NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036913

Metagenome / Metatranscriptome Family F036913

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036913
Family Type Metagenome / Metatranscriptome
Number of Sequences 169
Average Sequence Length 47 residues
Representative Sequence VKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA
Number of Associated Samples 128
Number of Associated Scaffolds 169

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 42.60 %
% of genes near scaffold ends (potentially truncated) 44.97 %
% of genes from short scaffolds (< 2000 bps) 83.43 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.781 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.669 % of family members)
Environment Ontology (ENVO) Unclassified
(30.178 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.746 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 54.67%    β-sheet: 0.00%    Coil/Unstructured: 45.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 169 Family Scaffolds
PF02080TrkA_C 38.46
PF00487FA_desaturase 8.88
PF00196GerE 8.28
PF11611DUF4352 7.10
PF00999Na_H_Exchanger 2.96
PF04237YjbR 2.37
PF13683rve_3 1.78
PF07731Cu-oxidase_2 0.59
PF13191AAA_16 0.59
PF01594AI-2E_transport 0.59
PF01343Peptidase_S49 0.59
PF01028Topoisom_I 0.59
PF06965Na_H_antiport_1 0.59
PF00400WD40 0.59
PF07366SnoaL 0.59
PF07732Cu-oxidase_3 0.59
PF00005ABC_tran 0.59
PF16859TetR_C_11 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 169 Family Scaffolds
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 8.88
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 8.88
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 3.55
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 2.96
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 2.96
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 2.96
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 2.96
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 2.37
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.18
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 1.18
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.59
COG3569DNA topoisomerase IBReplication, recombination and repair [L] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.78 %
UnclassifiedrootN/A27.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_10790833All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300000443|F12B_11160209Not Available855Open in IMG/M
3300000550|F24TB_11641612Not Available513Open in IMG/M
3300000858|JGI10213J12805_10026819Not Available504Open in IMG/M
3300000956|JGI10216J12902_106392108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1026Open in IMG/M
3300001431|F14TB_100323158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1045Open in IMG/M
3300001686|C688J18823_10755140All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300002568|C688J35102_120978570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4495Open in IMG/M
3300003324|soilH2_10384009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4199Open in IMG/M
3300003373|JGI25407J50210_10042242All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300003911|JGI25405J52794_10018682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1385Open in IMG/M
3300004463|Ga0063356_101768203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300004479|Ga0062595_100019909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2509Open in IMG/M
3300004479|Ga0062595_100372891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1007Open in IMG/M
3300004480|Ga0062592_102582264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300004643|Ga0062591_101703944Not Available639Open in IMG/M
3300004798|Ga0058859_10033493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300005093|Ga0062594_101754257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300005158|Ga0066816_1008250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia730Open in IMG/M
3300005168|Ga0066809_10141329All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005327|Ga0070658_10459107Not Available1098Open in IMG/M
3300005331|Ga0070670_101225580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp.686Open in IMG/M
3300005339|Ga0070660_100905577Not Available744Open in IMG/M
3300005347|Ga0070668_100751563All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005353|Ga0070669_101884945Not Available522Open in IMG/M
3300005356|Ga0070674_100513640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1000Open in IMG/M
3300005455|Ga0070663_101409614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales617Open in IMG/M
3300005457|Ga0070662_100529228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia986Open in IMG/M
3300005457|Ga0070662_100940432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia738Open in IMG/M
3300005459|Ga0068867_101268747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia679Open in IMG/M
3300005543|Ga0070672_101702863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300005545|Ga0070695_101570098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300005546|Ga0070696_101989879Not Available504Open in IMG/M
3300005844|Ga0068862_100944832Not Available850Open in IMG/M
3300005937|Ga0081455_10002880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia20248Open in IMG/M
3300005937|Ga0081455_10936138Not Available538Open in IMG/M
3300005937|Ga0081455_11017980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales512Open in IMG/M
3300005981|Ga0081538_10248059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales681Open in IMG/M
3300006049|Ga0075417_10559794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300006058|Ga0075432_10001051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8792Open in IMG/M
3300006058|Ga0075432_10084221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1156Open in IMG/M
3300006169|Ga0082029_1054563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales5276Open in IMG/M
3300006196|Ga0075422_10096413All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300006572|Ga0074051_11238134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia697Open in IMG/M
3300006844|Ga0075428_100032203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5791Open in IMG/M
3300006844|Ga0075428_100062870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales4063Open in IMG/M
3300006844|Ga0075428_100675627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1101Open in IMG/M
3300006844|Ga0075428_101920333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia615Open in IMG/M
3300006845|Ga0075421_101639931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia698Open in IMG/M
3300006846|Ga0075430_100968164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia701Open in IMG/M
3300006853|Ga0075420_100200798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1741Open in IMG/M
3300006876|Ga0079217_10221628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia985Open in IMG/M
3300006876|Ga0079217_10762398Not Available664Open in IMG/M
3300006881|Ga0068865_101484909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales607Open in IMG/M
3300006894|Ga0079215_10222640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300006918|Ga0079216_10580969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales765Open in IMG/M
3300007004|Ga0079218_10623008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales991Open in IMG/M
3300009098|Ga0105245_10252252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1715Open in IMG/M
3300009098|Ga0105245_11492766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300009098|Ga0105245_11642939All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300009100|Ga0075418_12719923Not Available540Open in IMG/M
3300009553|Ga0105249_11386488All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300009553|Ga0105249_11626515Not Available718Open in IMG/M
3300009553|Ga0105249_11819473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300009789|Ga0126307_11220689Not Available609Open in IMG/M
3300009840|Ga0126313_11014919Not Available680Open in IMG/M
3300010037|Ga0126304_10823893Not Available630Open in IMG/M
3300010038|Ga0126315_10163983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1322Open in IMG/M
3300010040|Ga0126308_10011661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4475Open in IMG/M
3300010041|Ga0126312_10088267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2109Open in IMG/M
3300010041|Ga0126312_10925151Not Available636Open in IMG/M
3300010042|Ga0126314_10429643Not Available954Open in IMG/M
3300010042|Ga0126314_10773376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300010045|Ga0126311_10029788All Organisms → cellular organisms → Bacteria3347Open in IMG/M
3300010045|Ga0126311_10033067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3198Open in IMG/M
3300010375|Ga0105239_11408858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300011000|Ga0138513_100013456Not Available1056Open in IMG/M
3300012212|Ga0150985_111256369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300012469|Ga0150984_105075129All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300012897|Ga0157285_10351059Not Available517Open in IMG/M
3300012911|Ga0157301_10005096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2393Open in IMG/M
3300012938|Ga0162651_100012965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1053Open in IMG/M
3300012938|Ga0162651_100057134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300013308|Ga0157375_10614855Not Available1245Open in IMG/M
3300015371|Ga0132258_10102907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6735Open in IMG/M
3300015371|Ga0132258_10465782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3153Open in IMG/M
3300015371|Ga0132258_10576525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2823Open in IMG/M
3300015371|Ga0132258_12217228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae1379Open in IMG/M
3300015372|Ga0132256_102299872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300015373|Ga0132257_102459612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300015374|Ga0132255_102431449Not Available800Open in IMG/M
3300015374|Ga0132255_105429475Not Available539Open in IMG/M
3300017792|Ga0163161_10057184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae2834Open in IMG/M
3300017792|Ga0163161_10300700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1263Open in IMG/M
3300017792|Ga0163161_11509640All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300017965|Ga0190266_10143655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1061Open in IMG/M
3300017965|Ga0190266_10946225Not Available571Open in IMG/M
3300018027|Ga0184605_10424416Not Available590Open in IMG/M
3300018031|Ga0184634_10249818Not Available813Open in IMG/M
3300018061|Ga0184619_10282733Not Available761Open in IMG/M
3300018066|Ga0184617_1023419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1398Open in IMG/M
3300018073|Ga0184624_10032025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2037Open in IMG/M
3300018076|Ga0184609_10489367Not Available561Open in IMG/M
3300018082|Ga0184639_10088113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1634Open in IMG/M
3300018082|Ga0184639_10515082Not Available601Open in IMG/M
3300018429|Ga0190272_11151297Not Available757Open in IMG/M
3300018432|Ga0190275_10592955Not Available1155Open in IMG/M
3300018466|Ga0190268_10054219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1613Open in IMG/M
3300018466|Ga0190268_10190082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1106Open in IMG/M
3300018466|Ga0190268_11345337Not Available606Open in IMG/M
3300018469|Ga0190270_10093099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2280Open in IMG/M
3300018476|Ga0190274_11947800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300018481|Ga0190271_10748682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1101Open in IMG/M
3300018481|Ga0190271_11238535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300018481|Ga0190271_12132810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300018481|Ga0190271_13355707Not Available537Open in IMG/M
3300019279|Ga0184642_1554644Not Available636Open in IMG/M
3300019767|Ga0190267_10773843Not Available633Open in IMG/M
3300019767|Ga0190267_10932149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp.599Open in IMG/M
3300019767|Ga0190267_11332837Not Available539Open in IMG/M
3300019869|Ga0193705_1004612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus phosphovorus → Microlunatus phosphovorus NM-13019Open in IMG/M
3300019873|Ga0193700_1006706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1802Open in IMG/M
3300019873|Ga0193700_1043881Not Available717Open in IMG/M
3300021078|Ga0210381_10219115All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300021510|Ga0222621_1050796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300022694|Ga0222623_10207852Not Available759Open in IMG/M
3300022694|Ga0222623_10222000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300022756|Ga0222622_10212028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1292Open in IMG/M
3300022756|Ga0222622_10216785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae1279Open in IMG/M
3300022756|Ga0222622_10376839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia994Open in IMG/M
3300023058|Ga0193714_1063526Not Available519Open in IMG/M
3300025935|Ga0207709_10400916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1049Open in IMG/M
3300025935|Ga0207709_10514832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria936Open in IMG/M
3300025937|Ga0207669_10140926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1674Open in IMG/M
3300025961|Ga0207712_11087019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300025961|Ga0207712_11772472All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300027560|Ga0207981_1048547All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300027873|Ga0209814_10176259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria920Open in IMG/M
3300027907|Ga0207428_10004597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13081Open in IMG/M
3300028597|Ga0247820_11010085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp.594Open in IMG/M
3300028608|Ga0247819_10332438All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300028707|Ga0307291_1004097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3112Open in IMG/M
3300028707|Ga0307291_1049474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1009Open in IMG/M
3300028716|Ga0307311_10229775Not Available548Open in IMG/M
3300028718|Ga0307307_10002077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5031Open in IMG/M
3300028719|Ga0307301_10005883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3422Open in IMG/M
3300028722|Ga0307319_10023796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → environmental samples → uncultured Propionibacteriaceae bacterium1879Open in IMG/M
3300028778|Ga0307288_10036595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1647Open in IMG/M
3300028875|Ga0307289_10096395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1205Open in IMG/M
3300028876|Ga0307286_10369626Not Available535Open in IMG/M
3300030496|Ga0268240_10089675Not Available709Open in IMG/M
3300030903|Ga0308206_1073994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300030905|Ga0308200_1130093Not Available564Open in IMG/M
3300030989|Ga0308196_1073782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300031082|Ga0308192_1070088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300031091|Ga0308201_10170625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300031092|Ga0308204_10251149Not Available573Open in IMG/M
3300031092|Ga0308204_10254265Not Available571Open in IMG/M
3300031114|Ga0308187_10078756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria979Open in IMG/M
3300031184|Ga0307499_10027379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1273Open in IMG/M
3300031454|Ga0272427_1015277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6117Open in IMG/M
3300031731|Ga0307405_10001131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10944Open in IMG/M
3300031731|Ga0307405_10143582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1668Open in IMG/M
3300031740|Ga0307468_101411632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300031852|Ga0307410_10000531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria15580Open in IMG/M
3300031901|Ga0307406_10306887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1222Open in IMG/M
3300032004|Ga0307414_10016431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4498Open in IMG/M
3300032126|Ga0307415_101054835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria758Open in IMG/M
3300034673|Ga0314798_104014Not Available604Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.28%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.51%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.73%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.14%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.55%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.96%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.78%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.78%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.18%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.18%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.18%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere1.18%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.59%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.59%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.59%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.59%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.59%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.59%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005158Soil and rhizosphere microbial communities from Laval, Canada - mgHAAEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030989Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031454Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak sudEnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300034673Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1079083323300000363SoilVKWKVVLAVGAVTGGALWFVRRRSRRAAADAELWAEATDPIARFGDT*
F12B_1116020923300000443SoilVKWKEVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIARFGES*
F24TB_1164161213300000550SoilVKWKVVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPI
JGI10213J12805_1002681913300000858SoilVKWKVVLAIGAVAGSAVWFARRKSRRAVEEAELWAEATDPIARFGES*
JGI10216J12902_10639210833300000956SoilVKWKVVLAVGAVAGSALWFVRRRSRRVAADAELWAEATDPITRFGDA*
F14TB_10032315823300001431SoilMVDRVKWKVVLAVGAVAGGAILFARHKSRRAAADAELWAEATDPIARFGDS*
C688J18823_1075514013300001686SoilKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIARFGES*
C688J35102_12097857033300002568SoilVKWKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIARFGES*
soilH2_1038400943300003324Sugarcane Root And Bulk SoilVKWKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIVRFGES*
JGI25407J50210_1004224223300003373Tabebuia Heterophylla RhizosphereMALAVGAIAGGALWLVRRRSRRAAEDAELWAEATDPIARFGES*
JGI25405J52794_1001868223300003911Tabebuia Heterophylla RhizosphereVKWKVVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIARFGES*
Ga0063356_10176820313300004463Arabidopsis Thaliana RhizosphereVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDP
Ga0062595_10001990933300004479SoilLASAAINTAAKVDRVKWKVVVAVGAVAGGAFWYVRRKSRRTAADAELWAEATDPVTRFGES*
Ga0062595_10037289123300004479SoilMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA*
Ga0062592_10258226413300004480SoilVKWKVVLAAGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS*
Ga0062591_10170394413300004643SoilMAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA*
Ga0058859_1003349323300004798Host-AssociatedVKWKLWLAVGALAGGAYWVARRRNRVNADAELWAEATDPVARFGDA*
Ga0062594_10175425713300005093SoilMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA*
Ga0066816_100825023300005158SoilVKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPISRFGDA*
Ga0066809_1014132913300005168SoilVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA*
Ga0070658_1045910723300005327Corn RhizosphereVNWKLWIAVGALAGGAFWAARRRNNRVNADAELWADATDPVARFGDA*
Ga0070670_10122558023300005331Switchgrass RhizosphereVNWKLWIAVGALAGGAFWAARRRNNRVNADAERWAAATDPVARFGDV*
Ga0070660_10090557713300005339Corn RhizosphereMVERVKWKVALAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA*
Ga0070668_10075156323300005347Switchgrass RhizosphereVKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA*
Ga0070669_10188494513300005353Switchgrass RhizosphereVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNV*
Ga0070674_10051364023300005356Miscanthus RhizosphereVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPIIRFGNA*
Ga0070663_10140961423300005455Corn RhizosphereVPPDGYGGPVKWKLWLAVGALAGGAYWVARRRNRVNADAELWADATDPVARFGEV*
Ga0070662_10052922833300005457Corn RhizosphereGGCSVVRESDRSANSLAGGRVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPIIRFGNA*
Ga0070662_10094043213300005457Corn RhizosphereVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA*
Ga0068867_10126874713300005459Miscanthus RhizosphereVKWTLWLAVGALAGGAYWVARRRNRVNADAELWADATDPVARFGDS*
Ga0070672_10170286323300005543Miscanthus RhizosphereVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATD
Ga0070695_10157009813300005545Corn, Switchgrass And Miscanthus RhizosphereVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGN
Ga0070696_10198987923300005546Corn, Switchgrass And Miscanthus RhizosphereMVDRVKWKVVLAVGAVAGGTLWYVRRKSPRAASDAELWAEATDPITRFGDA*
Ga0068862_10094483213300005844Switchgrass RhizosphereGALAGGAFWAARRRNNRVNADAERWADAADPVARFGDA*
Ga0081455_10002880143300005937Tabebuia Heterophylla RhizosphereVKWKVVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIVRFGES*
Ga0081455_1093613813300005937Tabebuia Heterophylla RhizosphereVKWKVVLAIGAIAGSAVWFARRKSRRASEEAELWAEATDPIARFGES*
Ga0081455_1101798023300005937Tabebuia Heterophylla RhizosphereMVDRVKWKVVLAVGAVAGGAILFARRKSRRAAADAELWAEATDPIARFGES*
Ga0081538_1024805923300005981Tabebuia Heterophylla RhizosphereVKWKVVLAVGAVAGGALWFVRRRSRRAEEDAELWAEATDPITRFGES*
Ga0075417_1055979423300006049Populus RhizosphereAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA*
Ga0075432_1000105113300006058Populus RhizosphereVKWKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWS
Ga0075432_1008422123300006058Populus RhizosphereVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA*
Ga0082029_105456343300006169Termite NestMVDRVKWKVVLAVGAVAGGAILFARRKSRRAAADAELWAEATDPIARFGDS*
Ga0075422_1009641333300006196Populus RhizosphereAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIVRFGES*
Ga0074051_1123813423300006572SoilMVLAVGAVAGGAVWFVRRKSRRAVAEAELWAEATDPIARFGET*
Ga0075428_10003220373300006844Populus RhizosphereVKWKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIERFGES*
Ga0075428_10006287043300006844Populus RhizosphereMVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIVRFGES*
Ga0075428_10067562733300006844Populus RhizosphereMVDRVKWKVAIAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGET*
Ga0075428_10192033323300006844Populus RhizosphereAAMVDRVKWKVVLAVGAVAGGAILFARRKSRRAAADAELWAEATDPIARFGDS*
Ga0075421_10163993123300006845Populus RhizosphereAMVDRVKWKVVLAVGAVAGGAILFARRKSRRAAADAELWAEATDPIARFGDS*
Ga0075430_10096816413300006846Populus RhizosphereVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIVRFGES*
Ga0075420_10020079833300006853Populus RhizosphereGCSVVRESDRSASSLAGGRVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA*
Ga0079217_1022162823300006876Agricultural SoilVDRVKWKVVLAVGAAAGGAFWFVRRKSRRSEADAELWAEATDPIARFGDG*
Ga0079217_1076239823300006876Agricultural SoilVKWKVVLAVGAAAGGAYWYVWRKARRAESDAELWAEATDPIGRFGDPDLSESS*
Ga0068865_10148490923300006881Miscanthus RhizosphereVKWKLWLAVGALAGGAYWVARRRNRVNADAELWADATDPVARFGEV*
Ga0079215_1022264023300006894Agricultural SoilVKWKVVLAVGAAAGGAYWYVWRKARRAESDAELWAEATDPIARFGDPDLSESS*
Ga0079216_1058096923300006918Agricultural SoilVKWKVVLAIGAVAGGAVWFARRKSRRAADEAELWAEATDPIARFGES*
Ga0079218_1062300833300007004Agricultural SoilVKWKVVLAVGAAAGGAYWYVWRKARQAESDAELWAEATDPIARFGDPDL*
Ga0105245_1025225223300009098Miscanthus RhizosphereMVERVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA*
Ga0105245_1149276613300009098Miscanthus RhizosphereRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA*
Ga0105245_1164293933300009098Miscanthus RhizosphereLPRYGGRVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNV*
Ga0075418_1271992313300009100Populus RhizosphereMVDVVKWKVVLAVGALAGGALWFVRRKSRQAAEDAELWSEATDPVTRFGES*
Ga0105249_1138648813300009553Switchgrass RhizosphereDRPTNSVAKVGRVKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA*
Ga0105249_1162651513300009553Switchgrass RhizosphereVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPI
Ga0105249_1181947323300009553Switchgrass RhizosphereVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA*
Ga0126307_1122068913300009789Serpentine SoilVKWKVVLAVGAAAGGAYWYVWRKARRAESDAELWAEATDPIARFGDPDL
Ga0126313_1101491913300009840Serpentine SoilMVDVVKWKVALAVGALAGGAMWFVRRKSRRAAEDAELWSEATDPVTRFGES*
Ga0126304_1082389323300010037Serpentine SoilMVDRVKWKVVVAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGES*
Ga0126315_1016398313300010038Serpentine SoilVKWKVVLAVGAAAGGAMWFARRKSRRAAADAELWAEATDPIARFGDS*
Ga0126308_1001166133300010040Serpentine SoilMALAVGAIAGGALWFVRRRSRRAEEDAELWAEATDPITRFGDT*
Ga0126312_1008826713300010041Serpentine SoilMVDRVKWKVVVAVGAVAGGAVWFARRKSRRAAADAELWAEATDPIARFGDS*
Ga0126312_1092515113300010041Serpentine SoilMVDRVKWKVVVAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGDS*
Ga0126314_1042964323300010042Serpentine SoilMVDRVKWKVVLAVGAAAGGAMWFARRKSRRAAADAELWAEATDPIARFGDS*
Ga0126314_1077337623300010042Serpentine SoilRYGGRVKWKVVLAVGAIAGGALWFVRRRSRRAEQDAELWAEATDPIARFGES*
Ga0126311_1002978833300010045Serpentine SoilMVDVVKWKVALAVGALAGGALWFVRRKSRRAAEDAELWSEATDPVTRFGES*
Ga0126311_1003306743300010045Serpentine SoilVKWKVVLAVGAAAGGAYWYVWRKARRAESDAELWAEATDPIARFGDPDT*
Ga0105239_1140885813300010375Corn RhizosphereAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA*
Ga0138513_10001345613300011000SoilLASDAINTAAKVDRVKWKVVLAVGAVAGGTFWYVRRKSRRAAADAELWAEATDPITRFGNA*
Ga0150985_11125636913300012212Avena Fatua RhizosphereVNWKLWVAVGALAGGAFWAARRRNNRVNADAERWAAATDPVARFGDV*
Ga0150984_10507512933300012469Avena Fatua RhizosphereGGAFWFVRRKSRRAAEDAELWSEATDPIARFGES*
Ga0157285_1035105923300012897SoilAKVDRVKWKVVLAVGAVAGGAFWYVRRKSRRTASEAELWAEATDPVTRFGES*
Ga0157301_1000509633300012911SoilKVVLAVGAVAGGAFWYVRRKSRRTASEAELWAEATDPVTRFGDS*
Ga0162651_10001296513300012938SoilGGRVKWKVVVAVGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS*
Ga0162651_10005713423300012938SoilVLAAGAVAGGALWFVRRRSRRAADEAELWAEATDPIARFGES*
Ga0157375_1061485523300013308Miscanthus RhizosphereVKWKLWLAVGALAGGVYWVARRRNRVNADAELWADATDPVARFGDS*
Ga0132258_1010290713300015371Arabidopsis RhizosphereVKWKVVLAIGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA*
Ga0132258_1046578223300015371Arabidopsis RhizosphereVKWKEVLAIGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA*
Ga0132258_1057652523300015371Arabidopsis RhizosphereLASAAINTAAKVDRVKWKVVFAVGAVAGGAFWYVRRKSRRTAAEAELWAEATDPVTRFGES*
Ga0132258_1221722813300015371Arabidopsis RhizosphereMVDRVRWKVVLAVGAVAGGALWYVRRKSRRTAADAEL
Ga0132256_10229987213300015372Arabidopsis RhizosphereIGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA*
Ga0132257_10245961213300015373Arabidopsis RhizosphereRVKWKVVLAIGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA*
Ga0132255_10243144933300015374Arabidopsis RhizosphereALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA*
Ga0132255_10542947513300015374Arabidopsis RhizosphereKVVLAIGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA*
Ga0163161_1005718433300017792Switchgrass RhizosphereVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAE
Ga0163161_1030070023300017792Switchgrass RhizosphereKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA
Ga0163161_1150964023300017792Switchgrass RhizosphereWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPIIRFGNA
Ga0190266_1014365533300017965SoilMVDVVKWKVALAVGALAGGALWFVRRKSRQAAEDAELWSEATDPVTRFGDT
Ga0190266_1094622513300017965SoilMVLAVGAVAGGALWFVRRKARRAAAEAELWEEATDPIARFGET
Ga0184605_1042441613300018027Groundwater SedimentVKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA
Ga0184634_1024981813300018031Groundwater SedimentMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWA
Ga0184619_1028273313300018061Groundwater SedimentVKWKVMLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA
Ga0184617_102341933300018066Groundwater SedimentVKWKVVLAVGAVAGGAFWFVRRKSRRAADEAELWAEATDPIARFGES
Ga0184624_1003202523300018073Groundwater SedimentMVERVKWKVVVAVGAVAGGALWFVRRKSRQAAADAELWAEATDPIARFGES
Ga0184609_1048936723300018076Groundwater SedimentMAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA
Ga0184639_1008811323300018082Groundwater SedimentVKWKVVLAVGAVAGGALWFVRRKSRRAADEAELWAEATDPIARFGES
Ga0184639_1051508223300018082Groundwater SedimentVDRVKWKVVVAVGAVAGGALWFVRRKSRQAAADAELWAEATDPIARFGES
Ga0190272_1115129723300018429SoilVKWKLWIAIGALTSGAFWIARRKNKINADAELWAEATDPVARFGDA
Ga0190275_1059295523300018432SoilVKWKLWVAVGALAGGAIWVARRKNKVNADAELWAEATDPVARFGDA
Ga0190268_1005421923300018466SoilMVDLVKWKMAVAVGALAGGALWFVRRKSRRAAEDAELWSEATDPVTRFGES
Ga0190268_1019008223300018466SoilMVDRVKWKVAIAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGDA
Ga0190268_1134533723300018466SoilMVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIARFGES
Ga0190270_1009309923300018469SoilVKWKVVVAVGAVAGGALWFVRRKSRQAAADAELWAEATDPIARFGES
Ga0190274_1194780023300018476SoilVKWKVWLAVGALAGGAYWVARRRNRVNADAELWAEATDPVARFGDA
Ga0190271_1074868223300018481SoilAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGDA
Ga0190271_1123853533300018481SoilVDRVKWKVAVAVGAIAGGALWFVRRKSRQAAADAELWAEATDPIARFGES
Ga0190271_1213281023300018481SoilVKWKLWLAVGALAGGAYWVARRRNRVNADAELWAEATDPVARFGEA
Ga0190271_1335570723300018481SoilVKWKLWVAVGALAGGAFWVARRKNKVNADAELWAEATDPVARFGDA
Ga0184642_155464423300019279Groundwater SedimentVAVGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS
Ga0190267_1077384323300019767SoilMVLAVGAVAGGALWFVRRKSRRAAAEAELWAEATDPIARFGET
Ga0190267_1093214923300019767SoilVKWKLWVAVGALAGGAVWVARRRNRVNDGAELWASATDPVTRFGDADDS
Ga0190267_1133283723300019767SoilAGGALWFVRRRSRRVADEAELWAEATDPIARFGES
Ga0193705_100461223300019869SoilMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA
Ga0193700_100670623300019873SoilVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA
Ga0193700_104388113300019873SoilMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAKA
Ga0210381_1021911513300021078Groundwater SedimentSVAKVGRVKWKVVLAVGAVAGGAFWYVRRKSRRAETDAELWAEATDPITRFGDA
Ga0222621_105079613300021510Groundwater SedimentWKVVLAVGAVAGGALWFVRRKSRRAADEAELWAEATDPIARFGES
Ga0222623_1020785213300022694Groundwater SedimentVKWKVVLAVGAVAGGAFWYVRRKSRRAETDAELWAEATDPITRFGDA
Ga0222623_1022200013300022694Groundwater SedimentAGGALWFVRRKSRRAADEAELWAEATDPIARFGES
Ga0222622_1021202813300022756Groundwater SedimentVVLAVGAVAGGAFWYVRRKSRRAETDAELWAEATDPITRFGDS
Ga0222622_1021678533300022756Groundwater SedimentMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA
Ga0222622_1037683913300022756Groundwater SedimentNHRTAMVDRVKWKVAVAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGDS
Ga0193714_106352613300023058SoilMAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA
Ga0207709_1040091633300025935Miscanthus RhizosphereVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPIIRFGNA
Ga0207709_1051483213300025935Miscanthus RhizosphereAVAGGAVWYVRRKSRRAEADAELWAEATDPIIRFGNA
Ga0207669_1014092623300025937Miscanthus RhizosphereVKWKLWLAVGALAGGAYWVARRRNRVNADAELWAEATDPVARFGDA
Ga0207712_1108701913300025961Switchgrass RhizosphereLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA
Ga0207712_1177247223300025961Switchgrass RhizosphereTNSVAKVGRVKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA
Ga0207981_104854713300027560SoilTVAKVGRVKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA
Ga0209814_1017625913300027873Populus RhizosphereAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA
Ga0207428_1000459733300027907Populus RhizosphereVKWKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIVRFGES
Ga0247820_1101008523300028597SoilVPADGYGGPVKWKLWLAVGALAGGAFWVARRRNNRVNADAELWAEATDPVARFGDA
Ga0247819_1033243833300028608SoilGRVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA
Ga0307291_100409713300028707SoilCRYGGRVKWKVVVAVGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS
Ga0307291_104947413300028707SoilWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA
Ga0307311_1022977513300028716SoilVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA
Ga0307307_1000207713300028718SoilVVVAVGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS
Ga0307301_1000588343300028719SoilAAPASPATPSIQAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA
Ga0307319_1002379623300028722SoilMALAVGAIAGGALWFVRRRSRRAEEDAELWAEATDPITRFGDT
Ga0307288_1003659533300028778SoilPTKSVAKVGRVKWKVVLAVGAVAGGAFWYVRRKSRRAETDAELWAEATDPITRFGDA
Ga0307289_1009639513300028875SoilVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA
Ga0307286_1036962623300028876SoilMAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWA
Ga0268240_1008967523300030496SoilMVDVVKWKVVLAVGALAGGALWFVRRKSRQAAEDAELWSEATDPVTRFGES
Ga0308206_107399413300030903SoilRVKWKVVVAVGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS
Ga0308200_113009313300030905SoilLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA
Ga0308196_107378213300030989SoilAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA
Ga0308192_107008813300031082SoilAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA
Ga0308201_1017062523300031091SoilRLGAVAGGALWFVRRKSRRAADEAELWAEATDPIARFGES
Ga0308204_1025114923300031092SoilRYCGRVKWKVVVAAGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS
Ga0308204_1025426523300031092SoilMALAVGAIAGGALWFVRRRSRRAEEDAELWAEATDSITRFGDT
Ga0308187_1007875623300031114SoilRVKWKMALAVGAIAGGALWFVRRRSRRAEEDAELWAEATDPITRFGDT
Ga0307499_1002737913300031184SoilTPSIQAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA
Ga0272427_101527763300031454RockMNWKVLLAVGAVAGGVVLAARHRSRRDDAEGAQWAEATDPVARFGDA
Ga0307405_1000113143300031731RhizosphereVKWKMALAVGAIAGGALWFVRRRSRRAEEDAELWAEATDPITRFGDT
Ga0307405_1014358223300031731RhizosphereVKWKVVLAVGAAAGGAYWYVWRKARRAESDAELWAEATDPIARFGDPDT
Ga0307468_10141163213300031740Hardwood Forest SoilDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA
Ga0307410_1000053153300031852RhizosphereVKWKVVLAVGAIAGGALWFVRRRSRRAEQDAELWAEATDPIARFGES
Ga0307406_1030688723300031901RhizosphereMVDVVKWKVALAVGALAGGAMWFVRRKSRRAAEDAELWSEATDPVTRFGES
Ga0307414_1001643183300032004RhizosphereWKVVLAVGAIAGGALWFVRRRSRRAEQDAELWAEATDPIARFGES
Ga0307415_10105483513300032126RhizosphereYGGRVKWKVVLAVGAIAGGALWFVRRRSRRAEQDAELWAEATDPIARFGES
Ga0314798_104014_95_2623300034673SoilVPADGYGGPVKWKLWLAVGALAGGAYWVARRRNRVNADAELWAEATDPVARFGEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.