Basic Information | |
---|---|
Family ID | F037329 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 168 |
Average Sequence Length | 43 residues |
Representative Sequence | IEKKAPLDVTPEQALRTMRALLLAHKSSREGRRVRWTEAPE |
Number of Associated Samples | 148 |
Number of Associated Scaffolds | 168 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.60 % |
% of genes near scaffold ends (potentially truncated) | 97.02 % |
% of genes from short scaffolds (< 2000 bps) | 88.69 % |
Associated GOLD sequencing projects | 140 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.143 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.476 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.595 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.548 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.99% β-sheet: 0.00% Coil/Unstructured: 71.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 168 Family Scaffolds |
---|---|---|
PF00155 | Aminotran_1_2 | 14.88 |
PF00025 | Arf | 6.55 |
PF13620 | CarboxypepD_reg | 2.98 |
PF00232 | Glyco_hydro_1 | 2.38 |
PF01040 | UbiA | 2.38 |
PF01431 | Peptidase_M13 | 1.79 |
PF05649 | Peptidase_M13_N | 1.79 |
PF13519 | VWA_2 | 1.19 |
PF00080 | Sod_Cu | 1.19 |
PF11949 | DUF3466 | 1.19 |
PF02308 | MgtC | 1.19 |
PF08734 | GYD | 1.19 |
PF13407 | Peripla_BP_4 | 1.19 |
PF00072 | Response_reg | 0.60 |
PF13561 | adh_short_C2 | 0.60 |
PF17164 | DUF5122 | 0.60 |
PF02472 | ExbD | 0.60 |
PF00578 | AhpC-TSA | 0.60 |
PF03544 | TonB_C | 0.60 |
PF01609 | DDE_Tnp_1 | 0.60 |
PF02547 | Queuosine_synth | 0.60 |
PF13517 | FG-GAP_3 | 0.60 |
PF03590 | AsnA | 0.60 |
PF07642 | BBP2 | 0.60 |
PF00593 | TonB_dep_Rec | 0.60 |
PF14534 | DUF4440 | 0.60 |
PF00694 | Aconitase_C | 0.60 |
PF00069 | Pkinase | 0.60 |
PF00933 | Glyco_hydro_3 | 0.60 |
PF08241 | Methyltransf_11 | 0.60 |
PF07883 | Cupin_2 | 0.60 |
PF00474 | SSF | 0.60 |
PF04185 | Phosphoesterase | 0.60 |
PF10518 | TAT_signal | 0.60 |
COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
---|---|---|---|
COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 6.55 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 3.57 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.38 |
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 2.38 |
COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 1.19 |
COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.19 |
COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 1.19 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.19 |
COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.60 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.60 |
COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.60 |
COG2502 | Asparagine synthetase A | Amino acid transport and metabolism [E] | 0.60 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.60 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.60 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.60 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.14 % |
Unclassified | root | N/A | 17.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459017|G14TP7Y01BFDTI | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300001471|JGI12712J15308_10216231 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300001546|JGI12659J15293_10010621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2581 | Open in IMG/M |
3300001661|JGI12053J15887_10441102 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100574511 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300004092|Ga0062389_103635851 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300005187|Ga0066675_10517505 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300005332|Ga0066388_103652621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
3300005435|Ga0070714_100654779 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300005435|Ga0070714_102305217 | Not Available | 524 | Open in IMG/M |
3300005533|Ga0070734_10144994 | Not Available | 1379 | Open in IMG/M |
3300005541|Ga0070733_10067590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2249 | Open in IMG/M |
3300005563|Ga0068855_101995482 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005602|Ga0070762_10054710 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
3300006175|Ga0070712_101273127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300006176|Ga0070765_100178952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1913 | Open in IMG/M |
3300007982|Ga0102924_1180633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
3300007982|Ga0102924_1387047 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300009089|Ga0099828_11164520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300009518|Ga0116128_1038311 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
3300009519|Ga0116108_1043336 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300009624|Ga0116105_1187529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300009628|Ga0116125_1016708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1823 | Open in IMG/M |
3300009635|Ga0116117_1102511 | Not Available | 717 | Open in IMG/M |
3300009672|Ga0116215_1335014 | Not Available | 656 | Open in IMG/M |
3300009683|Ga0116224_10489590 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300009839|Ga0116223_10751501 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300010343|Ga0074044_10210317 | Not Available | 1290 | Open in IMG/M |
3300010343|Ga0074044_10547149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 756 | Open in IMG/M |
3300010358|Ga0126370_11133727 | Not Available | 723 | Open in IMG/M |
3300010361|Ga0126378_10346059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1596 | Open in IMG/M |
3300010361|Ga0126378_11912559 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300010366|Ga0126379_11649369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Niveibacterium | 746 | Open in IMG/M |
3300010366|Ga0126379_12648160 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300010373|Ga0134128_11513400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
3300010376|Ga0126381_105165155 | Not Available | 500 | Open in IMG/M |
3300010379|Ga0136449_102578576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
3300011120|Ga0150983_11511038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
3300011120|Ga0150983_14853635 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300011269|Ga0137392_10273708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1392 | Open in IMG/M |
3300011269|Ga0137392_11339455 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300012202|Ga0137363_10138288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1901 | Open in IMG/M |
3300012203|Ga0137399_11587924 | Not Available | 542 | Open in IMG/M |
3300012212|Ga0150985_115551111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300012351|Ga0137386_10180944 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300012683|Ga0137398_10688361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300012955|Ga0164298_11414015 | Not Available | 539 | Open in IMG/M |
3300014200|Ga0181526_10345193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 947 | Open in IMG/M |
3300015265|Ga0182005_1096483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
3300016445|Ga0182038_11887209 | Not Available | 540 | Open in IMG/M |
3300017823|Ga0187818_10007854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4565 | Open in IMG/M |
3300017823|Ga0187818_10085254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1363 | Open in IMG/M |
3300017927|Ga0187824_10361226 | Not Available | 525 | Open in IMG/M |
3300017933|Ga0187801_10202381 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300017937|Ga0187809_10257248 | Not Available | 633 | Open in IMG/M |
3300017940|Ga0187853_10469540 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300017942|Ga0187808_10601199 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300017946|Ga0187879_10339335 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300017946|Ga0187879_10403146 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300017948|Ga0187847_10003709 | All Organisms → cellular organisms → Bacteria | 11504 | Open in IMG/M |
3300017948|Ga0187847_10265024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
3300017961|Ga0187778_10801823 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300017970|Ga0187783_11279276 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300017972|Ga0187781_11036403 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300017972|Ga0187781_11105764 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300017973|Ga0187780_10692285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300018006|Ga0187804_10271421 | Not Available | 735 | Open in IMG/M |
3300018007|Ga0187805_10127528 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300018021|Ga0187882_1076207 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
3300018023|Ga0187889_10106065 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300018047|Ga0187859_10423851 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300018085|Ga0187772_10177187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1423 | Open in IMG/M |
3300018085|Ga0187772_10313348 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300018085|Ga0187772_10459830 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300018086|Ga0187769_10681226 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300018088|Ga0187771_11175323 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300018088|Ga0187771_11349923 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300019887|Ga0193729_1035454 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
3300020579|Ga0210407_11193858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300020580|Ga0210403_11196857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300020582|Ga0210395_10036427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3607 | Open in IMG/M |
3300021170|Ga0210400_10999710 | Not Available | 680 | Open in IMG/M |
3300021180|Ga0210396_11144302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300021180|Ga0210396_11467417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300021181|Ga0210388_10676771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
3300021401|Ga0210393_10216666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1550 | Open in IMG/M |
3300021401|Ga0210393_11229566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300021403|Ga0210397_10658955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300021404|Ga0210389_10912303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
3300021405|Ga0210387_11775957 | Not Available | 520 | Open in IMG/M |
3300021445|Ga0182009_10256496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
3300021474|Ga0210390_11335654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300021475|Ga0210392_11388810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300021477|Ga0210398_10036670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4078 | Open in IMG/M |
3300021478|Ga0210402_11038443 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300021559|Ga0210409_10063062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3458 | Open in IMG/M |
3300021560|Ga0126371_10469166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1406 | Open in IMG/M |
3300022508|Ga0222728_1046890 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300022511|Ga0242651_1038610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300022513|Ga0242667_1000807 | Not Available | 1763 | Open in IMG/M |
3300022531|Ga0242660_1001970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2734 | Open in IMG/M |
3300022531|Ga0242660_1165940 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300022717|Ga0242661_1036329 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300022732|Ga0224569_116824 | Not Available | 511 | Open in IMG/M |
3300023056|Ga0233357_1057142 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300024225|Ga0224572_1043020 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300025432|Ga0208821_1055746 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300025509|Ga0208848_1021572 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300025921|Ga0207652_10172583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1941 | Open in IMG/M |
3300025929|Ga0207664_10485424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
3300025929|Ga0207664_10553980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
3300025949|Ga0207667_11032330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
3300027014|Ga0207815_1044920 | Not Available | 532 | Open in IMG/M |
3300027604|Ga0208324_1001414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9352 | Open in IMG/M |
3300027605|Ga0209329_1106452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300027619|Ga0209330_1116190 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300027783|Ga0209448_10162889 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300027842|Ga0209580_10659710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300027855|Ga0209693_10411757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300027879|Ga0209169_10706481 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300027884|Ga0209275_10009840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4067 | Open in IMG/M |
3300027884|Ga0209275_10706913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300027889|Ga0209380_10306344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 933 | Open in IMG/M |
3300027898|Ga0209067_10974546 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300027908|Ga0209006_11418217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300027911|Ga0209698_10290325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1297 | Open in IMG/M |
3300028047|Ga0209526_10027422 | All Organisms → cellular organisms → Bacteria | 3997 | Open in IMG/M |
3300028776|Ga0302303_10085549 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300028871|Ga0302230_10320773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 600 | Open in IMG/M |
3300028906|Ga0308309_11306907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300029883|Ga0311327_10434979 | Not Available | 817 | Open in IMG/M |
3300029914|Ga0311359_10078397 | All Organisms → cellular organisms → Bacteria | 3305 | Open in IMG/M |
3300029943|Ga0311340_10513856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
3300029951|Ga0311371_11517474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
3300030044|Ga0302281_10064249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1804 | Open in IMG/M |
3300030057|Ga0302176_10072173 | Not Available | 1335 | Open in IMG/M |
3300030399|Ga0311353_10177148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2018 | Open in IMG/M |
3300030617|Ga0311356_10480132 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300030618|Ga0311354_10179457 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
3300030659|Ga0316363_10426576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300030688|Ga0311345_10067310 | All Organisms → cellular organisms → Bacteria | 4332 | Open in IMG/M |
3300030741|Ga0265459_10897404 | Not Available | 907 | Open in IMG/M |
3300030743|Ga0265461_13490246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300030813|Ga0265750_1052577 | Not Available | 620 | Open in IMG/M |
3300030879|Ga0265765_1004303 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
3300030940|Ga0265740_1005597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
3300031231|Ga0170824_102707241 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300031234|Ga0302325_10599610 | Not Available | 1623 | Open in IMG/M |
3300031236|Ga0302324_103264184 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300031239|Ga0265328_10378136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300031249|Ga0265339_10331476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300031708|Ga0310686_105568654 | Not Available | 709 | Open in IMG/M |
3300031718|Ga0307474_10478824 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300031753|Ga0307477_10532004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 797 | Open in IMG/M |
3300031753|Ga0307477_10560157 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300031823|Ga0307478_11058665 | Not Available | 677 | Open in IMG/M |
3300031890|Ga0306925_10757711 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300031910|Ga0306923_12057939 | Not Available | 577 | Open in IMG/M |
3300031962|Ga0307479_11630745 | Not Available | 600 | Open in IMG/M |
3300032180|Ga0307471_101552175 | Not Available | 819 | Open in IMG/M |
3300032515|Ga0348332_14201775 | Not Available | 1323 | Open in IMG/M |
3300032783|Ga0335079_10678108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
3300032805|Ga0335078_12705722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300032892|Ga0335081_10056083 | All Organisms → cellular organisms → Bacteria | 6138 | Open in IMG/M |
3300032898|Ga0335072_11605466 | Not Available | 548 | Open in IMG/M |
3300032955|Ga0335076_10010288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9428 | Open in IMG/M |
3300033158|Ga0335077_11214598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300033804|Ga0314863_076634 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.48% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.55% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.95% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.95% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.76% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.76% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.17% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.57% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.57% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.38% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.79% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.79% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.19% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.19% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.19% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.19% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.19% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.19% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.19% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.60% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.60% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.60% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.60% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.60% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.60% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4ZMR_01242990 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MPSVRDAIEKRAVLDVTPDQALRTMRALLLAHKSSREGRRVRWTEAPE |
JGI12712J15308_102162312 | 3300001471 | Forest Soil | EVTPEQALRTMRGVLLAHKSSREGRRVRWNEAVE* |
JGI12659J15293_100106211 | 3300001546 | Forest Soil | ANVRDAIEKKVPLDVPPEQFLRTQRALVLAHKSSNENRVVNWDEPAE* |
JGI12053J15887_104411022 | 3300001661 | Forest Soil | YANVRAAIEKGTPLDVTPEQALRTMRGILLARKSSQEQRTVRWEEAAE* |
JGIcombinedJ26739_1005745112 | 3300002245 | Forest Soil | DAIEKGTPLDVTMEQALRTMRALLLARKSSREERTVRWEEEPE* |
Ga0062389_1036358511 | 3300004092 | Bog Forest Soil | RDAIEKGVPLEVTPQQSLQVMRALLLAHKSSREKRTVGWNEAP* |
Ga0066675_105175051 | 3300005187 | Soil | AIENGAPLDVPPEQALRTERALLLAHKSSREKRVVQWNEAVS* |
Ga0066388_1036526211 | 3300005332 | Tropical Forest Soil | DAVEKKAPLDVPPEQFLRTQRALVLAHKSSREKRVVEWTEVAE* |
Ga0070714_1006547792 | 3300005435 | Agricultural Soil | NVRDAMEGTAPLDVPPDQFLRTQRALLLSHKSSREQRVVNWNEPVE* |
Ga0070714_1023052171 | 3300005435 | Agricultural Soil | EKGAPLDVPPEQFLRTQRALVLAHKSSREKRVVQWSEKAE* |
Ga0070734_101449941 | 3300005533 | Surface Soil | IEKDAPLEVPPEQFLRTQRALLLAHRSSREKRVVRWDEAPE* |
Ga0070733_100675903 | 3300005541 | Surface Soil | NVRDAIQKKAPLDVTPEQALRTMRALLLAHKSSREGRVVRWSEAVE* |
Ga0068855_1019954821 | 3300005563 | Corn Rhizosphere | TERGDYRGFYVNMRAAIENGAPLEVPSDQILRTERALLLAHKSSKERRVVDWNEAVG* |
Ga0070762_100547103 | 3300005602 | Soil | AIEKGVPLEVTPQQSLQAMRAVLLAYKSSREKRTVRWDEAVE* |
Ga0070712_1012731271 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LEVPPDQFLRTQRALILAHKSSREKRVVTWNEAPE* |
Ga0070765_1001789523 | 3300006176 | Soil | EVTPQQSLQAMRAVLLAHKSSREKRTVRWDEAVE* |
Ga0102924_11806331 | 3300007982 | Iron-Sulfur Acid Spring | DVTPEQALRTMRGVLLAHTSSREGRRVRWTEAAE* |
Ga0102924_13870472 | 3300007982 | Iron-Sulfur Acid Spring | IEKGSPLDVTPEQALRTMRALVLAHKSSREGRRVRWEEVAE* |
Ga0099828_111645203 | 3300009089 | Vadose Zone Soil | VRDAIEKRAPLEVTPEQALRTMRAVMLAHKSSKERRTVGWEEAVE* |
Ga0116128_10383112 | 3300009518 | Peatland | VRDSIEKKATLEVTPEQALRTMRAVTLAHESSHEYRRVERGETAE* |
Ga0116108_10433362 | 3300009519 | Peatland | VRDSIEKKATLEVTPEQALRTMRAVTVAHESSHEYRRVERGETAE* |
Ga0116105_11875292 | 3300009624 | Peatland | IEKGSALDVTPEQALRTERALLLAHKSSREGRRVLWTEAPE* |
Ga0116125_10167081 | 3300009628 | Peatland | VRDAIEKGVPLEVTPQQSLQAMRAVLLAHKSSREKRTVRWDEAVA* |
Ga0116117_11025111 | 3300009635 | Peatland | VALEVTPEQALRTMRAVILAHKSSREKRTVAWGEAAE* |
Ga0116215_13350141 | 3300009672 | Peatlands Soil | NVRDAIEKGSPLDVTPEQALRTMRALLLAHKSSRERRTAQWTEAPE* |
Ga0116224_104895901 | 3300009683 | Peatlands Soil | IEKGSPLDVTPEHALRTMRALLLAHKSSRERRTAQWTEAPE* |
Ga0116223_107515012 | 3300009839 | Peatlands Soil | FYANVRDAIEKRVPLEVTPEQALRTMRAVILAHKSSRERRTVEWGEAVE* |
Ga0074044_102103171 | 3300010343 | Bog Forest Soil | YANVRDAIEEKSPLAVTSEQALRTMRAVLLSHKSSRERRTVSWDEAVE* |
Ga0074044_105471492 | 3300010343 | Bog Forest Soil | DAIEKKAALDVTPEQALRTMRAVMLAHKSSRERRTVEWGEAVE* |
Ga0126370_111337271 | 3300010358 | Tropical Forest Soil | YRGFYVNMRAAIEEGVPLEVPPDQFLSTQRGLLLAHKSSRERRVVGWNEAVE* |
Ga0126378_103460592 | 3300010361 | Tropical Forest Soil | YANVRDAIAKKAPLDVPPEQFLRTMRALVLAHKSSRERRVVAWDEAVS* |
Ga0126378_119125593 | 3300010361 | Tropical Forest Soil | YANVRDAIEKGARLDVSPEHALRVMRALLLAHKSSREGCTVGWNETVK* |
Ga0126379_116493691 | 3300010366 | Tropical Forest Soil | KKAPLDVPSEQFLRTQRAIVLAHKSSREKRVVKWNENPE* |
Ga0126379_126481601 | 3300010366 | Tropical Forest Soil | RGFYVNMRDAIERKTPLEVPPEQFLRTERALLLAHKSSREGRVLNWNEAPE* |
Ga0134128_115134002 | 3300010373 | Terrestrial Soil | RAAIENGAPLEVPSDQILRTERALLLAHKSSKERRVVDWNEAVG* |
Ga0126381_1051651551 | 3300010376 | Tropical Forest Soil | MRDAIERKAPLEVPPEQFLRTERGLLLAHKSSREGRVLNWNEAPE* |
Ga0136449_1025785761 | 3300010379 | Peatlands Soil | APLDVTPEQALRTMRAVVLAHKSSRERRTVEWGEAAE* |
Ga0150983_115110382 | 3300011120 | Forest Soil | PLDVTPEQALRTMRAVMLAHKSSKERRTVEWEEAVK* |
Ga0150983_148536351 | 3300011120 | Forest Soil | RGFYVNMRDAIEKKAPLDVPPEQFLRTQRGLLLSHKSSREKRVVNWNEPLE* |
Ga0137392_102737081 | 3300011269 | Vadose Zone Soil | NVRDAIEKGAPLDVTPDQALRTMRAVLLARKSSQEERTVRWEEAPE* |
Ga0137392_113394552 | 3300011269 | Vadose Zone Soil | RGFYANVRDAIEKEAALEVTPEQALRTMRAVLLAHKSSRGKRTVEWGEEAE* |
Ga0137363_101382883 | 3300012202 | Vadose Zone Soil | EVTPEQALRTMRAVMLAHKSSKELRTVEWGEAVE* |
Ga0137399_115879241 | 3300012203 | Vadose Zone Soil | AIEKGVALDVTPEQALRTMRALVLAHKSSAEGRRVGWGETPE* |
Ga0150985_1155511112 | 3300012212 | Avena Fatua Rhizosphere | AMEKKAALDVPPEQFLRTQRALLLSHKSSRERRVVDWNEKVE* |
Ga0137386_101809441 | 3300012351 | Vadose Zone Soil | IKKKAELDVTPDQALRTMRALLLAHKSSREGRRVRWTEAPE* |
Ga0137398_106883612 | 3300012683 | Vadose Zone Soil | KKTPLEVTPEQALRTMRAVMLAHKSSRDKRTVEWGEAVE* |
Ga0164298_114140151 | 3300012955 | Soil | GAPLEVPPEQFLRTQRALILAHKSSREKRVVRWDEKPE* |
Ga0181526_103451931 | 3300014200 | Bog | KKAALDVTPEQALRTMRAVVLAHKSSREQRTVQWGEAVE* |
Ga0182005_10964831 | 3300015265 | Rhizosphere | PLEVPSDQILRTERALLLAHKSSGEKRVVDWNEAVE* |
Ga0182038_118872092 | 3300016445 | Soil | GFYVNMRAAIEEGVPLEVPPGQFLSTQRGLLLAHKSSRERRIVGWNEAVE |
Ga0187818_100078546 | 3300017823 | Freshwater Sediment | YANVRDAMEKGVVLDVPPEAALRAMRALLLAHKSSREGRTVRWNEEPE |
Ga0187818_100852541 | 3300017823 | Freshwater Sediment | YANVRDAIEKKAPLDVTPEQFMRTQRALILAHKSSREKRVVQWNEPAE |
Ga0187824_103612261 | 3300017927 | Freshwater Sediment | KGAELDVTPQQALRAMRALLLAHKSSRERRTLRWEEAIN |
Ga0187801_102023811 | 3300017933 | Freshwater Sediment | AIEKKAALEVTPEQALRTMRAVVLAHKSSRKRRTVDWAEAPQ |
Ga0187809_102572481 | 3300017937 | Freshwater Sediment | RGFYVNFRDAVEKGAPLEVPPEQFLRTQRALILAHKSSREKRVVRWEELAE |
Ga0187853_104695401 | 3300017940 | Peatland | AIEKKAPLDVTPEQALRTMRAVILAHKSSRERRTVEWGEPAE |
Ga0187808_106011991 | 3300017942 | Freshwater Sediment | NVRDAIENKAPLDVPPEQALRTMRALLLAHKSSREGRVVAWDETVE |
Ga0187879_103393351 | 3300017946 | Peatland | FYANVRDAIEKKAPLDVTPEQALRTMRAIILAHKSSRERRTVDWGETAE |
Ga0187879_104031462 | 3300017946 | Peatland | EKKAPLDVTPEQALRTMRAIILAHKSSRERRTVEWGEAAE |
Ga0187847_100037091 | 3300017948 | Peatland | VRDAIEKKAALDVTPEQALRTMRAVVLAHKSSRERRTVEWGDAAE |
Ga0187847_102650241 | 3300017948 | Peatland | VRDAIEKKAALDVTPEQALRTMRAVVLAHKSSRERRTVEWAEAAE |
Ga0187778_108018231 | 3300017961 | Tropical Peatland | GFYANVRDAMEKQALLDVTPEQALRTMRALLLSHKSSREGRKVHWTETVE |
Ga0187783_112792761 | 3300017970 | Tropical Peatland | KAPLDVTPGQFLRSTRALVLAHKSSRERRVVGWDEAAD |
Ga0187781_110364032 | 3300017972 | Tropical Peatland | SALDVTPDQALRTMRALLLAHKSSREGRTVKWSEAPE |
Ga0187781_111057641 | 3300017972 | Tropical Peatland | EKRASLDVAPEQALRVMRALLLAHKSSREGRTVRWTEVPE |
Ga0187780_106922851 | 3300017973 | Tropical Peatland | RDAIEKNAKLDVTPEQALRTMRALLLAHKSSRESRVVRWTDAPE |
Ga0187804_102714211 | 3300018006 | Freshwater Sediment | KKAALEVTPEQALRTMRAVVLAHKSSRERRTVDWADAHQ |
Ga0187805_101275282 | 3300018007 | Freshwater Sediment | DVIEKGASPDVTPKQFLGTMRAIVLAHKSSRERRVVQWSEPAE |
Ga0187882_10762072 | 3300018021 | Peatland | MEKKAPLEVTPEQALRTMRAIVLAHKRSRERRTVEWGETPE |
Ga0187889_101060651 | 3300018023 | Peatland | VALDVTPEAALRAMRALLLAHKSSREERTVRWDEEPE |
Ga0187859_104238512 | 3300018047 | Peatland | GLEVTPEQALQVMRALTLAHKSSREGRRVRWTESPE |
Ga0187772_101771871 | 3300018085 | Tropical Peatland | LDVPPQQFMRTQRALILAHKSSRENRVVRWDEPAE |
Ga0187772_103133482 | 3300018085 | Tropical Peatland | YRGFYANARDAIEKGSPLEVPPEQALRTMRALLLAHKSSLETRVVKWTEAVE |
Ga0187772_104598301 | 3300018085 | Tropical Peatland | IEKHWPLAVTPEQALRTMRAVILAHKSSRERRTVRWDEKAE |
Ga0187769_106812262 | 3300018086 | Tropical Peatland | FYANVRDAIEKRTTPDVSPGDILSVIRALLLAHKSSREGRTVRWTEAVE |
Ga0187771_111753231 | 3300018088 | Tropical Peatland | IEKRAPLDVTPEHALRVMRALLLAHKSSREGQTVRWTDAVE |
Ga0187771_113499231 | 3300018088 | Tropical Peatland | KRAPLDVTPEHALRVMRALLLAHKSSREGRTVRWNEAVE |
Ga0193729_10354542 | 3300019887 | Soil | LDVTPEQALRTLRAIVLAHKSSAEGRRVGWGETPE |
Ga0210407_111938581 | 3300020579 | Soil | PLDVTPDQALRTMRGILLAHKSSREGRRVRWAEAPE |
Ga0210403_111968571 | 3300020580 | Soil | VLDAIEKGVPLEVTPQQSLQAMRAVLLAHKSSREKRTVRWDEAVE |
Ga0210395_100364271 | 3300020582 | Soil | VRDAIEKKAALDVTPEEALRTMRAVMLAHKSSRERRTVEWGEAVE |
Ga0210400_109997101 | 3300021170 | Soil | NMRDAIEKKAPLSITPEQALRTMRAVVLAHKSSRERRTVGWSEALDL |
Ga0210396_111443022 | 3300021180 | Soil | DAIEKKAPLDVPPEQFLRTQRGLLLSHKSSREKRVVNWNEPLE |
Ga0210396_114674171 | 3300021180 | Soil | LEVTPEQALRTMRAVVLAHKSSRKKRTVQWDEPAE |
Ga0210388_106767712 | 3300021181 | Soil | AIEKGVPLEVTPQQSLQAMRAVLLAHKSSREKRTVRWDEAVE |
Ga0210393_102166662 | 3300021401 | Soil | RDAVEGKAALDVTPEQALRTMRALMLAHKSSQERRTVEWGEATE |
Ga0210393_112295661 | 3300021401 | Soil | AALEVTPEQTLRTMGAVMLAHKSSRERRTVAWEEAVE |
Ga0210397_106589552 | 3300021403 | Soil | EKGTPLDVPPQQFMRTQRALLLAHKSSQEGRKVRWAESPE |
Ga0210389_109123032 | 3300021404 | Soil | PLDVPPEQFLRTQRALVLAHKSSNENRVVNWDEPAE |
Ga0210387_117759572 | 3300021405 | Soil | AIEKKAALDVTPEQALRTMRAVMLAHKSSRERRTVEWGEAVD |
Ga0182009_102564961 | 3300021445 | Soil | AAIEDGAPLEVPSDQILRTERALLLAHKSSGEKRVVDWNEAVE |
Ga0210390_113356542 | 3300021474 | Soil | DAIEKGSPLDVTPEQALRTERAVLLAHKSSREGRRVLWTEAPE |
Ga0210392_113888101 | 3300021475 | Soil | NVRDAIEQKSPLDVTPEQALRTMRAVLLAHKSSREGRTVNWTEAPE |
Ga0210398_100366701 | 3300021477 | Soil | AIEKKAALDVTPEQALRTMRAVMLAHKSSRERRTVEWGEAVE |
Ga0210402_110384431 | 3300021478 | Soil | YANVRDAIEKKAPLDVTPEQFMRTMRALVLAHKSSREKRVVRWSEAPE |
Ga0210409_100630624 | 3300021559 | Soil | RGFYVNMRDAIEKKAPLDVPPEQFLRTQRGLLLSHKSSREKRVVNWNEPLE |
Ga0126371_104691663 | 3300021560 | Tropical Forest Soil | YVNFRDAVEKKAPLDVPSEQFLRTQRAIVLAHKSSREKRVVKWNENPE |
Ga0222728_10468901 | 3300022508 | Soil | PLDVTPEQALRTMRALLLAHKSSREGRTVRWTEAPE |
Ga0242651_10386102 | 3300022511 | Soil | MRDAIEKKAPLEVTPEQALRTMRAVMLAHKSSKERRTVGWKEEAE |
Ga0242667_10008071 | 3300022513 | Soil | ALDVTPEQALRTMRAVILAHKSSGERRTVAWDEAAE |
Ga0242660_10019701 | 3300022531 | Soil | AIEKKAPLDVPPEQFLRTQRGLLLSHKSSREKRVVNWNEPLE |
Ga0242660_11659401 | 3300022531 | Soil | AIEKGSPLEVTLEQSMRTMRGLMLAHKSSRERRTVAWDEAVV |
Ga0242661_10363291 | 3300022717 | Soil | YANVRDAIEKRAPLDVTPQQALRTMRALLLARKSSREGRVVRWTEAVE |
Ga0224569_1168241 | 3300022732 | Rhizosphere | IEKKATLDVTPEQALRTMRAIMLAHKSSRERRTVEWGEAVE |
Ga0233357_10571421 | 3300023056 | Soil | GFYANVRDAVEKGAPLDVTPEQALRTMRGVLLAHKSSREGRRVRWTEAV |
Ga0224572_10430201 | 3300024225 | Rhizosphere | AELDVTPQQALRTMRAVMLAHKSSRERRTVEWGEAAE |
Ga0208821_10557462 | 3300025432 | Peatland | YLNVRDSIEKKATLEVTPEQALRTMRAVTVAHESSHEYRRVERGETAE |
Ga0208848_10215722 | 3300025509 | Arctic Peat Soil | KAPLDVTPEQALRTMRALLLAHKSSREGRRVRWTDAPE |
Ga0207652_101725834 | 3300025921 | Corn Rhizosphere | IENGAPLDVPPEQALRTERALLLAHKSSREKRVVQWNEVVS |
Ga0207664_104854241 | 3300025929 | Agricultural Soil | NVRHAIEKKTPLEVTPEQALRTMRAVMLAHKSSREKRTVEWGESVE |
Ga0207664_105539802 | 3300025929 | Agricultural Soil | REIDGLVRDAMEGTAPLDVPPDQFLRTQRALLLSHKSSREQRVVNWNEPVE |
Ga0207667_110323303 | 3300025949 | Corn Rhizosphere | IESAAPLDVPPEQALRTQRALLLAHKSSREKRVVQWNEAVS |
Ga0207815_10449202 | 3300027014 | Tropical Forest Soil | GFYVNMRDAIEGKAPLEVPPEQFLRTQRGLLIAHKSSREGRVVSWNESVE |
Ga0208324_100141412 | 3300027604 | Peatlands Soil | ALDVTPEQAVRTMRALLLAHRSSREGRVVKWTEAPE |
Ga0209329_11064522 | 3300027605 | Forest Soil | KAELAVTPEQALRAMRAIVLAHKSSKERRTVGWNEAAE |
Ga0209330_11161902 | 3300027619 | Forest Soil | VRDAIEKKAALDVTPEQALRTMRAVMLAHKSSRERRTVEWGEAVD |
Ga0209448_101628892 | 3300027783 | Bog Forest Soil | SLDVTPEQALRTMRGVLLAHKSSREGRRVQWTEAPE |
Ga0209580_106597101 | 3300027842 | Surface Soil | KKAPLDVTPEQALRTMRGLLLAHKSSREGRRVRWTEEVE |
Ga0209693_104117572 | 3300027855 | Soil | NVRDAIEKKAPLDVTPEQALRTMRALLLAHKSSREGRRVLWTEAPE |
Ga0209169_107064811 | 3300027879 | Soil | KVALDVTPEQALRTMRAVILAHKSSREKRTVEWGEPAE |
Ga0209275_100098401 | 3300027884 | Soil | ALDVTPEQALRTMRAVMLAHKSSRERRTVEWGEAVE |
Ga0209275_107069132 | 3300027884 | Soil | RDAIEKGVPLEVTPQQSLQAMRAVLLAHKSSREKRTVRWDEAVA |
Ga0209380_103063442 | 3300027889 | Soil | TALEVRPQQVPRTMRAIMLAHKSSRERRTVEWEEAAE |
Ga0209067_109745461 | 3300027898 | Watersheds | LDVTPEQALRTMRALLLAHKSNREGRVVRWSEAVE |
Ga0209006_114182171 | 3300027908 | Forest Soil | GFYANVRDAIEKKAPLEVTPQQALRTMRAIRLGHKSSRERRTVGWEEAVD |
Ga0209698_102903252 | 3300027911 | Watersheds | LDVTPEQALRTMRAILLAHKSSREGRVVGWTEAVE |
Ga0209526_100274221 | 3300028047 | Forest Soil | FYANIRDAIEKGVTLDVTPEQALRTMRAIVLAHKSSDEGRRVGWGERPE |
Ga0302303_100855491 | 3300028776 | Palsa | RDAIEKKAPLEVTPQQALRTMRAVMLGHKSSRERRTVGWEEAVD |
Ga0302230_103207732 | 3300028871 | Palsa | APLEVTPEQALRTMRAVILAHKSSREQRTVKWSEAVQ |
Ga0308309_113069072 | 3300028906 | Soil | EKGTPLDVPPEQALRTMRALLLAHKSSREERKVRWTEAVE |
Ga0311327_104349792 | 3300029883 | Bog | GFYANVRDAIEKKAALEVTPEQALRTMRAVILAHKSSREKRAVEWGETAE |
Ga0311359_100783973 | 3300029914 | Bog | FYANVRDAIEKNTPLEVTPEQALRTMRAVMLAHKSSKERRTVAWEEPPE |
Ga0311340_105138561 | 3300029943 | Palsa | NVRDAIEKGVPLEVTPQQSLNAMRAVLLAHKSSREKRTVRWDEAVE |
Ga0311371_115174742 | 3300029951 | Palsa | DAIEKGVPLEVTPQQSLNAMRAVLLAHKSSREKRTVRWDEAVE |
Ga0302281_100642491 | 3300030044 | Fen | YANLRDAIEKKAALEVTPEQALRTMRAVILAHKSSREKRAVEWGETAE |
Ga0302176_100721731 | 3300030057 | Palsa | IEKKAPLEVTPQQALRTMRAVMLGHKSSRERRTVGWEEVVE |
Ga0311353_101771483 | 3300030399 | Palsa | EKKAPLDVTPEQALRTMRAVMLAHKSSRERRTVEWGEPAE |
Ga0311356_104801322 | 3300030617 | Palsa | RDAIEKKAPLEVTPQQALRTMRAVMLGHKSSRERRTVGWEEVVE |
Ga0311354_101794572 | 3300030618 | Palsa | PLEVMPQQALRTMRAVMLAHKSSRERRTVAWEESVD |
Ga0316363_104265762 | 3300030659 | Peatlands Soil | RDAMEKKAPLDVTPEQALRTMRAVVLAHKSSRERRTVEWGEAAE |
Ga0311345_100673103 | 3300030688 | Bog | FYANVRDAIEKNTPLEVTPEQALRTMRAVMLAHKSSKERRTVGWEEPPE |
Ga0265459_108974041 | 3300030741 | Soil | AIEKKAALNVTPEQALRTMRAVMLAHKSSRERRTVEWSEAVQ |
Ga0265461_134902462 | 3300030743 | Soil | LFVSPCYYANVRDAIEKGSPLDVTPEQALRTERALLLAHKSSREARRVLWTEAPE |
Ga0265750_10525771 | 3300030813 | Soil | KKAALDVTPEQALRTMRAVMLAHKSSRERRTVEWGEAVE |
Ga0265765_10043032 | 3300030879 | Soil | VRDAIEKKAPLEVTPEQALRTMRAVMLAHKSSREKRTVQWDEAAD |
Ga0265740_10055972 | 3300030940 | Soil | VRDAIEKGVPLEVTPQQSLQAMRAVLLAHKSSREKRTVRWDEAVA |
Ga0170824_1027072412 | 3300031231 | Forest Soil | EKRAPLDVTPEQALRTMRALLLAHKSSREGRVVRWSETPV |
Ga0302325_105996101 | 3300031234 | Palsa | GAALEVTPEQALRTMRALLLARKSSRERRTVGWEEAVE |
Ga0302324_1032641842 | 3300031236 | Palsa | QKKTPLEVTPDQALRTMRALMLAYKSSRQRRTVLWEEAVD |
Ga0265328_103781362 | 3300031239 | Rhizosphere | IEKKAPLDVTPEQALRTMRALLLAHKSSREGRRVRWTEAPE |
Ga0265339_103314761 | 3300031249 | Rhizosphere | KKAPLDVTPEQALRTMRALLLAHKSSREGRRVRWTEAPE |
Ga0310686_1055686542 | 3300031708 | Soil | ANVRDALEKKAALEVTPEQALRTMRAVMLAHKSSRERRTVDWQEAAE |
Ga0307474_104788243 | 3300031718 | Hardwood Forest Soil | AIAKKAPLDVTPEQALRTMRAVLLAHKSSREKRTVEWGETVD |
Ga0307477_105320042 | 3300031753 | Hardwood Forest Soil | IEKKAALDVTPKQALRTMRAIMLAHKSSRERRTVEWDEPAE |
Ga0307477_105601572 | 3300031753 | Hardwood Forest Soil | VRDAIEKRAPLDVTPQQALRTMRALLLARKSSREGRVVRWTEAVE |
Ga0307478_110586651 | 3300031823 | Hardwood Forest Soil | YANVRDAIEKKIPLEVTPEQALRTMRAVMLAHKSSRERRTVEWGEEVE |
Ga0306925_107577111 | 3300031890 | Soil | FYTNVCNAMEKGAALDVTPEAALRAMKALLLSHKSSREGRTVRWSEMPE |
Ga0306923_120579392 | 3300031910 | Soil | GDYRGFYVNMRAAIEEGVPLEVPPDQFLSTQRGLLLAHKSSRERRVVGWNEAVE |
Ga0307479_116307451 | 3300031962 | Hardwood Forest Soil | NIRDAIEKGVALDVTPEQALRTLRAIVLAHKSSAEGRRVGWGETPE |
Ga0307471_1015521752 | 3300032180 | Hardwood Forest Soil | PLEVTPEQALRTMRAVMLAHKSSRERRTVEWGEEVE |
Ga0348332_142017753 | 3300032515 | Plant Litter | GDAIEKKAALDVTPEQALRTMRAVMLAHKSSRERRTVEWGESVE |
Ga0335079_106781081 | 3300032783 | Soil | NMRDAIEGKAPLDVPPEQFLRTQRGLLLSQKSSHEKRVVSWNEPPE |
Ga0335078_127057222 | 3300032805 | Soil | RGFYANVRDAIEKKAPLDVTPEQFLRTQRALLLAHKSSKEKRVVKWDEKLD |
Ga0335081_100560836 | 3300032892 | Soil | APLEVPPEQALRTMRALLLAHKSSREARKVRWTESVE |
Ga0335072_116054661 | 3300032898 | Soil | DAIEGEAPLDVTSEQFLRTQRALLLAHKSSRERRAVNWGEPLE |
Ga0335076_100102881 | 3300032955 | Soil | MEKGAPLAVTPEQALRTMRALLLSHKSSSERRTVNWNEKID |
Ga0335077_112145981 | 3300033158 | Soil | YANVRDAIEKKAPLDVTPEQFLRTQRALLLAHKSSKEKRVVKWDEKLD |
Ga0314863_076634_1_117 | 3300033804 | Peatland | WAALDVSPEHALRVMRALLLAHKSSRESRTVRWDEAVE |
⦗Top⦘ |