGRIIAFRSDFKKSA*
Ga0126379_1079126823300010366Tropical Forest SoilMAQVIEFYIPERFKKRVKWVPAENRGKVLSFPIDIKKTA*
Ga0105239_1034135723300010375Corn RhizosphereCLMAQVIEFYIPSRFKAKVKWIPLEQRGKVIAFPIDFKKSA*
Ga0126381_10015300323300010376Tropical Forest SoilMAHVIEFYIPARFKLKVKWVPREQRGKIIAFRSDLKKSA*
Ga0126381_10077099223300010376Tropical Forest SoilIEFYIPMRFNQKMKWVPQQQRGKIIDFPSKLKKSA*
Ga0134121_1305313923300010401Terrestrial SoilMAQVIEFYIPARFKPKVKWIPPEQRGKILTFPVDLKKSA*
Ga0126354_104212813300010857Boreal Forest SoilKPGAVMMEEVRWTAVDRRMVMAQVIEFYIPARFKPKVKWVPLEQRGKILLFPTDLKKSA*
Ga0137391_1022382213300011270Vadose Zone SoilMVMAQVIELYIPARFKPKVKWVPVEQRGKIIAFPTDLKKSA*
Ga0137391_1028587633300011270Vadose Zone SoilAQVIEFYIPVSFKPKVKWVPQEERGKVIAFPPELKKSA*
Ga0137391_1051860823300011270Vadose Zone SoilMAQVIEFYTPPRFKPKVKWIPPEQRGKILAFPTELKKSA*
Ga0137391_1090943013300011270Vadose Zone SoilMMKEAKRAAVDRRMVMAQVIEFYIPSRFKRKVKWVPMEQRGKIIAFPTDLKKSA*
Ga0137388_1063881923300012189Vadose Zone SoilRTAVDRRMVMAQVIEFYIPARLKPKVKWVPVEQRGKIIAFPTDLKKSA*
Ga0137388_1081592633300012189Vadose Zone SoilMAHIIEFYIPARFKTKPKGATQEQRGKVIAFPSDRKKS
Ga0137388_1126453513300012189Vadose Zone SoilMAQVIEFYIRARFKQKVKWIPPEQRGKIISFPADLKKSA*
Ga0137363_1039601823300012202Vadose Zone SoilMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIEFPADLKKSA*
Ga0137376_1151117823300012208Vadose Zone SoilVKRVGVLLFSDRRVEMAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPAEIRKSA*
Ga0137379_1047974323300012209Vadose Zone SoilMAMAQVIEFYIPSRFKPKVKWIPSDRRGRVIAFPAAIKKSA*
Ga0137379_1067832423300012209Vadose Zone SoilMARVIEFYVPAGFQRKSKWISPDERGKILEFPLAVKRTA*
Ga0137390_1007298813300012363Vadose Zone SoilMAQVIGFYIPTRFKPKVQWIPPEQRGKILAFPTELKKSA*
Ga0137397_1019691613300012685Vadose Zone SoilMMKEAKRAAVDRRMVMAQVIEFYIAARFKPKVKWVPVEQRGKIIAFPTDLKKSA*
Ga0137413_1049594323300012924Vadose Zone SoilMAQVIEFYIPASYRPKVKWIPPERRGKVIEFRADLKKSA*
Ga0137407_1000097463300012930Vadose Zone SoilMDRRLIMAQVIEFYIPTRFKQKVKWVPMEQRGKILSFPVDFKKSA*
Ga0137407_1056336623300012930Vadose Zone SoilMAQVIEFYIPKRFKPKVKWIPPEQRGKILVFPTDLKKSA*
Ga0164299_1016857323300012958SoilMAQVIEFYIPAGFRAKVKWIPPEQRGKILAFPVDLKKSA*
Ga0164309_1083368423300012984SoilMAQVIEFYIPSRFKPKVKWVPVEQRGKILLFSTDLKKSA*
Ga0157378_1021416433300013297Miscanthus RhizosphereAQVIEFYIPARFKPKVKWIPPEQRGKILTFPVDLKKSA*
Ga0157376_1130813913300014969Miscanthus RhizosphereQVIEFYIPSRFKPKVKWIPLEQRGKIIAFPIDFKKSA*
Ga0167637_101432023300015087Glacier Forefield SoilMVMAQVIEYYIPTRFKPKVKWVPAEQRGKIIVFPADLKKSA*
Ga0163161_1156100523300017792Switchgrass RhizosphereMAQVIEFYIPSRFKAKEKWIPLEQRGKIIAFPIDFKKSA
Ga0187776_1104354023300017966Tropical PeatlandMVMAQAIEFYISARFKPKVKWVPEEMRGKILVFPADLKKSA
Ga0187823_1001034133300017993Freshwater SedimentMAQVIEFYIPTRFKQKVKWIPPEQRGKVIAFPTDLKKSA
Ga0066662_1005480733300018468Grasslands SoilMAYVIEFYIPARFSTKPKGVTQEKRGKVIAFPSDRKKSA
Ga0066669_1023745723300018482Grasslands SoilMAQVIEFYIPASFKRKVKWIPAEQRGKIIFFPSDLKKSA
Ga0193729_122629823300019887SoilMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIEFPTDLKKSA
Ga0193751_103006033300019888SoilMAQVIEFYTPGSFKPKAKWVPQEQRGRVIAFPSELKKSA
Ga0193751_103341833300019888SoilMAHIEFYIPARFKTKPKGVTQEQRGKVIAFPSDRKKSA
Ga0179592_1039006013300020199Vadose Zone SoilMAQVIEFYIPASYRPKVKWIPPERRGKVIEFRADLKKSA
Ga0210407_1007134023300020579SoilMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA
Ga0210401_1012326323300020583SoilMAQVIEFYIAVDRRMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA
Ga0210382_1054598123300021080Groundwater SedimentVDRRLDMAQVIEFYVPTRFKPKVKWIPPEQRGKILVFPTDLKKSA
Ga0210405_1012924733300021171SoilMDRRMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA
Ga0193719_1001245333300021344SoilMAPVIEFYIPASFKPKVKWIPAEQRGKILAFPTDLKKSA
Ga0210393_1111507223300021401SoilMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA
Ga0210386_1147567413300021406SoilCNEEDRRGFMAQVIEFYIPTRFTATVRWVPEKERGKVLTFPTDLEKSA
Ga0210383_1111500913300021407SoilVILQEEGWAAMDRRMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA
Ga0210394_1084825813300021420SoilMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLK
Ga0210384_1078607523300021432SoilMAQVIEFYIPARFKPKVKWVPVEQRGKILEFPADMKKSA
Ga0210402_1123368223300021478SoilMAQVIEFYIPSRYKQKVKWVPPELRGKIIAFPADLKKSA
Ga0126371_1002344063300021560Tropical Forest SoilMAQVIEFYIPTRFKQKVRWVPQRQRGRIIAFRSDFKKSA
Ga0126371_1327563313300021560Tropical Forest SoilNMAQVIEFYIPARFQRRVKWVPPAQRGKILQFPGELKKSA
Ga0179589_1043898113300024288Vadose Zone SoilMAEVIEFYIPTRFKPKVKWIPPELRGKVIEFPTELKKSA
Ga0208848_104298123300025509Arctic Peat SoilMAQVIEYYIPTRFKPKVKWVPAEQRGKIIVFPTDLKKSA
Ga0207710_1005739923300025900Switchgrass RhizosphereMAQVIEFYIPARFKPKVKWVPLEQRGKILLFSTDLKKSA
Ga0207699_1039818523300025906Corn, Switchgrass And Miscanthus RhizosphereMVMAEVIEFYIPARFKQKVRWIPPEQRGKVIAFPTELKKSA
Ga0207684_10003772163300025910Corn, Switchgrass And Miscanthus RhizosphereMAQVIEFYIPASFKSKVKWIPPEQRGKVITFPTDLKKSA
Ga0207693_1061778623300025915Corn, Switchgrass And Miscanthus RhizosphereMMEEVRWTAVDRRMVMAQVIEFYIPARFKPKVKWIPVEQRGRIIAFPADLKKSA
Ga0207663_1050531023300025916Corn, Switchgrass And Miscanthus RhizosphereVDRRRVMAQVIEFYIPARFKPRMKWIPPEQRGKIITFPTDLKKSA
Ga0207687_1043443023300025927Miscanthus RhizosphereMAQVIEFYIPSRFKAKVKWIPLEQRGKVIAFPIDFKKSA
Ga0207712_1213149913300025961Switchgrass RhizosphereMAQVIEFYIPTRFKPKVKWVPPEQRGKILAFPTDLK
Ga0209863_1005537113300026281Prmafrost SoilMAQVIEYYIPTRFKPKAKWVPAEQRGKIIVFPTDLKKSA
Ga0209240_105586923300026304Grasslands SoilMARVIEFYIPARFKPKAKREIQEQRGKVIAFPSDLKKPA
Ga0209153_100500113300026312SoilMAQVIEFYIPTRFQRRMKWVPPTQRGKILQFPGELKKSA
Ga0257170_102880913300026351SoilMVMAQVIEFYIPARFKPKVKWIPLEQRGKILWFPADLKKSA
Ga0257168_100058643300026514SoilVAHVIEFYIPARFKTKPKGVTQEQRGKVIAFPSDRKKSA
Ga0209648_1001914763300026551Grasslands SoilVAHVIEFYIPARFKTKPKGMTQEQRGKVIAFPSDRKKSA
Ga0209217_104692723300027651Forest SoilMAQVIEFYIPSRFKPKVKWVPVEQRGKILVFPAELKKSA
Ga0209217_118036313300027651Forest SoilMAQVIEFYIPERFKVKVKWIPAEQRGKIITFPTDLKKSA
Ga0209736_115571413300027660Forest SoilMVMAQVIEFYIPTRFKPKVKWVPVAQRGKIIVFPTDLKKSA
Ga0209328_1010095113300027727Forest SoilMAQVIEFYIPTRFKPKVKWVPVAQRGKIIAFPTDLKKSA
Ga0209180_1006028213300027846Vadose Zone SoilMAQVIEFYIPARFKPKVKWIPLEQRGKILWFPADLKKSA
Ga0209465_1058992113300027874Tropical Forest SoilVWRDRRMVMARVIEFYIPDRFKPRVKWIPREQRGRVIAFPGVIRKSA
Ga0209275_1046378313300027884SoilMAPVIEFYIPARFKPKVKWVPQEQPEKVIAFPSDLKKSA
Ga0209380_1000966823300027889SoilMAPVIEFYIPARFKPKVKWVPQEQREQVIAFPSDLKKSA
Ga0209068_10000083143300027894WatershedsMAQVIEFYIPARFKSKVKWIPLEQRGKILSFPADLKKSA
Ga0209068_1001557813300027894WatershedsMAQVIEFYIPATFKQKVKWIPPEQRGKIISFPADLKKSA
Ga0209068_1037209513300027894WatershedsMMKEAKRAAVDRRMVMAQVIEFYIPSRFKPKIKWVSMEQRGKIIAFPTDLKKSA
Ga0209583_1078295013300027910WatershedsVMAQVIEFYIPARFKSKVKWIPLEQRGKILSFPADLKKSA
Ga0209526_1021533133300028047Forest SoilMARVIEFYIPARFKVNVKWIPPEQRGKIITFPTDLKKSA
Ga0209526_1035723113300028047Forest SoilMAQVIEFYIPTRFKPKVKWVPVAQRGKIIVFPTDLKKSA
Ga0222749_1003914313300029636SoilAVILQEEGWAAMDRRMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA
Ga0073994_1005136923300030991SoilMAQVIEFYIHARFKPRVKWVPQEQRGKVVEFPSELKQSA
Ga0170824_12587458713300031231Forest SoilMAQVIEFYIPSRFKSKAKWIPAELRGKVLTFPANLKKP
Ga0170818_10170655223300031474Forest SoilMAQVIEFYIPSRFKSKVKWIPAELRGKVLTFPANLKK
Ga0310686_10881354323300031708SoilMAPVIEFYIPARFKPKVKWMPQEQCEQVIASPSDLKKSA
Ga0307469_1001558763300031720Hardwood Forest SoilDRRLVMAQVIEFYIPTRFKPKVRWIPAEQRGKLLAFPTDLKKSA
Ga0307469_1141530113300031720Hardwood Forest SoilMAQVIEFYIPVRFKPKVKWVPVEQRGKILAFPTDLKKSA
Ga0307477_1002146563300031753Hardwood Forest SoilMAQVIEIYIPARFKTKPKGVSREQRGKVIAFPSDRKKSA
Ga0307477_1020867223300031753Hardwood Forest SoilMAQVIEFYIPTRFKQKVKWVPQEQRGKIVALPSDLKK
Ga0307475_1034639023300031754Hardwood Forest SoilMAEVIEFYIPARFKPKVKWIPLEQRGKVLSFPTDLKKSA
Ga0307475_1048977823300031754Hardwood Forest SoilMAQVIEFYIPTRFKQKVKWVPQEQRGKIVALPSDLKKSA
Ga0318546_1093555013300031771SoilMAYVIEFYVPARFKPKAKCAPEQRGKLIAFPSDAKKRFRSFLASV
Ga0307471_10121404823300032180Hardwood Forest SoilMAQVIEFYIPTRFKPKVKWTPPEQRGKVLAFPADLKKSA
Ga0307472_10093186023300032205Hardwood Forest SoilMAQVIEFYIPARFKPKVKWVPVEQRGKILEFPAAMKKSA
Ga0307472_10223618713300032205Hardwood Forest SoilMDRRMDGSEDDMAQVIEYYIPARFKPKVKWVPVEQRGKILEFPADLKKSA
Ga0335085_10000642353300032770SoilMAQVIEFYIPTRFKPKVKWVPAEQRGKILVFPTDLKKSA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.