Basic Information | |
---|---|
Family ID | F038299 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 166 |
Average Sequence Length | 40 residues |
Representative Sequence | MASTKVPIELSSTPGIVDNSNATAITIDSSENVGIGT |
Number of Associated Samples | 141 |
Number of Associated Scaffolds | 166 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 99.38 % |
% of genes near scaffold ends (potentially truncated) | 95.78 % |
% of genes from short scaffolds (< 2000 bps) | 84.34 % |
Associated GOLD sequencing projects | 129 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (41.566 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (22.289 % of family members) |
Environment Ontology (ENVO) | Unclassified (71.687 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.145 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.77% β-sheet: 9.23% Coil/Unstructured: 80.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 166 Family Scaffolds |
---|---|---|
PF13884 | Peptidase_S74 | 47.59 |
PF00386 | C1q | 4.82 |
PF11962 | Peptidase_G2 | 0.60 |
PF02195 | ParBc | 0.60 |
PF11651 | P22_CoatProtein | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.61 % |
Unclassified | root | N/A | 41.57 % |
unclassified Hyphomonas | no rank | unclassified Hyphomonas | 4.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10033228 | All Organisms → Viruses → Predicted Viral | 2803 | Open in IMG/M |
3300000117|DelMOWin2010_c10156516 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 746 | Open in IMG/M |
3300001961|GOS2240_1047492 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 985 | Open in IMG/M |
3300001962|GOS2239_1025564 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
3300001962|GOS2239_1044606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 589 | Open in IMG/M |
3300001963|GOS2229_1008013 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300002242|KVWGV2_10989122 | Not Available | 511 | Open in IMG/M |
3300004461|Ga0066223_1148117 | Not Available | 556 | Open in IMG/M |
3300005611|Ga0074647_1011920 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
3300005837|Ga0078893_11936831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 684 | Open in IMG/M |
3300005941|Ga0070743_10233111 | Not Available | 600 | Open in IMG/M |
3300006193|Ga0075445_10107400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED65 | 1034 | Open in IMG/M |
3300006352|Ga0075448_10040803 | Not Available | 1489 | Open in IMG/M |
3300006419|Ga0075496_1011614 | Not Available | 502 | Open in IMG/M |
3300006752|Ga0098048_1129023 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 758 | Open in IMG/M |
3300006802|Ga0070749_10783564 | Not Available | 506 | Open in IMG/M |
3300006810|Ga0070754_10241498 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 828 | Open in IMG/M |
3300006869|Ga0075477_10189165 | Not Available | 847 | Open in IMG/M |
3300006919|Ga0070746_10355007 | Not Available | 664 | Open in IMG/M |
3300006921|Ga0098060_1051421 | All Organisms → Viruses | 1217 | Open in IMG/M |
3300006947|Ga0075444_10191810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED65 | 831 | Open in IMG/M |
3300007344|Ga0070745_1142886 | Not Available | 911 | Open in IMG/M |
3300007344|Ga0070745_1155239 | Not Available | 865 | Open in IMG/M |
3300007540|Ga0099847_1112781 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 822 | Open in IMG/M |
3300007542|Ga0099846_1251598 | Not Available | 613 | Open in IMG/M |
3300007954|Ga0105739_1140250 | Not Available | 570 | Open in IMG/M |
3300007960|Ga0099850_1012715 | All Organisms → Viruses → Predicted Viral | 3791 | Open in IMG/M |
3300007963|Ga0110931_1148339 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 704 | Open in IMG/M |
3300008012|Ga0075480_10044401 | All Organisms → Viruses → Predicted Viral | 2632 | Open in IMG/M |
3300008012|Ga0075480_10160190 | Not Available | 1214 | Open in IMG/M |
3300009440|Ga0115561_1259623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300009606|Ga0115102_10387025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-7 | 505 | Open in IMG/M |
3300009608|Ga0115100_10075308 | Not Available | 550 | Open in IMG/M |
3300009790|Ga0115012_11265016 | Not Available | 623 | Open in IMG/M |
3300010148|Ga0098043_1135038 | All Organisms → Viruses | 705 | Open in IMG/M |
3300011258|Ga0151677_1027244 | Not Available | 606 | Open in IMG/M |
3300012524|Ga0129331_1075132 | Not Available | 535 | Open in IMG/M |
3300012919|Ga0160422_10851801 | Not Available | 586 | Open in IMG/M |
3300012920|Ga0160423_10273979 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
3300012952|Ga0163180_10148252 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1555 | Open in IMG/M |
3300012969|Ga0129332_1135574 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 718 | Open in IMG/M |
3300017708|Ga0181369_1094972 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 623 | Open in IMG/M |
3300017709|Ga0181387_1044326 | Not Available | 882 | Open in IMG/M |
3300017710|Ga0181403_1002512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 4174 | Open in IMG/M |
3300017713|Ga0181391_1151004 | Not Available | 514 | Open in IMG/M |
3300017717|Ga0181404_1031607 | Not Available | 1358 | Open in IMG/M |
3300017719|Ga0181390_1099921 | Not Available | 778 | Open in IMG/M |
3300017720|Ga0181383_1024514 | unclassified Hyphomonas → Hyphomonas sp. | 1622 | Open in IMG/M |
3300017724|Ga0181388_1037891 | Not Available | 1178 | Open in IMG/M |
3300017727|Ga0181401_1004849 | All Organisms → Viruses → Predicted Viral | 4679 | Open in IMG/M |
3300017729|Ga0181396_1123550 | Not Available | 533 | Open in IMG/M |
3300017730|Ga0181417_1093752 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 726 | Open in IMG/M |
3300017734|Ga0187222_1150797 | Not Available | 517 | Open in IMG/M |
3300017737|Ga0187218_1096978 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 709 | Open in IMG/M |
3300017740|Ga0181418_1014178 | All Organisms → Viruses → Predicted Viral | 2133 | Open in IMG/M |
3300017741|Ga0181421_1037900 | Not Available | 1295 | Open in IMG/M |
3300017744|Ga0181397_1023872 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
3300017744|Ga0181397_1038253 | Not Available | 1357 | Open in IMG/M |
3300017745|Ga0181427_1001159 | Not Available | 6610 | Open in IMG/M |
3300017751|Ga0187219_1156189 | Not Available | 655 | Open in IMG/M |
3300017753|Ga0181407_1077159 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 852 | Open in IMG/M |
3300017755|Ga0181411_1003546 | All Organisms → cellular organisms → Bacteria | 5475 | Open in IMG/M |
3300017756|Ga0181382_1150950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 605 | Open in IMG/M |
3300017758|Ga0181409_1088740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 928 | Open in IMG/M |
3300017763|Ga0181410_1012837 | All Organisms → Viruses → Predicted Viral | 2879 | Open in IMG/M |
3300017764|Ga0181385_1175661 | Not Available | 647 | Open in IMG/M |
3300017775|Ga0181432_1214482 | Not Available | 604 | Open in IMG/M |
3300017782|Ga0181380_1085151 | unclassified Hyphomonas → Hyphomonas sp. | 1104 | Open in IMG/M |
3300017782|Ga0181380_1172106 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 732 | Open in IMG/M |
3300017783|Ga0181379_1059590 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 1446 | Open in IMG/M |
3300017783|Ga0181379_1114153 | Not Available | 981 | Open in IMG/M |
3300017786|Ga0181424_10031452 | All Organisms → Viruses → Predicted Viral | 2304 | Open in IMG/M |
3300017786|Ga0181424_10037258 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2108 | Open in IMG/M |
3300017786|Ga0181424_10453160 | Not Available | 517 | Open in IMG/M |
3300017950|Ga0181607_10582442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300017985|Ga0181576_10056644 | Not Available | 2665 | Open in IMG/M |
3300018420|Ga0181563_10391494 | Not Available | 795 | Open in IMG/M |
3300018424|Ga0181591_10592912 | unclassified Hyphomonas → Hyphomonas sp. | 794 | Open in IMG/M |
3300019459|Ga0181562_10338993 | Not Available | 738 | Open in IMG/M |
3300019459|Ga0181562_10570158 | Not Available | 531 | Open in IMG/M |
3300019751|Ga0194029_1096255 | Not Available | 518 | Open in IMG/M |
3300020173|Ga0181602_10236413 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300020174|Ga0181603_10377135 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 525 | Open in IMG/M |
3300020374|Ga0211477_10085038 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
3300020393|Ga0211618_10144909 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300020410|Ga0211699_10270211 | Not Available | 659 | Open in IMG/M |
3300020430|Ga0211622_10250311 | Not Available | 759 | Open in IMG/M |
3300020461|Ga0211535_10163626 | Not Available | 969 | Open in IMG/M |
3300021085|Ga0206677_10226547 | unclassified Hyphomonas → Hyphomonas sp. | 785 | Open in IMG/M |
3300021185|Ga0206682_10277515 | Not Available | 736 | Open in IMG/M |
3300021373|Ga0213865_10082494 | All Organisms → Viruses → Predicted Viral | 1737 | Open in IMG/M |
3300021373|Ga0213865_10235431 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 885 | Open in IMG/M |
3300021373|Ga0213865_10250293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 849 | Open in IMG/M |
3300021378|Ga0213861_10210143 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1054 | Open in IMG/M |
3300021389|Ga0213868_10431522 | Not Available | 722 | Open in IMG/M |
3300021425|Ga0213866_10094755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1633 | Open in IMG/M |
3300021425|Ga0213866_10359197 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 718 | Open in IMG/M |
3300021792|Ga0226836_10840630 | Not Available | 518 | Open in IMG/M |
3300021957|Ga0222717_10117310 | All Organisms → Viruses → Predicted Viral | 1650 | Open in IMG/M |
3300021959|Ga0222716_10075545 | All Organisms → Viruses → Predicted Viral | 2327 | Open in IMG/M |
3300021959|Ga0222716_10112420 | Not Available | 1826 | Open in IMG/M |
3300021964|Ga0222719_10179480 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
3300022066|Ga0224902_100679 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1610 | Open in IMG/M |
3300022167|Ga0212020_1081127 | All Organisms → Viruses | 544 | Open in IMG/M |
3300022169|Ga0196903_1010101 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
3300022178|Ga0196887_1058492 | unclassified Hyphomonas → Hyphomonas sp. | 959 | Open in IMG/M |
3300022178|Ga0196887_1096615 | All Organisms → Viruses | 666 | Open in IMG/M |
3300022187|Ga0196899_1173811 | All Organisms → Viruses → environmental samples → uncultured virus | 585 | Open in IMG/M |
3300022187|Ga0196899_1181950 | Not Available | 566 | Open in IMG/M |
3300022200|Ga0196901_1052009 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
3300022900|Ga0255771_1100957 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10154640 | All Organisms → Viruses | 1200 | Open in IMG/M |
3300023180|Ga0255768_10122697 | All Organisms → Viruses → Predicted Viral | 1695 | Open in IMG/M |
3300023180|Ga0255768_10340651 | Not Available | 822 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10112173 | All Organisms → Viruses → Predicted Viral | 1398 | Open in IMG/M |
3300025048|Ga0207905_1044486 | Not Available | 694 | Open in IMG/M |
3300025083|Ga0208791_1033889 | unclassified Hyphomonas → Hyphomonas sp. | 953 | Open in IMG/M |
3300025108|Ga0208793_1049439 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1302 | Open in IMG/M |
3300025132|Ga0209232_1026570 | All Organisms → Viruses → Predicted Viral | 2239 | Open in IMG/M |
3300025137|Ga0209336_10089936 | Not Available | 883 | Open in IMG/M |
3300025138|Ga0209634_1022719 | All Organisms → Viruses → Predicted Viral | 3460 | Open in IMG/M |
3300025138|Ga0209634_1119657 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
3300025570|Ga0208660_1047945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Marinomonas → Marinomonas polaris → Marinomonas polaris DSM 16579 | 1078 | Open in IMG/M |
3300025621|Ga0209504_1008358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5068 | Open in IMG/M |
3300025646|Ga0208161_1066671 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
3300025646|Ga0208161_1073252 | Not Available | 1014 | Open in IMG/M |
3300025647|Ga0208160_1028670 | All Organisms → Viruses → Predicted Viral | 1701 | Open in IMG/M |
3300025652|Ga0208134_1059116 | All Organisms → Viruses | 1180 | Open in IMG/M |
3300025655|Ga0208795_1042280 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1382 | Open in IMG/M |
3300025771|Ga0208427_1211749 | Not Available | 611 | Open in IMG/M |
3300025810|Ga0208543_1096104 | Not Available | 708 | Open in IMG/M |
3300025815|Ga0208785_1090837 | unclassified Hyphomonas → Hyphomonas sp. | 768 | Open in IMG/M |
3300025840|Ga0208917_1182100 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 711 | Open in IMG/M |
3300025853|Ga0208645_1024621 | All Organisms → Viruses → Predicted Viral | 3229 | Open in IMG/M |
3300025853|Ga0208645_1135210 | Not Available | 961 | Open in IMG/M |
3300025860|Ga0209119_1188663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300025887|Ga0208544_10391283 | Not Available | 520 | Open in IMG/M |
3300025889|Ga0208644_1048590 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2371 | Open in IMG/M |
3300026187|Ga0209929_1028348 | All Organisms → Viruses → Predicted Viral | 1700 | Open in IMG/M |
3300027791|Ga0209830_10181454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 991 | Open in IMG/M |
3300027810|Ga0209302_10338697 | Not Available | 689 | Open in IMG/M |
3300027820|Ga0209578_10535620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 523 | Open in IMG/M |
3300027833|Ga0209092_10053487 | All Organisms → Viruses → Predicted Viral | 2491 | Open in IMG/M |
3300027833|Ga0209092_10063250 | Not Available | 2259 | Open in IMG/M |
3300028125|Ga0256368_1022716 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1111 | Open in IMG/M |
3300029792|Ga0183826_1022717 | Not Available | 1007 | Open in IMG/M |
3300031519|Ga0307488_10319255 | All Organisms → Viruses | 992 | Open in IMG/M |
3300031622|Ga0302126_10126809 | Not Available | 968 | Open in IMG/M |
3300031659|Ga0307986_10378304 | Not Available | 571 | Open in IMG/M |
3300031687|Ga0308008_1077761 | Not Available | 778 | Open in IMG/M |
3300031695|Ga0308016_10366724 | Not Available | 516 | Open in IMG/M |
3300031706|Ga0307997_10265092 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 616 | Open in IMG/M |
3300031775|Ga0315326_10975020 | Not Available | 519 | Open in IMG/M |
3300031851|Ga0315320_10246140 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1297 | Open in IMG/M |
3300031851|Ga0315320_10415486 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 928 | Open in IMG/M |
3300032047|Ga0315330_10255749 | Not Available | 1116 | Open in IMG/M |
3300032088|Ga0315321_10301913 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
3300032277|Ga0316202_10062072 | All Organisms → Viruses | 1742 | Open in IMG/M |
3300032277|Ga0316202_10130939 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
3300034374|Ga0348335_154826 | unclassified Hyphomonas → Hyphomonas sp. | 621 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.29% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 21.08% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.05% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.83% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.63% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.22% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.22% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.41% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.41% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.81% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.20% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.20% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.20% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.20% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.60% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.60% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.60% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.60% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.60% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.60% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.60% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.60% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.60% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.60% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.60% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.60% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.60% |
Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.60% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.60% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.60% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001961 | Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025 | Environmental | Open in IMG/M |
3300001962 | Marine microbial communities from Cocos Island, Costa Rica - GS023 | Environmental | Open in IMG/M |
3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
3300006419 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
3300012969 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
3300020393 | Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054) | Environmental | Open in IMG/M |
3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
3300021792 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Illium_FS922 150_kmer | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022066 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2) | Environmental | Open in IMG/M |
3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
3300029792 | Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052 | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
3300031687 | Marine microbial communities from water near the shore, Antarctic Ocean - #125 | Environmental | Open in IMG/M |
3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
3300031706 | Marine microbial communities from David Island wharf, Antarctic Ocean - #36 | Environmental | Open in IMG/M |
3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_100332285 | 3300000101 | Marine | MAITKVTRTLLSTGIDDQSNATAITIDSSENVGIGNTVASSMD |
DelMOWin2010_101565161 | 3300000117 | Marine | MALTQVSRGLLSTSIVDNGNATAITIDSSENVGIGRAPRVML |
GOS2240_10474921 | 3300001961 | Marine | MTTKVPIELSSTPSIVDGGNATAITIDSSENVGIGSSTINAKL |
GOS2239_10255644 | 3300001962 | Marine | MTTKVPIELSSTPSIVDGGNATAITIDSSENCWNRVID |
GOS2239_10446061 | 3300001962 | Marine | MTTKIPAELSSTPGIADSSNATAITISADENLGVGTTTITNNTLG |
GOS2229_10080134 | 3300001963 | Marine | MALTQVPIELSSTPGIVDNSNATAITIDSSENVGIGSSPAYKLDV |
KVWGV2_109891221 | 3300002242 | Marine Sediment | MTTKIPVELSSTPGIVDGSNATAITIDSSENVGIG |
Ga0066223_11481171 | 3300004461 | Marine | MANTKIPVELSSTPSIVDGGNATAITIDSSENVLVGQTLASSNA |
Ga0074647_10119201 | 3300005611 | Saline Water And Sediment | MALTQVPIELSSTPGIVDNSNATAITIDSSENVGI |
Ga0078893_119368311 | 3300005837 | Marine Surface Water | MANTKIPVELSSTPGIVDNSNATAITIDSSENVGIGTSSIASGGANT |
Ga0070743_102331111 | 3300005941 | Estuarine | MALIKVPKEMGSTPGIVDNSNATAITIDSSENVGI |
Ga0075445_101074002 | 3300006193 | Marine | MALTKTPIELSSTPGIVDNSNATAITIDSSENVTL |
Ga0075448_100408031 | 3300006352 | Marine | MALTKVSRGLLSTGIVDNSNATAITIDSSENVTFAGGVTTTGLAIN |
Ga0075496_10116141 | 3300006419 | Aqueous | MALTKVSRGLLSTGIVDNSTTTAITIDSSENVGIG |
Ga0098048_11290233 | 3300006752 | Marine | MANTKIPAELSSTPGIVDNSNATTITINSSENVGINDIN |
Ga0070749_107835642 | 3300006802 | Aqueous | MAATKVPIELSSTPGIVDNSNATAITIDSSENVGIGTTPSAYNS |
Ga0070754_102414981 | 3300006810 | Aqueous | MALTKIPSELSSTTGIVDNSTATAITIDSNENVGIGTSSP |
Ga0075477_101891652 | 3300006869 | Aqueous | MALTEIPIELSSTPGIVDNSTSTAIIIDASQNVGIGVSPSTKLHLGGAAPLDS |
Ga0070746_103550073 | 3300006919 | Aqueous | MANTKIPVELSSTPSIVDNGDATAITIDSSERVMIGTTDAGYPDFGDSL |
Ga0098060_10514211 | 3300006921 | Marine | MTTKVPVELSSTPGIVDGSNATAITIDSSENVGIGVTPDS |
Ga0075444_101918101 | 3300006947 | Marine | MALTKTPIELSSTPGIVDNSNATAITIDSSENVTLT |
Ga0070745_11428861 | 3300007344 | Aqueous | MASTKVPIELSSTPGIVDNSNATAITIDSNENVALTGG |
Ga0070745_11552393 | 3300007344 | Aqueous | MALTQVPIELSSTPGIVDNSNATAITIDSSENVGIGTNSPNSYSGFT |
Ga0070745_11968832 | 3300007344 | Aqueous | MALTEVPIELSSTPGIIDNSTGTAITIDSSNNTNFADNAKAIF |
Ga0099847_11127811 | 3300007540 | Aqueous | MALTKVSRGLLSTSIVDNGNATAITIDSSENVGIGTSSPVSFGAN |
Ga0099846_12515982 | 3300007542 | Aqueous | MASTKVPIELSSTPGIVDNSNATAITIDSSENVGIGTS |
Ga0105739_11402502 | 3300007954 | Estuary Water | MALTKVSRGLLSTGLVDNSNATAITLNADESATFAGAISVTG |
Ga0099850_10127157 | 3300007960 | Aqueous | MAITKVTRTLLSTGIDDQSNATAITIDSSEQVGIGCSPAKPLDVQSG |
Ga0110931_11483391 | 3300007963 | Marine | MTTKVPIELSSTPGIVDGSNATAITIDSSENVGIGVTPDSEPR |
Ga0075480_100444014 | 3300008012 | Aqueous | MAITKVTRTLLSTGIVDNSNATAITIDSSERVLIGTDSGD |
Ga0075480_101601902 | 3300008012 | Aqueous | MANTKIPVELSSTPGIVDNSNATAITIDSSENVGIGTS |
Ga0115561_12596232 | 3300009440 | Pelagic Marine | MALTKVSRGLISTSIVDNGNATAITIDSSENVSFTGAATFSG |
Ga0115558_11899291 | 3300009449 | Pelagic Marine | MALTEIPKELSSTPSIVDNSTGTAITIDSSNNTNFADNAKAIF |
Ga0115102_103870252 | 3300009606 | Marine | MALTKVSRGLLSTSIEDNGTSTAITIDSSENVGIGAASPS |
Ga0115100_100753081 | 3300009608 | Marine | MALTEIPIELSSTPSIVDGGNATAITIDSSENVTFAGN |
Ga0115012_112650163 | 3300009790 | Marine | MALTKVDKSVSSTPGIVDNSDATAITIDSSENVLIGVTSGSDPLVVS |
Ga0098043_11350381 | 3300010148 | Marine | MTTKVPVELSSTPGIVDGSNATAITIDSSENVGIG |
Ga0151677_10272442 | 3300011258 | Marine | MALTKTPIELSSTPGIVDNSNTTAITIDASENVGIGVTNP |
Ga0129331_10751323 | 3300012524 | Aqueous | MALTEIPIELSSTPGIVDNSNATAITIDSSENVGIGT |
Ga0160422_108518013 | 3300012919 | Seawater | MANTKIPVELSSTPGIVDNSDANAITIDSSENVAIGSSTADAK |
Ga0160423_102739791 | 3300012920 | Surface Seawater | MVTKVDKSVSSTPGIVDNSNATAITITSDENVLIGSSTSIA |
Ga0163180_101482521 | 3300012952 | Seawater | MALTTIPSELSSVSGIADSSDATAITIDSSENIKINQKLSIGT |
Ga0129332_11355742 | 3300012969 | Aqueous | MALTKVSRGLLSTGIVDNSTTTAITIDSSENVGIGTSNPPNC |
Ga0181369_10949721 | 3300017708 | Marine | MALTKVSRGLLSTSIVDNGNATAITIDSSENVGIGTSAVMQD |
Ga0181387_10443263 | 3300017709 | Seawater | MAITKVTRNMLNTGIVDNSNATAITIDSSENVGIG |
Ga0181403_10025121 | 3300017710 | Seawater | MALTKVSRGLLSTSIVDNGNATAITIDSSENVGIGTSSPSRTFHSL |
Ga0181391_11510041 | 3300017713 | Seawater | MALTKVSRGLLSTGIVDNSNATAITLNADESSTFAGP |
Ga0181404_10316073 | 3300017717 | Seawater | MAITKVTRQLLSTGINDNSNATAITIDSSEDVTLA |
Ga0181390_10999212 | 3300017719 | Seawater | MANTKIPAELSSTPGIIDNSNATAITIDSSENVGIGTGSPS |
Ga0181383_10245144 | 3300017720 | Seawater | MTTKTPIELSSTPSVVDNGNATAITIDSSERVGILQSSPTS |
Ga0181388_10378911 | 3300017724 | Seawater | MTTKIPVELSSTPGIVDGSNATAITINSSEQVGIGTTSPSYK |
Ga0181401_10048498 | 3300017727 | Seawater | MTTKIPVELSSTPGIVDGSNATAITIDSSERVGIG |
Ga0181396_11235502 | 3300017729 | Seawater | MAITKVTRNMLNTGIVDNSNATAITIYSSENVGIGTASPSQTLHT |
Ga0181417_10937521 | 3300017730 | Seawater | MSVTQVPIELSSTPGIVDNSNATAITIDSSENVGIGTSAT |
Ga0187222_11507972 | 3300017734 | Seawater | MTTKVPIELSSTPSIVDGGNATAITIDSSERVGIGTA |
Ga0187218_10969782 | 3300017737 | Seawater | MANTKIPAELSSTPGIIDNSNATAITIDSSENVGIG |
Ga0181428_10311001 | 3300017738 | Seawater | MTTKTPIELSSTPSVVDNGNATAITIDSSENVTVNNGTLTS |
Ga0181428_10509661 | 3300017738 | Seawater | MTTTKVPIELSSTPGIVDGSNATAITIDSSERVGINTSSPNAVLTTDPE |
Ga0181418_10141781 | 3300017740 | Seawater | MTTKIPVELSSTPGIVDGSNATAITIDSSERVGVGN |
Ga0181421_10379002 | 3300017741 | Seawater | MTTKIPVELSSTPGIVDGSNATAITIDSSEQVGIGTASPAQTL |
Ga0181397_10238722 | 3300017744 | Seawater | MALTKVSRGLLSTSIEDNGNATAITIDSSENVGIGTSSPN |
Ga0181397_10382531 | 3300017744 | Seawater | MTTKIPVELSSTPGIVDGSNATAITIDSSERVGIGT |
Ga0181427_100115910 | 3300017745 | Seawater | MANTKIPVELSSTPSIVDNGDATAITIDSSERVGILQ |
Ga0187219_11561891 | 3300017751 | Seawater | MTTKIPVELSSTPGIVDGSNATAITIDSSENVGIGAVPKTTEAGWTN |
Ga0181407_10771591 | 3300017753 | Seawater | MALTTTPIELSSTPSIVDGGNATAITIDSSEFVEFANGASFGV |
Ga0181411_10035467 | 3300017755 | Seawater | MALTEIPIELSSTPSIVDGGNATAITIDSSENIGLGVTNPADYYAE |
Ga0181382_11509502 | 3300017756 | Seawater | MALTKTPIELSSTPSIVDGGNATAITIDSSEFVEFANGA |
Ga0181409_10887403 | 3300017758 | Seawater | MALTDVPVELSSTPSIVDGGNAAAITIDSSENVGIGLSS |
Ga0181410_10128371 | 3300017763 | Seawater | MALTTTPIELSSTPSIVDGGNATAITIDSSENVSLANNLAFIAADGVS |
Ga0181385_11756611 | 3300017764 | Seawater | MAITKVTRTLLSTGIVDNSNATAITIDSSENVGIGVTP |
Ga0181432_12144823 | 3300017775 | Seawater | MALTKIPAYLSSTPSIVDGGNATALTIDSSENITLTGTL |
Ga0181380_10851511 | 3300017782 | Seawater | MAITKVTRTLLSTGIVDNSNATAITIDSSENVGIGV |
Ga0181380_11721061 | 3300017782 | Seawater | MALTKVSRGLLSTSIVDNGNATAITIDSSENVGIGVTSPNAIIE |
Ga0181379_10595903 | 3300017783 | Seawater | MALTDVPVELSSTPSIVDGGNAAAITIDSSENVGIGTI |
Ga0181379_11141532 | 3300017783 | Seawater | MALTKIPSELSSTTGIVDNSNATAITIDSSENVVIGHTSALALECLGKK |
Ga0181424_100314525 | 3300017786 | Seawater | MALTEIPSELSSTPSIVDNGNATAITIDSSERVLIG |
Ga0181424_100372581 | 3300017786 | Seawater | MALTQVPIELSSTPGIVDNSNATAITIDSSENVGIGS |
Ga0181424_104531602 | 3300017786 | Seawater | MALTKVPNELSSTPSIVDGGNATAITIDSSENVLIGQT |
Ga0181607_105824422 | 3300017950 | Salt Marsh | MALTQVPIELSSTPGIVDNSNATAITIDSSENVGIGESNPAEKL |
Ga0181607_106722421 | 3300017950 | Salt Marsh | MALTEVPIELSSTPGIIDNSTGTAITIDSSNNTNFADNTKAIFG |
Ga0181590_109951472 | 3300017967 | Salt Marsh | MALTEVPIELSSTPGIVDNSTGTAITIDSSNNTNFADNVK |
Ga0181576_100566442 | 3300017985 | Salt Marsh | MALTEVPIELSSTPGIVDNSTGTAITIDTSGNVGIGES |
Ga0181563_103914942 | 3300018420 | Salt Marsh | MALTKVSKGLISTSIVDNGNATAITIDSAGSATFSN |
Ga0181591_105929123 | 3300018424 | Salt Marsh | MPRTRIPKELSSTTGIVDNSTATAITIDSSQNVGIGTSSS |
Ga0181562_103389931 | 3300019459 | Salt Marsh | MALTKVSRGLISTSIVDNGNATAITIDSSENVSFTGA |
Ga0181562_105701582 | 3300019459 | Salt Marsh | MALTKTPIELSSTPSIVDNSDGAAITIDINENVTVSQ |
Ga0194029_10962553 | 3300019751 | Freshwater | MASTKVPIELSSTPGIVDNSNATAITIDSSENVGIGTSSPNAY |
Ga0181602_102364131 | 3300020173 | Salt Marsh | MALTKVSRGLLSTSIVDNGNATAITIDSSENVGIGT |
Ga0181603_103771351 | 3300020174 | Salt Marsh | MALTQVPIELSSTPGIVDNSNATAITIDSSENVGIGSTPI |
Ga0211477_100850381 | 3300020374 | Marine | MAITKVPVELSSTTGIVDNSNATAITIDSSENVLIGTTNTTTV |
Ga0211618_101449091 | 3300020393 | Marine | MATTKIPVELSSTPGIVDNSNATAITIDSSENVGIGTT |
Ga0211699_102702111 | 3300020410 | Marine | MTTKVPVELSSTPGIADSSNATAVTITSDEDFLVRQTS |
Ga0211622_102503111 | 3300020430 | Marine | MTTKIPVELSSTPGIVDGSNATAITIDSSENVGIGTT |
Ga0211535_101636261 | 3300020461 | Marine | MANTKVPVELSSTPGIVDNSNATAITIDSSENVGIGTSSPSRQLT |
Ga0206677_102265472 | 3300021085 | Seawater | MAITKVTRTLLSTGIVDNSNATAITIDSSEQVGIGLTNQAN |
Ga0206682_102775153 | 3300021185 | Seawater | MALTKVSRGLLSTGIVDNSNATAITLNADESATFSGTVGV |
Ga0213865_100824943 | 3300021373 | Seawater | MALTQVPIELSSTPGIVDNSNATAITIDSSENVGIGRAPR |
Ga0213865_102354311 | 3300021373 | Seawater | MALTQVSRGLLSTSIVDNGNAMAITIDSSENVGIGT |
Ga0213865_102502931 | 3300021373 | Seawater | MANTKIPVELSSTPGIVDNSNATAITIDSSENVGIGTA |
Ga0213861_102101431 | 3300021378 | Seawater | MALTQVPIELSSTPGIVDNSNATAITIDSSENVGIGTS |
Ga0213868_104315221 | 3300021389 | Seawater | MALTKVSRGLISTSIVDNGNATAITIDSSENVTFAGD |
Ga0213866_100947553 | 3300021425 | Seawater | MANTKIPVELSSTPGIVDNSNATAITIDSSENVGIGT |
Ga0213866_103591972 | 3300021425 | Seawater | MANTKIPVELSSTPGIVDNSNATAITIDSSENVGIG |
Ga0226836_108406302 | 3300021792 | Hydrothermal Vent Fluids | MTTKIPVELSSTPGISDSSDATAITITSAEKVGIGT |
Ga0222717_101173102 | 3300021957 | Estuarine Water | MALTKVSRGLLSTSIVDNGNATAITIDSSDNVTFS |
Ga0222716_100755452 | 3300021959 | Estuarine Water | MANTKIPVELSSTPGIVDNSNATAITIDSSENVGIGGS |
Ga0222716_101124201 | 3300021959 | Estuarine Water | MATQKIDRNMLNTGIVDNSNATAITIDSSEKVGIGTGS |
Ga0222719_101794801 | 3300021964 | Estuarine Water | MANTTIPIELSSTPGIVDNSNATAITIDSSENVGI |
Ga0224902_1006792 | 3300022066 | Seawater | MTTKIPVELSSTPSIVDNGDATAITIDSDEKVGIGTTSP |
Ga0212020_10811271 | 3300022167 | Aqueous | MASTKVPIELSSTPGIVDNSNATAITIDSSENVGIG |
Ga0196903_10101011 | 3300022169 | Aqueous | MALTKVSRGLLSTSIVDNGNATAITIDSSENVGIG |
Ga0196887_10584922 | 3300022178 | Aqueous | MAITKVTRTLLSTGIDDQSNATAITIDSSENVGINN |
Ga0196887_10966152 | 3300022178 | Aqueous | MTTKIPVELSSTPGIVDGSNATAITIDSSERVGIN |
Ga0196899_11738111 | 3300022187 | Aqueous | MASTKVPIELSSTPGIVDNSNATAITIDSSENVALTGGL |
Ga0196899_11819501 | 3300022187 | Aqueous | MALTKVSRGLLSTSIVDNGNATAITIDANENVGIGTNSPNSTAGFTTLTLNNAT |
Ga0196901_10520091 | 3300022200 | Aqueous | MASTKVPIELSSTPGIVDNSNATAITIDSNENVALTGGLTLA |
Ga0255771_11009572 | 3300022900 | Salt Marsh | MALTKVSRGLISTSIVDNGNATAITIDSSENVSFTGAGTFS |
(restricted) Ga0233432_101546401 | 3300023109 | Seawater | MALTKVSRELLNTSIVDNGNATAITIDSSENVGIG |
Ga0255768_101226971 | 3300023180 | Salt Marsh | MASTKVPIELSSTPGIVDNSNATAITIDSSENVGIGT |
Ga0255768_103406511 | 3300023180 | Salt Marsh | MAKTTVPQELSSTPNITDNGTATAITIDSSQNVGIGTSS |
(restricted) Ga0233444_101121731 | 3300024264 | Seawater | MALTKVSRELLNTSIVDNGNATAITIDSSENVGIGT |
Ga0207905_10444862 | 3300025048 | Marine | MALTEIPIELSSTPSIVDGGNATAITIDSSENVTLAGN |
Ga0208791_10338891 | 3300025083 | Marine | MAITKVTRTLLSTGIVDNSNATAITIDSSENVGIG |
Ga0208793_10494391 | 3300025108 | Marine | MTTKVPVELSSTPGIVDGSNATAITIDSSENVGIGIT |
Ga0209232_10265701 | 3300025132 | Marine | MALTQVPIELSSTPGIVDNSNATAITIDSSENVLVGKTSL |
Ga0209336_100899363 | 3300025137 | Marine | MATTKIPQELSSTPGIVDNSNATAVTIDSSENVMVGTTNTNPVG |
Ga0209634_10227193 | 3300025138 | Marine | MANTKIPKELSSTPSIVDNGNATAITIDTSENVTLASGLDVN |
Ga0209634_11196571 | 3300025138 | Marine | MATTKIPQELSSTPGIVDNSNATAVTIDSSENVMVG |
Ga0208660_10479453 | 3300025570 | Aqueous | MALTKTPIELSSTQGIVDNSNATAITIDSSENVGIG |
Ga0209504_10083584 | 3300025621 | Pelagic Marine | MALTKVSRGLISTSIVDNGNATAITIDSSENVSFTG |
Ga0208161_10666712 | 3300025646 | Aqueous | MASTKVPIELSSTPGIVDNSNATAITIDSSENVGIGTSN |
Ga0208161_10732521 | 3300025646 | Aqueous | MASTKVPIELSSTPGIVDNSNATAITIDSSENVGIGTSNP |
Ga0208160_10286703 | 3300025647 | Aqueous | MASTKVPIELSSTPGIVDNSNATAITIDSSENVGIGVTPVSAEGSFLQF |
Ga0208134_10591161 | 3300025652 | Aqueous | MALTKTPIELSSTPSIVDGGNATAITIDSSENVGIG |
Ga0208795_10422801 | 3300025655 | Aqueous | MASTKVPIELSSTPGIVDNSNATAITIDSNENVALTGGLT |
Ga0208427_12117491 | 3300025771 | Aqueous | MALTEIPIELSSTPGIVDNSTSTAIIIDASQNVGIGVSPSTKLHLGGA |
Ga0208543_10961042 | 3300025810 | Aqueous | MALTEIPIELSSTPGIVDNSTSTAIIIDASQNVGIGVSPSTKLHLG |
Ga0208785_10908372 | 3300025815 | Aqueous | MALTKVTRNLLSTGIDDQSTSTAITIDSSGNVGIGN |
Ga0208917_11821001 | 3300025840 | Aqueous | MASTKVPIELSSTPGIVDNSNATAITIDSSENVAL |
Ga0208645_10246213 | 3300025853 | Aqueous | MALTKVSRGLLSTSIVDNGNATAITIDANENVGIG |
Ga0208645_11352102 | 3300025853 | Aqueous | MALTQVSRGLLSTSIVDNGNATAITIDANENVGIGTS |
Ga0209119_11886632 | 3300025860 | Pelagic Marine | MALTKVSRGLISTSIVDNGNATAITIDSSENVSFTGAATFSGN |
Ga0208544_103912832 | 3300025887 | Aqueous | MALTKVSRGLLSTGIVDNSTTTAITIDSSENVGIGTS |
Ga0208644_10485902 | 3300025889 | Aqueous | MALTEIPIELSSTPGIVDNSTSTAITIDSSGNVGIGTSSPD |
Ga0209929_10283483 | 3300026187 | Pond Water | MAKTTVPIELSSTPSIVDNGNATAITIDSSQNVGIGT |
Ga0209830_101814543 | 3300027791 | Marine | MALTEIPIELSSTPSIVDNGNATAITIDSSERVSINTTSATELLNV |
Ga0209302_103386971 | 3300027810 | Marine | MALTKVSRGLLSTGIVDNSNATAITLNADESATFAGNVGIGNSNST |
Ga0209578_105356201 | 3300027820 | Marine Sediment | MALTKVSRGLLSTSIVDNGNATAITIDANENVGIGG |
Ga0209092_100534871 | 3300027833 | Marine | MALTEIPSELSSTPSIVDGGNATAITIDSSENVLVNRTSV |
Ga0209092_100632505 | 3300027833 | Marine | MALTKVSRGLLSTGIVDNSNATAITIDSSENIGLGLVPTDFA |
Ga0256368_10227162 | 3300028125 | Sea-Ice Brine | MALTEIPIELSSTPSIVDGGNATAITISSAELVTVANG |
Ga0183826_10227172 | 3300029792 | Marine | MATTKIPVELSSTPGIVDNSNATAITIDSSENTTFA |
Ga0307488_103192551 | 3300031519 | Sackhole Brine | MALTKIPIELSSTPSIVDGGNATAITIDSSEGVAF |
Ga0302126_101268093 | 3300031622 | Marine | MALTKVSRGLLSTGIVDNSNATAITLNADESATFAGNVGI |
Ga0307986_103783042 | 3300031659 | Marine | MALTKTPIELSSTPGIVDSSNATAITIDSSENVGIGTSSPRATLDL |
Ga0308008_10777613 | 3300031687 | Marine | MALTKVVKHLSSTPSIVDEGNATAITINNSEEVTFAD |
Ga0308016_103667241 | 3300031695 | Marine | MALTKVVKHLSSTPSIVDEGNATAITINNSEEVTFADDIFVL |
Ga0307997_102650921 | 3300031706 | Marine | MALTKTPIELSSTPGIVDNSNATAITIDSSENVGIGTSPAT |
Ga0315326_109750201 | 3300031775 | Seawater | MALIKIPKEMGSTPGIVDNSNATAITIDSSENVGIGRTSIAQPSSGATTL |
Ga0315320_102461402 | 3300031851 | Seawater | MALTEIPIELSSTPGIVDNSNATAITIDSSENVGIGTSTP |
Ga0315320_104154862 | 3300031851 | Seawater | MANTKIPAELSSTPGIIDNSNATAITIDSSENVGIGTSPSTKLH |
Ga0315330_102557491 | 3300032047 | Seawater | MTTKIPAELSSTPSIVDNGDATAITIDSSENIGIGTTSPA |
Ga0315321_103019132 | 3300032088 | Seawater | MALTKTPIELSSTPGIVDNSNATAITIDSSERVLIG |
Ga0316202_100620721 | 3300032277 | Microbial Mat | MALTKTPIELSSTPSIVDGGNATAITIDDSENVTLAG |
Ga0316202_101309392 | 3300032277 | Microbial Mat | MAITKVTRTLLSTGIVDNSNATAITIDSSENVGIGLTNQ |
Ga0348335_154826_501_620 | 3300034374 | Aqueous | MAKTTVPIELSSTPSIVDNGNATAITIDSSENVGINNASP |
⦗Top⦘ |