Basic Information | |
---|---|
Family ID | F038205 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 166 |
Average Sequence Length | 43 residues |
Representative Sequence | MGNILEIIAVACDECGGAGFLFWGDENNYDVESCDCALESWGI |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 166 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 79.52 % |
% of genes near scaffold ends (potentially truncated) | 22.29 % |
% of genes from short scaffolds (< 2000 bps) | 66.87 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (46.386 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (14.458 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.964 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.036 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.86% β-sheet: 19.72% Coil/Unstructured: 70.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 166 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 6.63 |
PF13640 | 2OG-FeII_Oxy_3 | 1.20 |
PF00067 | p450 | 0.60 |
PF01464 | SLT | 0.60 |
PF06628 | Catalase-rel | 0.60 |
PF01755 | Glyco_transf_25 | 0.60 |
PF00041 | fn3 | 0.60 |
PF02467 | Whib | 0.60 |
PF13385 | Laminin_G_3 | 0.60 |
PF09834 | DUF2061 | 0.60 |
PF00565 | SNase | 0.60 |
PF03567 | Sulfotransfer_2 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
---|---|---|---|
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.60 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.60 |
COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.61 % |
Unclassified | root | N/A | 46.39 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001250|B570J13876_101502 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
3300001274|B570J13895_1009168 | Not Available | 1083 | Open in IMG/M |
3300002835|B570J40625_100001627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 41265 | Open in IMG/M |
3300002835|B570J40625_100153183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2625 | Open in IMG/M |
3300002835|B570J40625_100392701 | All Organisms → Viruses → Predicted Viral | 1352 | Open in IMG/M |
3300002835|B570J40625_100428977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1272 | Open in IMG/M |
3300003388|JGI25910J50241_10013375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2928 | Open in IMG/M |
3300003430|JGI25921J50272_10012795 | All Organisms → Viruses → Predicted Viral | 2417 | Open in IMG/M |
3300003430|JGI25921J50272_10047999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 980 | Open in IMG/M |
3300004124|Ga0066178_10195535 | Not Available | 579 | Open in IMG/M |
3300004240|Ga0007787_10234948 | Not Available | 898 | Open in IMG/M |
3300005517|Ga0070374_10487229 | Not Available | 616 | Open in IMG/M |
3300005525|Ga0068877_10064323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2375 | Open in IMG/M |
3300005527|Ga0068876_10249446 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
3300005527|Ga0068876_10366766 | Not Available | 807 | Open in IMG/M |
3300005580|Ga0049083_10191290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300005581|Ga0049081_10328007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300005662|Ga0078894_10318421 | Not Available | 1410 | Open in IMG/M |
3300005662|Ga0078894_10576203 | Not Available | 1004 | Open in IMG/M |
3300005662|Ga0078894_10766930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
3300005662|Ga0078894_11422596 | Not Available | 578 | Open in IMG/M |
3300005662|Ga0078894_11620063 | Not Available | 533 | Open in IMG/M |
3300005662|Ga0078894_11728218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300005941|Ga0070743_10012584 | Not Available | 2976 | Open in IMG/M |
3300006030|Ga0075470_10042021 | Not Available | 1408 | Open in IMG/M |
3300006641|Ga0075471_10427157 | Not Available | 662 | Open in IMG/M |
3300006641|Ga0075471_10565952 | Not Available | 559 | Open in IMG/M |
3300006875|Ga0075473_10041722 | All Organisms → Viruses → Predicted Viral | 1768 | Open in IMG/M |
3300007545|Ga0102873_1244985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300007593|Ga0102918_1219813 | Not Available | 579 | Open in IMG/M |
3300007625|Ga0102870_1201265 | Not Available | 567 | Open in IMG/M |
3300007630|Ga0102903_1185132 | Not Available | 567 | Open in IMG/M |
3300007862|Ga0105737_1210095 | Not Available | 516 | Open in IMG/M |
3300007864|Ga0105749_1166323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300008055|Ga0108970_10456268 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
3300008107|Ga0114340_1000421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 29334 | Open in IMG/M |
3300008107|Ga0114340_1000725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58338 | Open in IMG/M |
3300008107|Ga0114340_1001257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25585 | Open in IMG/M |
3300008107|Ga0114340_1004104 | Not Available | 13727 | Open in IMG/M |
3300008107|Ga0114340_1012540 | Not Available | 4736 | Open in IMG/M |
3300008107|Ga0114340_1016805 | All Organisms → Viruses → Predicted Viral | 3490 | Open in IMG/M |
3300008107|Ga0114340_1017414 | Not Available | 3423 | Open in IMG/M |
3300008107|Ga0114340_1083902 | All Organisms → Viruses → Predicted Viral | 2096 | Open in IMG/M |
3300008107|Ga0114340_1102955 | All Organisms → Viruses → Predicted Viral | 2304 | Open in IMG/M |
3300008107|Ga0114340_1105850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1115 | Open in IMG/M |
3300008107|Ga0114340_1254809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300008108|Ga0114341_10289514 | Not Available | 859 | Open in IMG/M |
3300008110|Ga0114343_1047443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1678 | Open in IMG/M |
3300008110|Ga0114343_1137362 | All Organisms → Viruses → Predicted Viral | 2031 | Open in IMG/M |
3300008111|Ga0114344_1000371 | Not Available | 43404 | Open in IMG/M |
3300008111|Ga0114344_1060155 | Not Available | 1446 | Open in IMG/M |
3300008113|Ga0114346_1020979 | Not Available | 3522 | Open in IMG/M |
3300008113|Ga0114346_1064060 | Not Available | 1783 | Open in IMG/M |
3300008113|Ga0114346_1164134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
3300008114|Ga0114347_1194100 | Not Available | 682 | Open in IMG/M |
3300008116|Ga0114350_1146530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1183 | Open in IMG/M |
3300008120|Ga0114355_1175653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300008120|Ga0114355_1220968 | Not Available | 586 | Open in IMG/M |
3300008120|Ga0114355_1248191 | Not Available | 526 | Open in IMG/M |
3300008962|Ga0104242_1009397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1730 | Open in IMG/M |
3300008996|Ga0102831_1137869 | Not Available | 810 | Open in IMG/M |
3300009059|Ga0102830_1152745 | Not Available | 678 | Open in IMG/M |
3300009155|Ga0114968_10000324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 35272 | Open in IMG/M |
3300009155|Ga0114968_10276746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
3300009161|Ga0114966_10001752 | Not Available | 19827 | Open in IMG/M |
3300009161|Ga0114966_10544790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300009183|Ga0114974_10214620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
3300009194|Ga0114983_1013451 | All Organisms → Viruses → Predicted Viral | 2314 | Open in IMG/M |
3300009419|Ga0114982_1290630 | Not Available | 512 | Open in IMG/M |
3300010354|Ga0129333_10996908 | Not Available | 704 | Open in IMG/M |
3300010388|Ga0136551_1000342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13666 | Open in IMG/M |
3300010388|Ga0136551_1000378 | Not Available | 12855 | Open in IMG/M |
3300012000|Ga0119951_1116305 | Not Available | 618 | Open in IMG/M |
3300012711|Ga0157607_1092811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300013005|Ga0164292_10550373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
3300013295|Ga0170791_13377912 | Not Available | 880 | Open in IMG/M |
3300013295|Ga0170791_14306262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1057 | Open in IMG/M |
3300013372|Ga0177922_10976895 | Not Available | 589 | Open in IMG/M |
3300014819|Ga0119954_1018333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1439 | Open in IMG/M |
3300020161|Ga0211726_10842565 | Not Available | 502 | Open in IMG/M |
3300020205|Ga0211731_10574037 | Not Available | 652 | Open in IMG/M |
3300020480|Ga0208201_100059 | Not Available | 8059 | Open in IMG/M |
3300020483|Ga0207418_100851 | All Organisms → Viruses → Predicted Viral | 3337 | Open in IMG/M |
3300020486|Ga0208698_101126 | All Organisms → Viruses → Predicted Viral | 2500 | Open in IMG/M |
3300020493|Ga0208591_1015703 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
3300020506|Ga0208091_1003122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2402 | Open in IMG/M |
3300020506|Ga0208091_1024224 | Not Available | 695 | Open in IMG/M |
3300020528|Ga0208224_1006304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1950 | Open in IMG/M |
3300021438|Ga0213920_1006625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3954 | Open in IMG/M |
3300021519|Ga0194048_10005208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6232 | Open in IMG/M |
3300021961|Ga0222714_10156370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1362 | Open in IMG/M |
3300021961|Ga0222714_10581799 | Not Available | 562 | Open in IMG/M |
3300021962|Ga0222713_10018405 | Not Available | 5944 | Open in IMG/M |
3300021962|Ga0222713_10045543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3395 | Open in IMG/M |
3300021962|Ga0222713_10074566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2496 | Open in IMG/M |
3300021962|Ga0222713_10385055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300022747|Ga0228703_1032217 | All Organisms → Viruses → Predicted Viral | 1549 | Open in IMG/M |
3300022748|Ga0228702_1046896 | Not Available | 1185 | Open in IMG/M |
3300022748|Ga0228702_1101316 | Not Available | 677 | Open in IMG/M |
3300022752|Ga0214917_10001130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34856 | Open in IMG/M |
3300023174|Ga0214921_10000990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 49719 | Open in IMG/M |
3300023174|Ga0214921_10011400 | Not Available | 10810 | Open in IMG/M |
3300023174|Ga0214921_10133090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1746 | Open in IMG/M |
3300024346|Ga0244775_10044152 | All Organisms → Viruses → Predicted Viral | 3911 | Open in IMG/M |
3300024346|Ga0244775_10276181 | Not Available | 1397 | Open in IMG/M |
3300024346|Ga0244775_10457090 | Not Available | 1046 | Open in IMG/M |
3300024346|Ga0244775_10734855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300024346|Ga0244775_11540096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300024348|Ga0244776_10163943 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
3300025732|Ga0208784_1017322 | Not Available | 2374 | Open in IMG/M |
3300025872|Ga0208783_10094202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1317 | Open in IMG/M |
3300025872|Ga0208783_10159111 | Not Available | 955 | Open in IMG/M |
3300026405|Ga0256296_1039520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300027137|Ga0255092_1070573 | Not Available | 548 | Open in IMG/M |
3300027278|Ga0208439_1102421 | Not Available | 509 | Open in IMG/M |
3300027281|Ga0208440_1010682 | All Organisms → Viruses → Predicted Viral | 2206 | Open in IMG/M |
3300027304|Ga0208810_1005211 | All Organisms → Viruses → Predicted Viral | 3040 | Open in IMG/M |
3300027508|Ga0255072_1031901 | Not Available | 1100 | Open in IMG/M |
3300027529|Ga0255077_1084629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300027608|Ga0208974_1004457 | Not Available | 4909 | Open in IMG/M |
3300027689|Ga0209551_1212762 | Not Available | 589 | Open in IMG/M |
3300027710|Ga0209599_10126249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300027710|Ga0209599_10145287 | Not Available | 631 | Open in IMG/M |
3300027734|Ga0209087_1086621 | Not Available | 1351 | Open in IMG/M |
3300027754|Ga0209596_1043906 | Not Available | 2391 | Open in IMG/M |
3300027754|Ga0209596_1051266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2155 | Open in IMG/M |
3300027759|Ga0209296_1166919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
3300027759|Ga0209296_1285047 | Not Available | 663 | Open in IMG/M |
3300027770|Ga0209086_10000043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 110973 | Open in IMG/M |
3300027782|Ga0209500_10001231 | Not Available | 19608 | Open in IMG/M |
3300027793|Ga0209972_10034688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2883 | Open in IMG/M |
3300027804|Ga0209358_10303096 | Not Available | 784 | Open in IMG/M |
3300027805|Ga0209229_10033418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2261 | Open in IMG/M |
3300027805|Ga0209229_10039598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2083 | Open in IMG/M |
3300028025|Ga0247723_1001180 | Not Available | 15788 | Open in IMG/M |
3300028025|Ga0247723_1029474 | All Organisms → Viruses → Predicted Viral | 1747 | Open in IMG/M |
3300028025|Ga0247723_1121073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300028178|Ga0265593_1071349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300029349|Ga0238435_100456 | Not Available | 9576 | Open in IMG/M |
3300031758|Ga0315907_10003962 | Not Available | 16938 | Open in IMG/M |
3300031758|Ga0315907_10070937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3017 | Open in IMG/M |
3300031758|Ga0315907_10952669 | Not Available | 625 | Open in IMG/M |
3300031784|Ga0315899_10178088 | Not Available | 2155 | Open in IMG/M |
3300031784|Ga0315899_10394173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1348 | Open in IMG/M |
3300031857|Ga0315909_10290197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1229 | Open in IMG/M |
3300031857|Ga0315909_10566587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300031963|Ga0315901_10191248 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
3300031963|Ga0315901_10962291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300032050|Ga0315906_11010714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300032092|Ga0315905_11401872 | Not Available | 555 | Open in IMG/M |
3300032116|Ga0315903_10387436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
3300032116|Ga0315903_10986356 | Not Available | 591 | Open in IMG/M |
3300033418|Ga0316625_100397090 | Not Available | 1039 | Open in IMG/M |
3300033488|Ga0316621_11282396 | Not Available | 556 | Open in IMG/M |
3300033521|Ga0316616_100513916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1377 | Open in IMG/M |
3300033557|Ga0316617_102246962 | Not Available | 563 | Open in IMG/M |
3300033816|Ga0334980_0002144 | Not Available | 9103 | Open in IMG/M |
3300033816|Ga0334980_0119441 | Not Available | 1090 | Open in IMG/M |
3300033993|Ga0334994_0023152 | All Organisms → Viruses → Predicted Viral | 4100 | Open in IMG/M |
3300034018|Ga0334985_0314078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300034062|Ga0334995_0671584 | Not Available | 588 | Open in IMG/M |
3300034071|Ga0335028_0318680 | Not Available | 915 | Open in IMG/M |
3300034101|Ga0335027_0247530 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
3300034102|Ga0335029_0286831 | Not Available | 1045 | Open in IMG/M |
3300034117|Ga0335033_0382964 | Not Available | 698 | Open in IMG/M |
3300034356|Ga0335048_0019245 | All Organisms → Viruses → Predicted Viral | 4830 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 14.46% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.84% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.64% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.83% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.83% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.23% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.02% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.42% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.22% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.61% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.61% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.41% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.41% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.41% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.41% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.81% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.81% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.20% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.20% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.20% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.60% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.60% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.60% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001250 | Freshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion | Environmental | Open in IMG/M |
3300001274 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020480 | Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020483 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020486 | Freshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020493 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026405 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027137 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027304 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J13876_1015023 | 3300001250 | Freshwater | MGNLIEIIGVACDECGGAGFIFFGDENNYDVESCDCALEIWGM* |
B570J13895_10091685 | 3300001274 | Freshwater | MGNLAEIIGVACDECGGAGFIFWGDEKNYDVESCDCVKDVWGI* |
B570J40625_10000162751 | 3300002835 | Freshwater | MGNISEIVGVACDECGGAGFIFFGDEKNYDVESCDCVKETWGI* |
B570J40625_1001531832 | 3300002835 | Freshwater | MGNLAEIIGVACDECGGAGFVFFGDEKNYDVESCDCVKETWGF* |
B570J40625_1003927015 | 3300002835 | Freshwater | MGNLIEIIGVACDECGGAGFIFFGDENNYDVESCDCALEIWGI* |
B570J40625_1004289772 | 3300002835 | Freshwater | MGNLAEIIGVACDECGGAGFIFFGDEKNYDVESCDCVQDTWGI* |
JGI25910J50241_1001337510 | 3300003388 | Freshwater Lake | MGNLAEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKDXWGI* |
JGI25921J50272_100127954 | 3300003430 | Freshwater Lake | MIXEIIAVACDECGGAGFLFWGDENNYDVESCDCALEKWGI* |
JGI25921J50272_100479992 | 3300003430 | Freshwater Lake | MVNNLKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL* |
Ga0066178_101955352 | 3300004124 | Freshwater Lake | MAKVKEYLEIIAVACDECGGAGFLFWGDENNYDVESCDCALESWGI* |
Ga0007787_102349482 | 3300004240 | Freshwater Lake | MGQLKEIIAVACDECGGAGFLFWGDENNFDVETCDCKFDETELM* |
Ga0070374_104872293 | 3300005517 | Freshwater Lake | MIKEIIAVACDECGGAGFLFWGDENNYDVESCDCALEKWGI* |
Ga0068877_100643237 | 3300005525 | Freshwater Lake | MGNISEIIAVSCDECGGAGFLFWGDENNYDVESCDCALEKWGI* |
Ga0068876_102494462 | 3300005527 | Freshwater Lake | MGNLTEIIAVACDECGGAGFLFWGNENNYDVESCDCALESWGI* |
Ga0068876_103667662 | 3300005527 | Freshwater Lake | MVNNLKEIIAVACDECGGAGFLFWGDENNYDVEACECAVEDWNI* |
Ga0049083_101912901 | 3300005580 | Freshwater Lentic | MGNLAEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKD |
Ga0049081_103280074 | 3300005581 | Freshwater Lentic | MAKMKEYIEIIAANCDECGGAGFLFFGNENNYDVEPCD |
Ga0078894_103184215 | 3300005662 | Freshwater Lake | MSDLKEIIAVACDECGGAGFLFWGDENNYDVESCDCALEKWGI* |
Ga0078894_105762032 | 3300005662 | Freshwater Lake | MINEIIAVACDECGGAGFLFWGDENNYDVESCDCALEKWGI* |
Ga0078894_107669303 | 3300005662 | Freshwater Lake | MAKVKEYLEIIAVNCDECGGAGFLFWGDENNYDVESCDCALEKWGI* |
Ga0078894_114225963 | 3300005662 | Freshwater Lake | LMGNISEIIAVSCDECGGAGFLFWGDENNYDVEACDCALDDWNI* |
Ga0078894_116200632 | 3300005662 | Freshwater Lake | MGNIAEIIAVACDECGGAGFLFWGDENNYDVESCDCALDDWGI* |
Ga0078894_117282181 | 3300005662 | Freshwater Lake | MAKVKQYLEIIAVNCDECGGAGFLFWGDENNFDVESCDCALEKWGV* |
Ga0070743_100125849 | 3300005941 | Estuarine | MSDLKEIIAVACDECGGAGFLFWGDENNYDVEACECALDDWNI* |
Ga0075470_100420212 | 3300006030 | Aqueous | MVKNVKEIIAVACDECGGAGFLFWGDENNYDVEACECALEDWNI* |
Ga0075471_104271571 | 3300006641 | Aqueous | KTKMVKNVKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL* |
Ga0075471_105659522 | 3300006641 | Aqueous | MVNNVKEIIAVACDECGGAGFLFWGDENNYDVEACECALEDWNI* |
Ga0075473_100417227 | 3300006875 | Aqueous | MVKNVKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL* |
Ga0102873_12449851 | 3300007545 | Estuarine | EIIAVACDECGGAGFLFWGDENNYDVEACECALDDWNI* |
Ga0102918_12198132 | 3300007593 | Estuarine | MVKNVKEIIAVACDECGGAGFLFWGDENNYDVESCDCALEKWGI* |
Ga0102870_12012651 | 3300007625 | Estuarine | MSKMKEYVEIIAANCDECGGAGFVFFGDENNYDVEPCECIADL |
Ga0102903_11851322 | 3300007630 | Estuarine | MGQLKEIIAVACDECNGVGFIFWGDENNFDVETCNCEFDETELI* |
Ga0105737_12100951 | 3300007862 | Estuary Water | MANVKQYLEIIAVDCDECGGAGFLFWGDENNFDIESCDC |
Ga0105749_11663231 | 3300007864 | Estuary Water | MSKMKEYIEIIAANCDECGGAGFIFLGDENNYDVEPCD |
Ga0108970_104562683 | 3300008055 | Estuary | MVKDVKEIIAVACDECGGAGFLFWGDENNYDVEACDCALESWNI* |
Ga0114340_100042169 | 3300008107 | Freshwater, Plankton | MGNLAEIIGVACDECGGAGFIFFGDENNYDVQSCDCAEEAWGI* |
Ga0114340_100072523 | 3300008107 | Freshwater, Plankton | MGNIAEIIGVECDECGGAGFVFYGDEKEFDVKSCDCALETWGI* |
Ga0114340_10012572 | 3300008107 | Freshwater, Plankton | MAKVKEYLEIIAVDCNECNGAGFIFFGSDNNYDVESCDCVLESWEI* |
Ga0114340_10041049 | 3300008107 | Freshwater, Plankton | MVNNLKEIIAVACDECGGAGFLFWGDENNYDVEQCDCALDVWGL* |
Ga0114340_10125405 | 3300008107 | Freshwater, Plankton | MAKVKQYLEIIAASCDECGGAGFLFWGDENNYDVEACECALEDWNI* |
Ga0114340_10168059 | 3300008107 | Freshwater, Plankton | MAKVKEYLEIISAQCDECGGAGFLFWGNENNFDVESCECALEDWNI* |
Ga0114340_10174147 | 3300008107 | Freshwater, Plankton | MVKDVKEIIAVACDECGGAGFLFWGDENNYDVEACECALEDWNI* |
Ga0114340_10839024 | 3300008107 | Freshwater, Plankton | MTDLKEIIAVACDECGGAGFLFWGDENNYDVEQCDCALDDWGL* |
Ga0114340_11029554 | 3300008107 | Freshwater, Plankton | MGNIAEIIAVSCNECGGAGFLFWGDENNYDVESCDCALDDWGI* |
Ga0114340_11058501 | 3300008107 | Freshwater, Plankton | ERKTKMVNNLKEIIAVACDECGGAGFLFWGDENNYDVESCECALEKWGI* |
Ga0114340_12548091 | 3300008107 | Freshwater, Plankton | MAKVKQYLEIISAECDECGGAGFVFWGDENNYDCEPC |
Ga0114341_102895143 | 3300008108 | Freshwater, Plankton | MTDLKEIIAVSCDECGGAGFLFWGDENNYDVEQCDCALDDWGL* |
Ga0114343_10474434 | 3300008110 | Freshwater, Plankton | MAKVKQYLEIIAVACDECGGAGFLFWGDENNYDVESCECALEKWGI* |
Ga0114343_11373627 | 3300008110 | Freshwater, Plankton | MVNNLKEIIAVACDECGGAGFLFWGDENNYDVQL* |
Ga0114344_100037110 | 3300008111 | Freshwater, Plankton | MGNISEIIAVACDECGGAGFLFWGDENNYDVEACECAIEDWNI* |
Ga0114344_10601556 | 3300008111 | Freshwater, Plankton | MAKVKQYLEIIAVACDECGGAGFLFWGDENNYDVESCECALEKWG |
Ga0114346_10209791 | 3300008113 | Freshwater, Plankton | YLEIISAQCDECGGAGFLFWGNENNFDVESCECALEDWNI* |
Ga0114346_10640604 | 3300008113 | Freshwater, Plankton | MGNIAEIIAVACDECGGAGFLFWGDENNYDVEACECALDDWNI* |
Ga0114346_11641343 | 3300008113 | Freshwater, Plankton | MVNNVKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL* |
Ga0114347_11941002 | 3300008114 | Freshwater, Plankton | MSKIKEYIEIIAAECDECGGAGFIFFGDEKNYDVESCECATDEWGI* |
Ga0114350_11465304 | 3300008116 | Freshwater, Plankton | MVNNLKEIIAVACDECGGAGFLFWGDENNYDVESCECALEKWGI* |
Ga0114355_11756531 | 3300008120 | Freshwater, Plankton | KEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL* |
Ga0114355_12209681 | 3300008120 | Freshwater, Plankton | IAVACDECGGAGFLFWGDENNYDVEACECALEDWNI* |
Ga0114355_12481911 | 3300008120 | Freshwater, Plankton | VSCDECGGAGFLFWGDENNYDVESCDCALEKWGI* |
Ga0104242_10093973 | 3300008962 | Freshwater | MVKDIKEIIAVACDECGGAGFIFFGDENNYDVEQCECAEGKEIY* |
Ga0102831_11378691 | 3300008996 | Estuarine | IAVACDECGGAGFLFWGDENNYDVESCDCALEKWGI* |
Ga0102830_11527453 | 3300009059 | Estuarine | AVACDECGGAGFLFWGDENNYDVESCDCALEKWGI* |
Ga0114968_1000032446 | 3300009155 | Freshwater Lake | MGNLAEIIGVACDECGGAGFIFWGDENNYDVESCDCALEMWGI* |
Ga0114968_102767462 | 3300009155 | Freshwater Lake | MAKVKQLIETLAENCEKCGGAGFIFFGDENNFDCETCDCVEGENYNV* |
Ga0114966_1000175251 | 3300009161 | Freshwater Lake | VGNILEILAVSCDECGGAGFVFWGDENNYDVESCDCALEMWGI* |
Ga0114966_105447901 | 3300009161 | Freshwater Lake | MINLKEIIAVACDECEGAGFIFFGDENNFDVETCDCVKGENFNV* |
Ga0114974_102146204 | 3300009183 | Freshwater Lake | MGNLAEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKDAWGI* |
Ga0114983_10134516 | 3300009194 | Deep Subsurface | MGNLIEIIGVACDECGGAGFIFFGDENNYDVESCDCALEMWGI* |
Ga0114982_12906302 | 3300009419 | Deep Subsurface | MAKVKQYLEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL* |
Ga0129333_109969081 | 3300010354 | Freshwater To Marine Saline Gradient | MAKVKELIEIVSAECDECGGAGFIFFGNELAYDVEPCDC |
Ga0136551_100034227 | 3300010388 | Pond Fresh Water | MGNLSEIIGVACDDCGGAGFIFWGDENNYDVESCDCALEMWGI* |
Ga0136551_100037828 | 3300010388 | Pond Fresh Water | MIKEIIAVACDECNGAGFIFWGDENNFDVESCQCNFDETDLI* |
Ga0119951_11163052 | 3300012000 | Freshwater | MGNLAEIIAVACDECGGAGFLFWGDENNYDVEACECAVEDWNI* |
Ga0157607_10928113 | 3300012711 | Freshwater | MGNLIEIIGVACDECGGAGFIFFGDEKNYDVESCDCALEIWGM* |
Ga0164292_105503732 | 3300013005 | Freshwater | MGNLIEIIGVACDECGGAGFIFFGDEKNYDVESCDCALEIWGI* |
Ga0170791_133779123 | 3300013295 | Freshwater | MGNLSEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKDAWGI* |
Ga0170791_143062623 | 3300013295 | Freshwater | MVKVNKLIETLAENCEKCGGAGFIFFGDENNFDCETCDCVEGENYNV* |
Ga0177922_109768951 | 3300013372 | Freshwater | MSKMKEYIEIIAANCDECGGAGFLFFGNENNYDVEPCDCIAD |
Ga0119954_10183332 | 3300014819 | Freshwater | MGNILEILAVECDECGGAGFVFWGDENNYDVESCDCSLDKWVI* |
Ga0211726_108425653 | 3300020161 | Freshwater | VGNILEILAVSCDECGGAGFIFWGDENNYDVESCDCALEMWGI |
Ga0211731_105740371 | 3300020205 | Freshwater | MGNLTEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKDEWGI |
Ga0208201_10005910 | 3300020480 | Freshwater | MGNLAEIIGVACDECGGAGFIFWGDEKNYDVESCDCVKDVWGI |
Ga0207418_1008519 | 3300020483 | Freshwater | MGNLIEIIGVACDECGGAGFIFFGDENNYDVESCDCALEIWGM |
Ga0208698_1011266 | 3300020486 | Freshwater | MGNLIEIIGVACDECGGAGFIFFGDEKNYDVESCDCALEIWGI |
Ga0208591_10157032 | 3300020493 | Freshwater | MGNISEIVGVACDECGGAGFIFFGDEKNYDVESCDCVKETWGI |
Ga0208091_10031227 | 3300020506 | Freshwater | MGNLAEIIGVACDECGGAGFIFFGDEKNYDVESCDCVQDTWGI |
Ga0208091_10242243 | 3300020506 | Freshwater | MGNLAEIIGVACDECGGAGFVFFGDEKNYDVESCDCVKETWGF |
Ga0208224_10063045 | 3300020528 | Freshwater | MGNLAEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKDAWGI |
Ga0213920_100662510 | 3300021438 | Freshwater | MGNISEIIAVECEECGGAGFVFWGDEKNYDVESCDCVLDKWVI |
Ga0194048_1000520813 | 3300021519 | Anoxic Zone Freshwater | MGNILEILAVECDECGGAGFVFWGDEKNYDVESCDCSLDKWVI |
Ga0222714_101563704 | 3300021961 | Estuarine Water | EMVNNVKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL |
Ga0222714_105817993 | 3300021961 | Estuarine Water | MGQLKEIIAVACDECGGAGFLFWGDENNYDVETCNCNFDETDLI |
Ga0222713_1001840510 | 3300021962 | Estuarine Water | MVNNVKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL |
Ga0222713_100455435 | 3300021962 | Estuarine Water | MGNITEIIAVACDECGGAGFLFWGNENNFDVESCDCALEKWGI |
Ga0222713_100745664 | 3300021962 | Estuarine Water | MVNDVKEIIAVACDECGGAGFLFWGDENNYDVESCDCALEKWGI |
Ga0222713_103850553 | 3300021962 | Estuarine Water | MVNNLKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL |
Ga0228703_10322174 | 3300022747 | Freshwater | MGNIAEIIAVACDECGGAGFLFWGNENNYDVEACECAVEDWNI |
Ga0228702_10468961 | 3300022748 | Freshwater | MGNLSEIIAVPCDECGGAGFLFWGDEKNYDVETCDCALDDWMI |
Ga0228702_11013161 | 3300022748 | Freshwater | MGNISEIIAVACDECGGAGFLFWGDENNYDVESCDCALDDWGI |
Ga0214917_1000113040 | 3300022752 | Freshwater | MGNILEILAVECDECGGAGFVFWGDENNYDVESCDCSLDKWVI |
Ga0214921_100009901 | 3300023174 | Freshwater | MSKIKEYIEIIAANCDECGGAGFLFFGDENNYDCEPCDCISD |
Ga0214921_1001140015 | 3300023174 | Freshwater | MGNLAEIIAVACDECGGAGFLFWGDENNYDVEACECAVEDWNI |
Ga0214921_101330903 | 3300023174 | Freshwater | MVKDIKEIIAVACDECGGAGFIFFGDENNYDVEQCECAEGKEIY |
Ga0244775_100441529 | 3300024346 | Estuarine | MSDLKEIIAVACDECGGAGFLFWGDENNYDVEACECALDDWNI |
Ga0244775_102761813 | 3300024346 | Estuarine | MIKEIIAVACDECGGAGFLFWGDENNYDVESCDCALEKWGI |
Ga0244775_104570901 | 3300024346 | Estuarine | MSDLKEIIAVACDECGGAGFLFWGDENNYDVESCDCALEKWGI |
Ga0244775_107348552 | 3300024346 | Estuarine | MGNLLEILAIACDECNGAGFIFIGDENNFDCETCDCVEGENYNV |
Ga0244775_115400961 | 3300024346 | Estuarine | MGNILEIIAVACDECGGAGFLFWGDENNYDVESCDCALESWGI |
Ga0244776_101639431 | 3300024348 | Estuarine | MVNNLKEIIAVACDECGGAGFLFWGDENNYDVEACECALVDWNI |
Ga0208784_10173224 | 3300025732 | Aqueous | MVKNVKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL |
Ga0208783_100942022 | 3300025872 | Aqueous | MVKNVKEIIAVACDECGGAGFLFWGDENNYDVEQCDCALDVWGL |
Ga0208783_101591114 | 3300025872 | Aqueous | NVKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL |
Ga0256296_10395202 | 3300026405 | Freshwater | MAKVKQYLEIIAVACDECGGAGFLFWGDENNYDVESCECALEKWGI |
Ga0255092_10705732 | 3300027137 | Freshwater | MVKNLKEIIAVACDECGGAGFLFWGDENNYDVESCECALEKWGI |
Ga0208439_11024213 | 3300027278 | Estuarine | AVACDECGGAGFLFWGDENNYDVESCDCALEKWGI |
Ga0208440_10106821 | 3300027281 | Estuarine | MARMKEYVEIISAACDECGGAGFLFWGDENNYDVEPCEC |
Ga0208810_10052112 | 3300027304 | Estuarine | MARMKEYVEIISAACDECGGAGFLFWGDENNYDVEACECALEDWNI |
Ga0255072_10319015 | 3300027508 | Freshwater | MSKVKQYLEIISAECDECGGAGFVFWGDENNYDCEP |
Ga0255077_10846293 | 3300027529 | Freshwater | LEIIAVACDECGGAGFLFWGDENNYDVESCECALEKWGI |
Ga0208974_10044573 | 3300027608 | Freshwater Lentic | MGNISEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKETWGI |
Ga0209551_12127622 | 3300027689 | Freshwater Lake | MAKVKEYLEIIAVACDECGGAGFLFWGDENNYDVESCDCALESWGI |
Ga0209599_101262492 | 3300027710 | Deep Subsurface | MGNLIEIIGVACDECGGAGFIFFGDENNYDVESCDCALEMWGI |
Ga0209599_101452873 | 3300027710 | Deep Subsurface | MGNLKEIIAVACDECGGAGFIFWGNENNFDVETCECALDDWSI |
Ga0209087_10866216 | 3300027734 | Freshwater Lake | VGNILEILAVSCDECGGAGFIFFGDEKNYDVESCDCVKDAWGI |
Ga0209596_10439066 | 3300027754 | Freshwater Lake | MINLKEIIAVACDECEGAGFIFFGDENNFDVETCDCVKGENFNV |
Ga0209596_10512665 | 3300027754 | Freshwater Lake | MAKVKQLIETLAENCEKCGGAGFIFFGDENNFDCETCDCVEGENYNV |
Ga0209296_11669193 | 3300027759 | Freshwater Lake | MGNLSEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKDTWGI |
Ga0209296_12850473 | 3300027759 | Freshwater Lake | MGNLAEIVGVACDECGGAGFIFFGDEKNYDVESCDCVKDTWGI |
Ga0209086_10000043101 | 3300027770 | Freshwater Lake | VGNILEILAVSCDECGGAGFVFWGDENNYDVESCDCALEMWGI |
Ga0209500_1000123145 | 3300027782 | Freshwater Lake | VGNILEILAVSCDECGGAGFIFWGDENNYDVESCDCALEIWGI |
Ga0209972_100346881 | 3300027793 | Freshwater Lake | DTIPITDERKTKMVNNLKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL |
Ga0209358_103030963 | 3300027804 | Freshwater Lake | GNISEIIAVSCDECGGAGFLFWGDENNYDVESCDCALEKWGI |
Ga0209229_100334184 | 3300027805 | Freshwater And Sediment | MGQLKEIIAVACDECGGAGFLFWGDENNFDVETCDCKFDETELM |
Ga0209229_100395986 | 3300027805 | Freshwater And Sediment | MVKDVKEIIAVACDECGGAGFLFWGDENNYDVEACECALEDWNI |
Ga0247723_100118037 | 3300028025 | Deep Subsurface Sediment | MGNLAEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKNAWGI |
Ga0247723_10294746 | 3300028025 | Deep Subsurface Sediment | MGNLKEIIAVACDECGGAGFIFWGNENNFDVEACECALDDWSI |
Ga0247723_11210733 | 3300028025 | Deep Subsurface Sediment | VKQYLEIIAVSCDECGGAGFLFWGDENNYDVESCDCALEKWGI |
Ga0265593_10713492 | 3300028178 | Saline Water | MGNLLEILAVACDECEGAGFIFFGDENNFDVETCGCVEGENFNV |
Ga0238435_1004568 | 3300029349 | Freshwater | MAKVKQYLEIIAVACDECGGAGFLFYGDENNYDVESCDCALEIWGI |
Ga0315907_1000396217 | 3300031758 | Freshwater | MTDLKEIIAVACDECGGAGFLFWGDENNYDVEQCDCALDDWGL |
Ga0315907_100709377 | 3300031758 | Freshwater | MSKIKEYIEIIAAECDECGGAGFIFFGDEKNYDVESCECATDEWGI |
Ga0315907_109526693 | 3300031758 | Freshwater | MVKDVKEIIAVACDECGGAGFLFWGDENNYDVEAC |
Ga0315899_101780883 | 3300031784 | Freshwater | MGNIAEIIAVACDECGGAGFLFWGDENNYDVEACECALDDWNI |
Ga0315899_103941736 | 3300031784 | Freshwater | MAKVKEYLEIIAVDCNECNGAGFIFFGSDNNYDVESCDCVLESWEI |
Ga0315909_102901973 | 3300031857 | Freshwater | MVNNLKEIIAVACDECGGAGFLFWGDENNYDVESCECALEKWGI |
Ga0315909_105665873 | 3300031857 | Freshwater | MVNNVKEIIAVACDECGGAGFLFWGDENNYDVEQCECAWGL |
Ga0315901_101912486 | 3300031963 | Freshwater | MGNISEIIAVSCDECGGAGFLFWGDENNYDVESCDCALEKWGIN |
Ga0315901_109622912 | 3300031963 | Freshwater | VATDTIPITNERKTKMVNNLKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL |
Ga0315906_110107141 | 3300032050 | Freshwater | MAKVKQYLEIIAVACDECGGAGFLFWGDENNYDVEQCECALD |
Ga0315905_114018722 | 3300032092 | Freshwater | MVNNLKEIIAVACDECGGAGFLFWGDENNYDVEACECALEDWNI |
Ga0315903_103874363 | 3300032116 | Freshwater | MGNIQEIIGVECDECGGAGFVFYGDEKEFDVKSCDCALETWGI |
Ga0315903_109863564 | 3300032116 | Freshwater | AVSCDECGGAGFLFWGDENNYDVESCDCALEKWGI |
Ga0316625_1003970904 | 3300033418 | Soil | KNVKEIIAVACDECGGAGFLFWGDENNYDVEQCECALDVWGL |
Ga0316621_112823964 | 3300033488 | Soil | AVACDECGGAGFLFWGDENNYDVEQCDCALDVWGI |
Ga0316616_1005139163 | 3300033521 | Soil | MVKDVKEIIAVACDECGGAGFLFWGDENNYDVEQCDCALDVWGL |
Ga0316617_1022469623 | 3300033557 | Soil | MVKNVKEIIAVACDECGGAGFLFWGDENNYDVEQCDCALDVWGI |
Ga0334980_0002144_2810_2950 | 3300033816 | Freshwater | MAKVKEYLEIIAVNCDECNGAGFLFWGDENNFDVESCDCALEKWGI |
Ga0334980_0119441_772_903 | 3300033816 | Freshwater | MGNLAEIIGVACDECGGAGFIFWGDEKNYDVESCDCVKDAWGI |
Ga0334994_0023152_1575_1706 | 3300033993 | Freshwater | MGNLIEIIGVACDECGGAGFIFFGDEKNYDVESCDCALEIWGM |
Ga0334985_0314078_720_851 | 3300034018 | Freshwater | MGNLIEIIGVACDECGGAGFIFFGDENNYDVESCDCALEIWGI |
Ga0334995_0671584_333_464 | 3300034062 | Freshwater | MGNLAEIIGVACDECGGAGFIFWGDEKNYDVESCDCVKNAWGI |
Ga0335028_0318680_564_695 | 3300034071 | Freshwater | MGNLTEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKNAWGI |
Ga0335027_0247530_125_265 | 3300034101 | Freshwater | MAKVKEYLEIIAVACDECGGAGFLFWGNENNYDVESCDCALEKWGI |
Ga0335029_0286831_926_1045 | 3300034102 | Freshwater | KQIIAVACDECGGAGFLFWGDENNYDVESCDCALEKWGI |
Ga0335033_0382964_572_697 | 3300034117 | Freshwater | NLAEIIGVACDECGGAGFIFWGDEKNYDVESCDCVKDVWGI |
Ga0335048_0019245_2303_2434 | 3300034356 | Freshwater | MGNLAEIIGVACDECGGAGFIFFGDEKNYDVESCDCVKETWGI |
⦗Top⦘ |