NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F038429

Metagenome Family F038429

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F038429
Family Type Metagenome
Number of Sequences 166
Average Sequence Length 41 residues
Representative Sequence VVEFRTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDVS
Number of Associated Samples 110
Number of Associated Scaffolds 166

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.33 %
% of genes near scaffold ends (potentially truncated) 77.71 %
% of genes from short scaffolds (< 2000 bps) 83.13 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.542 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.494 % of family members)
Environment Ontology (ENVO) Unclassified
(35.542 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.217 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.94%    β-sheet: 11.59%    Coil/Unstructured: 72.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 166 Family Scaffolds
PF04392ABC_sub_bind 3.01
PF08708PriCT_1 2.41
PF07681DoxX 1.20
PF09261Alpha-mann_mid 1.20
PF00483NTP_transferase 1.20
PF03401TctC 0.60
PF00072Response_reg 0.60
PF00106adh_short 0.60
PF03795YCII 0.60
PF05239PRC 0.60
PF00581Rhodanese 0.60
PF03734YkuD 0.60
PF04430DUF498 0.60
PF01741MscL 0.60
PF13545HTH_Crp_2 0.60
PF00486Trans_reg_C 0.60
PF13701DDE_Tnp_1_4 0.60
PF07045DUF1330 0.60
PF03695UPF0149 0.60
PF01135PCMT 0.60
PF01970TctA 0.60
PF01381HTH_3 0.60
PF02776TPP_enzyme_N 0.60
PF06577EipA 0.60
PF13304AAA_21 0.60
PF13560HTH_31 0.60
PF13709DUF4159 0.60
PF01255Prenyltransf 0.60
PF02518HATPase_c 0.60
PF04326AlbA_2 0.60
PF08241Methyltransf_11 0.60
PF01391Collagen 0.60
PF03144GTP_EFTU_D2 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 166 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 3.01
COG0383Alpha-mannosidaseCarbohydrate transport and metabolism [G] 1.20
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 1.20
COG4270Uncharacterized membrane proteinFunction unknown [S] 1.20
COG0020Undecaprenyl pyrophosphate synthaseLipid transport and metabolism [I] 0.60
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.60
COG1504Uncharacterized conserved protein, DUF498 domainFunction unknown [S] 0.60
COG1784TctA family transporterGeneral function prediction only [R] 0.60
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.60
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.60
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.60
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.60
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.60
COG2865Predicted transcriptional regulator, contains HTH domainTranscription [K] 0.60
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.60
COG3079Uncharacterized conserved protein YgfB, UPF0149 familyFunction unknown [S] 0.60
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.60
COG3333TctA family transporterGeneral function prediction only [R] 0.60
COG3737Uncharacterized protein, contains Mth938-like domainFunction unknown [S] 0.60
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.60
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.54 %
UnclassifiedrootN/A14.46 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig1234259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7776Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101449217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria814Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101462528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium955Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10059989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria976Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10074497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria730Open in IMG/M
3300000955|JGI1027J12803_103941171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria975Open in IMG/M
3300000956|JGI10216J12902_101584467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300000956|JGI10216J12902_112413217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria692Open in IMG/M
3300004281|Ga0066397_10020948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium971Open in IMG/M
3300004479|Ga0062595_100476011All Organisms → cellular organisms → Bacteria → Proteobacteria928Open in IMG/M
3300005174|Ga0066680_10314393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1000Open in IMG/M
3300005332|Ga0066388_101196029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1299Open in IMG/M
3300005332|Ga0066388_101632650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1136Open in IMG/M
3300005332|Ga0066388_107627439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300005436|Ga0070713_100622431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1027Open in IMG/M
3300005445|Ga0070708_101603273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria606Open in IMG/M
3300005467|Ga0070706_100282081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1550Open in IMG/M
3300005555|Ga0066692_10253092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1112Open in IMG/M
3300005713|Ga0066905_101194314All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300005713|Ga0066905_101892885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria552Open in IMG/M
3300005713|Ga0066905_102216878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300005713|Ga0066905_102264644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300005764|Ga0066903_101341553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1339Open in IMG/M
3300005764|Ga0066903_103464644All Organisms → cellular organisms → Bacteria → Proteobacteria851Open in IMG/M
3300005764|Ga0066903_104172478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria773Open in IMG/M
3300005764|Ga0066903_104920986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria709Open in IMG/M
3300005764|Ga0066903_105522342All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005764|Ga0066903_107008639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300005764|Ga0066903_107388169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300005764|Ga0066903_107749618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria552Open in IMG/M
3300005764|Ga0066903_109167656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300006028|Ga0070717_10474837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1129Open in IMG/M
3300006028|Ga0070717_11163480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria702Open in IMG/M
3300006032|Ga0066696_10917499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300006163|Ga0070715_10900271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300006175|Ga0070712_101674534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria557Open in IMG/M
3300006847|Ga0075431_102010857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300007076|Ga0075435_102046617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300009100|Ga0075418_11179886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria830Open in IMG/M
3300009792|Ga0126374_10609637All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300010046|Ga0126384_10256882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1415Open in IMG/M
3300010046|Ga0126384_10608235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria958Open in IMG/M
3300010047|Ga0126382_10457311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1014Open in IMG/M
3300010047|Ga0126382_10816903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria797Open in IMG/M
3300010047|Ga0126382_10925081Not Available757Open in IMG/M
3300010047|Ga0126382_11145459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria693Open in IMG/M
3300010321|Ga0134067_10124760All Organisms → cellular organisms → Bacteria → Proteobacteria900Open in IMG/M
3300010360|Ga0126372_10023083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. S83722Open in IMG/M
3300010360|Ga0126372_10028226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3464Open in IMG/M
3300010361|Ga0126378_11591617Not Available742Open in IMG/M
3300010361|Ga0126378_13322803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300010362|Ga0126377_10024266All Organisms → cellular organisms → Bacteria → Proteobacteria5035Open in IMG/M
3300010376|Ga0126381_103001655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria670Open in IMG/M
3300010398|Ga0126383_11388267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria792Open in IMG/M
3300010398|Ga0126383_12828523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300010398|Ga0126383_12875449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria562Open in IMG/M
3300010398|Ga0126383_13376638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis521Open in IMG/M
3300012199|Ga0137383_10089177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2233Open in IMG/M
3300012199|Ga0137383_10819500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria679Open in IMG/M
3300012201|Ga0137365_10024249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4694Open in IMG/M
3300012201|Ga0137365_11079509Not Available579Open in IMG/M
3300012202|Ga0137363_10758753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria822Open in IMG/M
3300012211|Ga0137377_11095099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales727Open in IMG/M
3300012211|Ga0137377_11440271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria616Open in IMG/M
3300012211|Ga0137377_11469907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria608Open in IMG/M
3300012354|Ga0137366_11070724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria556Open in IMG/M
3300012355|Ga0137369_10903532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300012356|Ga0137371_10309378All Organisms → cellular organisms → Bacteria → Proteobacteria1230Open in IMG/M
3300012356|Ga0137371_10642486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae813Open in IMG/M
3300012361|Ga0137360_10458240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1081Open in IMG/M
3300012929|Ga0137404_10810654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria851Open in IMG/M
3300012948|Ga0126375_10507867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium900Open in IMG/M
3300012948|Ga0126375_11788773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria536Open in IMG/M
3300012948|Ga0126375_12045219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300012961|Ga0164302_11793794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria518Open in IMG/M
3300012971|Ga0126369_10820180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1013Open in IMG/M
3300012971|Ga0126369_11273925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium825Open in IMG/M
3300012971|Ga0126369_13232264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300012984|Ga0164309_10177813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1443Open in IMG/M
3300012988|Ga0164306_10074927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2134Open in IMG/M
3300016294|Ga0182041_10935290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria781Open in IMG/M
3300016294|Ga0182041_11493433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria622Open in IMG/M
3300016319|Ga0182033_11290523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria656Open in IMG/M
3300016341|Ga0182035_10091071All Organisms → cellular organisms → Bacteria → Proteobacteria2207Open in IMG/M
3300016341|Ga0182035_10335574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1251Open in IMG/M
3300016341|Ga0182035_10492699All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300016357|Ga0182032_10966731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria726Open in IMG/M
3300016357|Ga0182032_11272170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300016371|Ga0182034_10207311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1520Open in IMG/M
3300016371|Ga0182034_10594767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria933Open in IMG/M
3300016387|Ga0182040_10195522All Organisms → cellular organisms → Bacteria → Proteobacteria1482Open in IMG/M
3300016445|Ga0182038_10459820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1079Open in IMG/M
3300016445|Ga0182038_11714023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria566Open in IMG/M
3300018073|Ga0184624_10486174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300018469|Ga0190270_11145048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria813Open in IMG/M
3300020580|Ga0210403_11340688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300021560|Ga0126371_10900723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1028Open in IMG/M
3300025910|Ga0207684_10270366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1466Open in IMG/M
3300025915|Ga0207693_10646041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria822Open in IMG/M
3300025916|Ga0207663_11630418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria519Open in IMG/M
3300026277|Ga0209350_1109698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria643Open in IMG/M
3300026325|Ga0209152_10419726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300026538|Ga0209056_10318307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1055Open in IMG/M
3300026551|Ga0209648_10493874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium716Open in IMG/M
3300027161|Ga0208368_105662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium loti662Open in IMG/M
3300027874|Ga0209465_10046081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2080Open in IMG/M
3300027909|Ga0209382_12203321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria521Open in IMG/M
3300031572|Ga0318515_10161730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1195Open in IMG/M
3300031572|Ga0318515_10221026All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300031573|Ga0310915_10128947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1733Open in IMG/M
3300031573|Ga0310915_11089073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria555Open in IMG/M
3300031679|Ga0318561_10297143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium883Open in IMG/M
3300031681|Ga0318572_10166419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1278Open in IMG/M
3300031713|Ga0318496_10651085All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300031720|Ga0307469_11350321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria678Open in IMG/M
3300031723|Ga0318493_10357446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria795Open in IMG/M
3300031724|Ga0318500_10042556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1890Open in IMG/M
3300031736|Ga0318501_10639823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales585Open in IMG/M
3300031763|Ga0318537_10395611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300031771|Ga0318546_11318629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300031777|Ga0318543_10563731Not Available510Open in IMG/M
3300031780|Ga0318508_1231657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300031781|Ga0318547_10873540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300031793|Ga0318548_10424434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria651Open in IMG/M
3300031795|Ga0318557_10452169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria590Open in IMG/M
3300031819|Ga0318568_10764841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria600Open in IMG/M
3300031821|Ga0318567_10231596Not Available1035Open in IMG/M
3300031880|Ga0318544_10008541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. S83161Open in IMG/M
3300031890|Ga0306925_10736398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1028Open in IMG/M
3300031894|Ga0318522_10063891Not Available1321Open in IMG/M
3300031896|Ga0318551_10347314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium839Open in IMG/M
3300031897|Ga0318520_10273292All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300031910|Ga0306923_11425310Not Available728Open in IMG/M
3300031946|Ga0310910_10050037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2940Open in IMG/M
3300031946|Ga0310910_10261955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1354Open in IMG/M
3300031947|Ga0310909_10262145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens1445Open in IMG/M
3300031947|Ga0310909_10769241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria797Open in IMG/M
3300032001|Ga0306922_10111099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2907Open in IMG/M
3300032001|Ga0306922_11397688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300032025|Ga0318507_10335139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria659Open in IMG/M
3300032054|Ga0318570_10309886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria718Open in IMG/M
3300032059|Ga0318533_10769090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria707Open in IMG/M
3300032066|Ga0318514_10784473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300032076|Ga0306924_12403183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium manausense531Open in IMG/M
3300032090|Ga0318518_10457211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria654Open in IMG/M
3300032180|Ga0307471_102839691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300032261|Ga0306920_100029805All Organisms → cellular organisms → Bacteria7769Open in IMG/M
3300033289|Ga0310914_11130765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria684Open in IMG/M
3300033290|Ga0318519_10272454Not Available985Open in IMG/M
3300033290|Ga0318519_10387654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria830Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.49%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil16.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil11.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.41%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.41%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.20%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.20%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.20%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.60%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027161Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_026014502124908045SoilMMARTSYIVEFRTAEGEALAISIPGSEAAVIRHFQERMPYGLFVPDVP
INPhiseqgaiiFebDRAFT_10144921723300000364SoilVIEFMTTEGNVLAISIPRTEAHVIRHFQERMPYGLFVPDLALE*
INPhiseqgaiiFebDRAFT_10146252823300000364SoilVVEFRTAAGEALAISIPRTETAMVKHFQERMPYGLFVPDLV*
AF_2010_repII_A1DRAFT_1005998923300000597Forest SoilRTAAGEALAISIPRSEASVVRYFQERTPYGLFVPEVT*
AF_2010_repII_A001DRAFT_1007449733300000793Forest SoilAAGEALAISIPASETGVIRHFQERMPYGLFVPDTP*
JGI1027J12803_10394117133300000955SoilTYIVEFKTAADEALAISIPEAAVIQHFQERMPYGLFVPDVSDSR*
JGI10216J12902_10158446713300000956SoilDGTYVVEFRTAGETLAISIPRTEAAVTRHFQERMPYGLFVPDVDAGAI*
JGI10216J12902_11241321733300000956SoilMTCPAPFYLVEFRTAAGESLAISIPRTEAAVIRHFQERMPYGLFVPDVP*
Ga0066397_1002094823300004281Tropical Forest SoilMEFKAAAGEALAISIPRAEAPVIRYLHARMLHGLVVPDVP*
Ga0062595_10047601133300004479SoilGTYVIEFRTAAGESLAISIPGTEAAVIRHFQERMPYGLFVPDVDSGVE*
Ga0066680_1031439313300005174SoilKNDGTYIVEFRTAEGKTLAISIPRTETAVIRHFQERMPYGLFVPDVP*
Ga0066388_10119602923300005332Tropical Forest SoilVVEFKTAEGETLAISIPRTETGVIQHFQERISYGLFMPEH*
Ga0066388_10163265033300005332Tropical Forest SoilYIVEFRTAAGEALAISIPGGEARVIRHFQERMPYGLFVPDVP*
Ga0066388_10762743913300005332Tropical Forest SoilDGTYVVEFRTAAGEALAISIPATETRVIRHFQDRMRYGLFVSDVP*
Ga0070713_10062243133300005436Corn, Switchgrass And Miscanthus RhizosphereMATYVIEFKTAAGEVLAISIPRTETAVIRHFQERMPYGLFVPDIP*
Ga0070708_10160327313300005445Corn, Switchgrass And Miscanthus RhizosphereRTSVGESLAISIRRTEAAVIRHFQERMPYGLYVPDVHESG*
Ga0070706_10028208113300005467Corn, Switchgrass And Miscanthus RhizosphereLSNLAMADGEALAISIPIIETAVIRHFQGRMPYGLFVPDVNAI*
Ga0066692_1025309213300005555SoilYIVEFRTAEGKTLAISIPRTETAVIRHFQERMPYGLFVPDAP*
Ga0066704_1057232833300005557SoilQEPDHDFRPEEDGTYVVEFKTAAGEALAISIPRTECAVTGLFVPDVEAT*
Ga0066905_10119431413300005713Tropical Forest SoilKAAAGEALAISIPRTEAPMIRYFRARMPYGLVVPDVP*
Ga0066905_10189288513300005713Tropical Forest SoilMVEFRTAAGEALAISIPRNEAAVIRHFQERMPYGLFVPEVE*
Ga0066905_10221687813300005713Tropical Forest SoilKDDGTYIVAAAGEALAISIPRNEASVIRHFQERMPYGLFVPDVP*
Ga0066905_10226464423300005713Tropical Forest SoilYIVEFRTAAGEALAISITRSEASVVRYFQERMPYGLFVPDIP*
Ga0066903_10134155333300005764Tropical Forest SoilFRTAAGEALAISIPRTEASVVRHFQERMPYGLFVPDVP*
Ga0066903_10346464413300005764Tropical Forest SoilGEALAISIPRGETAVIRHFQERMPYGLFVPEVLSE*
Ga0066903_10417247813300005764Tropical Forest SoilVVEFRTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDVS*
Ga0066903_10492098623300005764Tropical Forest SoilMEFKAAAGEALAISIPRTEAPVIRYFQARMPYGLVVPDVL*
Ga0066903_10552234223300005764Tropical Forest SoilDGTYVVEFRTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDVEAGAI*
Ga0066903_10700863913300005764Tropical Forest SoilTARKTTGHVVEFRTGAGEALAISIPRSEASVIRHFQERMPYGLFVPDVP*
Ga0066903_10738816923300005764Tropical Forest SoilTAAGEALAISIPRTEAAVIRYFQERMPYGLFVPDAEPQ*
Ga0066903_10774961823300005764Tropical Forest SoilLQAPTAAGEALAISIPRAEAPVIRYFQARMPYGLVVPDVP*
Ga0066903_10916765623300005764Tropical Forest SoilGTYVVEFRTAAGEALAISIPRNEAGVIRHFQERMPYGLFVPDVP*
Ga0070717_1047483733300006028Corn, Switchgrass And Miscanthus RhizosphereDGTYVIEFWRTAGEALAISVPRNEAAVLKHFQERMPYGLFVPDVP*
Ga0070717_1116348023300006028Corn, Switchgrass And Miscanthus RhizosphereAGQALAISIPSTETEVIRHFQERMPHGLFVPEVP*
Ga0066696_1091749913300006032SoilEGESLAITIPRTEAAVIKHFQARMPYGPILPDGPLEVGD*
Ga0070715_1090027123300006163Corn, Switchgrass And Miscanthus RhizosphereVEFKTADGEELAISVPRNETAVLKHFQERIPYGLFVPDAPGNL*
Ga0070712_10167453433300006175Corn, Switchgrass And Miscanthus RhizosphereAGEALAISISRTETAVIRHFQERMPYGLFVLDVP*
Ga0075431_10201085723300006847Populus RhizosphereIVEFRTAAGEALAISIPNSETAVLKHFQERMPYGLFVPDVDQP*
Ga0075435_10204661713300007076Populus RhizosphereVEFRTADGEALAISIPRSEAHVIRHFQERMPYGLFVPEVPTS*
Ga0075418_1117988613300009100Populus RhizosphereGTHVVEFMTSKGDALSISIPRNETAVIKHFQERMRYGLFVPDVTAF*
Ga0126374_1060963723300009792Tropical Forest SoilMEFKAAAGEALAISIPRAEAPVIRYLQTRMPHGLVVPDVP*
Ga0126384_1025688213300010046Tropical Forest SoilRTAQGAVLAISIPRTEAAVIRHFQERMPYGLFVPDTEPQ*
Ga0126384_1060823513300010046Tropical Forest SoilMAIVEFKTAAGEALAISIPRAEASVIRHFQEVMPYGLFVPDVP*
Ga0126382_1045731113300010047Tropical Forest SoilDDGTYVVEFKTAADEVLAISAPGGEARVIRHFQERVPYGLFVPEVA*
Ga0126382_1081690323300010047Tropical Forest SoilDGTYVVEFRTESAVLAISIPRTEAAVVRHFQERMPYGLFVPDVP*
Ga0126382_1092508113300010047Tropical Forest SoilVNTRIVEFKTANGALAISIPRTECAVIRHFQERMPHGLVVQDVS*
Ga0126382_1114545913300010047Tropical Forest SoilTYVVEFRTAAGEALAISIPRTEDGVIRHFQERMPYGLFVPDVP*
Ga0126382_1147094823300010047Tropical Forest SoilMANETPAISIPRTEAAVVRHFKERMPYGLFVPDVN
Ga0134067_1012476033300010321Grasslands SoilEGEALAISIPRTEAAVIRHFQSKMPYGLVVPDVKPDTDR*
Ga0126372_1002308313300010360Tropical Forest SoilRTAEGESLAISIPRTETAVIRHFQERMPHGLLFVPDVL*
Ga0126372_1002822653300010360Tropical Forest SoilAGKALAISIPRTETAVIRHFQERMPYGLFVPEVPSE*
Ga0126378_1159161713300010361Tropical Forest SoilAGEALAISIPRTEAGVIRHFQERMPYGLFVPDVP*
Ga0126378_1244403423300010361Tropical Forest SoilPDDTYVIEFKTADGQTLAISMPRGEWVVLKHFQERMPYGLFVPDIQ*
Ga0126378_1332280313300010361Tropical Forest SoilAAGEALAISIPGSDAGVIRHFQERMPYGLFVPDVS*
Ga0126377_1002426613300010362Tropical Forest SoilTAAGKALAISIPRTETAVIRHFQERMPYGLFVPEVPSE*
Ga0126381_10300165523300010376Tropical Forest SoilAGEALAISIPRTEASVVRYFQERMPYGLFVPDVA*
Ga0126383_1138826713300010398Tropical Forest SoilDGTYVVEFRTAAGEALAISIPRTETAVIRYFQERMPYGLFVADVTDATA*
Ga0126383_1282852313300010398Tropical Forest SoilISIPRTEAAVIRHFQERMPYGLFVPDEPNLGETQ*
Ga0126383_1287544923300010398Tropical Forest SoilVEFKTAAGATLAISIPRTEADVVRHFQERMPYGLFVPDMNAI*
Ga0126383_1337663823300010398Tropical Forest SoilEFRTAAGEALAISIPRSEASVIRHFQERMPYGLFVPDVP*
Ga0137383_1008917733300012199Vadose Zone SoilVVEFRTAEGDALAISIPRTEAHVIWHFQEWMPYGVLVLDVNAVE*
Ga0137383_1081950013300012199Vadose Zone SoilGEALAISIPRGETAVIRHFQERMPYGLFVPDVSVG*
Ga0137365_1002424913300012201Vadose Zone SoilVVDRTAAGEALAILIPRVECAVIRHFQERMPYGLFVPDVP*
Ga0137365_1107950923300012201Vadose Zone SoilRAWALAISIPRSEAAVIRHFQERVPYGLVVPEAP*
Ga0137363_1075875313300012202Vadose Zone SoilAGEALAISIPRSEGGGDPAHFQERMPYGLFVPDVPS*
Ga0137399_1034082223300012203Vadose Zone SoilAEGDALAISIPRTEAAVIRHFQAKMPYELVVPDVKAD*
Ga0137379_1055383413300012209Vadose Zone SoilMKPAAGEALAISIPRNEAGVIRHFQERMPYGLFVPDVP*
Ga0137377_1109509933300012211Vadose Zone SoilFRTADGDVLTISIPGTEAAVIRHFQERMPYGLFVPDADVFGS*
Ga0137377_1144027123300012211Vadose Zone SoilMTSEGDVLAISIPRTEVHVIRHFQERMPYSLFVPDVPMSL*
Ga0137377_1146990733300012211Vadose Zone SoilMKPAAGEALAISIPRNEAGVIRHFQERMPYGLFVP
Ga0137366_1107072413300012354Vadose Zone SoilFRTAAGEPLAISIPGTEAAVIRHFQERMPYGLFVPDVDSGVE*
Ga0137369_1090353213300012355Vadose Zone SoilPKNDGTYVVECITATGEVLAISIPRSEVHVIRYFQERMPYGLFVPDDVT*
Ga0137369_1107277213300012355Vadose Zone SoilDGESLAISVPGSEGAVIRYFQERMPYGLFVPDAA*
Ga0137371_1030937833300012356Vadose Zone SoilLVEFRTAAGESLAISIPRTEAAVIRHFKERMPYGLFVPDVNAG*
Ga0137371_1064248623300012356Vadose Zone SoilGGEALAISIPRTEAAVIRHFQERMPYGLFVPDVNAI*
Ga0137360_1045824013300012361Vadose Zone SoilFRTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDVDTSK*
Ga0137390_1018291813300012363Vadose Zone SoilWQLRFEFRTSVGESLAISIRRTEAAVIHHFQERMPYGLYVPNVHESG*
Ga0137404_1081065423300012929Vadose Zone SoilVIEFRTAAGESLAISIPGTEAAVIRHFQERMPYGLFVPDVDSGVE*
Ga0126375_1050786713300012948Tropical Forest SoilAAGATLAISIPRTEADVVRHFQERMPYGLFVPDIP*
Ga0126375_1178877323300012948Tropical Forest SoilYVVEFRTAAGEALAISIPGGEARVIRYFQERMPYGLFVPDVL*
Ga0126375_1204521923300012948Tropical Forest SoilPKSDGTYVEFRTAAGEALAISVPRNEAAVIRHFQERMPYGLFVPDVP*
Ga0164302_1179379413300012961SoilRTAAGEALAISIPGTEAAVIRHFQARMPYGLVVPDAD*
Ga0126369_1027211413300012971Tropical Forest SoilMANETPAISIPRTEAAVVRHFKERMPYGLFVPDVNAI*
Ga0126369_1082018013300012971Tropical Forest SoilIVEFKTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDVP*
Ga0126369_1127392513300012971Tropical Forest SoilAGEALAISIPRTETAVIRHFQERMPYGLFVPEVP*
Ga0126369_1323226413300012971Tropical Forest SoilTYVVEFRTSDGETLAISIPRTECAVVRHFQERMPYGLFVPDVDPQ*
Ga0164309_1017781313300012984SoilAGDALAISIPRSEVSVIRHFQERMPYGLFVPEVET*
Ga0164306_1007492733300012988SoilAEGDVLAISTPRSEAAMLRHFQERMPYGLCVPDVAM*
Ga0182041_1093529013300016294SoilYIVEFRTAAGEALAISIPRTEAAVVRHFQERMPYGLFVPDVP
Ga0182041_1149343323300016294SoilFRTAAGEALAISIPRSEASVVRYFQERMPYGLFVPDIS
Ga0182033_1129052313300016319SoilFRTAAGEALAISIPRTEAAVARHFQERMPYGLFVPDVP
Ga0182035_1009107113300016341SoilRTAEGAVLAISIPRSEAALIQHFQERMPYGLFVPDVNSGA
Ga0182035_1011549053300016341SoilGEALAISIPRTEAAVIRHFQERMPYGLFVPDAEPR
Ga0182035_1033557413300016341SoilPKDDGTYIVEFRTAAGEALAISIPRSEASVIRHFQERMPYGLFVPDVP
Ga0182035_1049269923300016341SoilDDGTYVVEFRTAASAVLAISIPRTETAVIRYFQERMPYGLFVPDAP
Ga0182032_1096673123300016357SoilTYIVEFRTAAGEALAISIPRTEAAVVRHFQERMPYGLFVPDVP
Ga0182032_1127217013300016357SoilDDGTYIVEFRTAAGEALAISIPRTEAAVARHFQERMPYGLFVPDVP
Ga0182034_1020731113300016371SoilKTDGTYVVEFRTAEGEALAISIPRTETAVIRHFQERMPYGLFVPDMNAI
Ga0182034_1059476723300016371SoilYVIEFKAAAGEALAILIPRTETAVVRHFQERMPYGLFVPDIP
Ga0182040_1019552243300016387SoilTAEGEALAISIPRTETAVIRHFQERMPYGLFVPDMNAI
Ga0182038_1045982013300016445SoilKTDGTYVVEFRTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDEP
Ga0182038_1171402323300016445SoilRTAAGEALAISIPRSEASVVRYFQERMPYGLFVPDIS
Ga0184624_1048617413300018073Groundwater SedimentLGLLLLAAGEALAISIPRTEAAVIRYFQERMPYGLFVPEVL
Ga0190270_1114504823300018469SoilDGTFVIEFMTSAGEALAISIPASEARVARHFQERIPYGLFVPDVSMD
Ga0210403_1134068823300020580SoilMASDGTYIVEFRTAAGEALAISIPRTEATVIRHFQARMPYGLVVRDIDNR
Ga0126371_1090072323300021560Tropical Forest SoilYIVEFRTAAGEALAISIPRSEASVVRYFQERMPYGLFVPDIP
Ga0207684_1014865813300025910Corn, Switchgrass And Miscanthus RhizosphereGEALAISIPIIETAVIRHFQGRMPYGLFVPDVNAI
Ga0207684_1027036633300025910Corn, Switchgrass And Miscanthus RhizosphereMATYVIEFKTAAGEVLAISIPRTETAVIRHFQERMPYGLFVPDIP
Ga0207693_1064604113300025915Corn, Switchgrass And Miscanthus RhizosphereMRGKNRIVVQFRTAEGDMLAISIPRSETAVIRHFQERMPYGLFVPDVQP
Ga0207663_1163041823300025916Corn, Switchgrass And Miscanthus RhizosphereRTAAGEALAISIPRTECAVIRHFQERMPYGLFVPDLNKP
Ga0207646_1111245313300025922Corn, Switchgrass And Miscanthus RhizosphereTDDTYVIEFRTAAGEALAISVPRNETAVLKHFQERMPYELFVPDVP
Ga0209350_110969823300026277Grasslands SoilIEFRTAAGESLAISIPGTEAAVIRHFQERMPYGLFVPDVDSGVE
Ga0209152_1041972623300026325SoilETYVVEFRTAAGEALAISIPIIETAVIRHFQGRMPYGLFVPVNAI
Ga0209056_1031830713300026538SoilETYVVEFRTAAGEALAISIPIIETAVIRHFQGRMPYGLFVPDVNAI
Ga0209648_1049387423300026551Grasslands SoilYVVEFRTAAGEVLAISIPRGETAVLKHFQERMPYGLFVPDVNPDADP
Ga0208368_10566223300027161Forest SoilRTAAGEALAISIPGGEARVIRHFQERMPYGLFVPDVP
Ga0209465_1004608123300027874Tropical Forest SoilMEFKAAAGEALAISIPRAEAPVIRYLHARMLHGLVVPDVP
Ga0209465_1051611523300027874Tropical Forest SoilMGVALAISIPRTEAAVIRHFQERMPYGLFVPDARLV
Ga0209382_1220332123300027909Populus RhizospherePTADGEELAISAPRNETAVLKHFQERIPYGLFVPDAPGNL
Ga0318515_1016173013300031572SoilSRTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDVT
Ga0318515_1022102623300031572SoilFRTAASAVLAISIPRTETAVIRYFQERMPYGLFVPDAP
Ga0310915_1012894713300031573SoilTAAGEALAISIPRSEASVIRHFQERMPYGLSVPDVP
Ga0310915_1108907323300031573SoilKDDGAYIVEFRTAAGEALAISIPRSEAVVRYFQERMPYGLFVPDIS
Ga0318561_1029714323300031679SoilTYVVEFRTAAGEALAISLPASETRVIRHFQERMPSGLFVPDTP
Ga0318561_1044720923300031679SoilPKTDGTYVVEFRTAEGEALAISIPRTETAVIRHFQERMPYGLFVPDMNAI
Ga0318561_1080919713300031679SoilMGAALAISIPRTEAAAIRHFRERMPYGLFVPDARLV
Ga0318572_1016641943300031681SoilTYVVEFRTAAGEALAISIPRTEAAVIRHFHERMPYGLFVPDVNGV
Ga0318496_1065108523300031713SoilYVVEFRTAAGEALAISIPRTETAVIRHFQERMQYGLFVPDAP
Ga0307469_1135032113300031720Hardwood Forest SoilEFRTAAGEALAISIPRTECAVIRHFQERMPYGLFVPDLNKP
Ga0318493_1035744613300031723SoilTYVVEFRTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDEP
Ga0318500_1004255653300031724SoilEFRTAAGEALAISIPRSEASVVRYFQERMPYGLFVPDIS
Ga0318501_1063982323300031736SoilRTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDAEPR
Ga0318537_1039561113300031763SoilFKTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDVNAI
Ga0318546_1131862913300031771SoilRASDGESLAISIPRTECAVIRHFQDRMPYGLVVPDLP
Ga0318543_1056373113300031777SoilVIEFRTAGGDSLAISIPRTEAAVIRHFQTWMPYGLVVPDVDAAK
Ga0318508_123165723300031780SoilMTYVVEFRTAAGEALAISLPASETRVIRHFQERMPSGLFVPD
Ga0318547_1087354023300031781SoilGTYIVEFRTAAGEALAISIPRTEAAVIRHFQERMPYGLFVPDAEPR
Ga0318548_1042443423300031793SoilIVEVRTAAGEALAISIPRSEASVIRHFQERMPYGLFVPDIS
Ga0318557_1045216913300031795SoilAAGEALAISIPRTETAVIRHFQERMPYGLFVPDEP
Ga0318568_1076484113300031819SoilTDGTYVVEFRTAAGAELAISIPRSEAAVIQHFQERMPYGLFVPDEP
Ga0318567_1023159633300031821SoilIVEFRTAAGEALAITIPRTECAVIRHFQERMPYGLFVPDVP
Ga0306919_1009502233300031879SoilMGVALAISIPRTEAAAIRHFRERMPYGLFVPDARLV
Ga0318544_1000854113300031880SoilAEGESLAISIPRTETAVIRHFQERMPHGLFVPDVL
Ga0306925_1073639813300031890SoilKDDGTYIVEFRTAAGEALAISIPRTEAAVVRHFQERMPYGLFVPDVP
Ga0318522_1006389123300031894SoilFRTALGESLAISIPGNEAGVIRHFQERMPYGLFVPDVP
Ga0318551_1034731413300031896SoilTYVVEFRTAAGESLAISLPASETRVIRHFQERMPSGLFVPDTP
Ga0318520_1027329213300031897SoilGTYVVEFRTAEGEVLAISIPTTETAVIRHFQERMPYGLSVPDEP
Ga0306923_1142531023300031910SoilLAFGAATYVIEFKTVAGEALAISIPRTEAAVIRHFQARMPYSLIVPDAD
Ga0310910_1005003753300031946SoilMEFKAAAGEALAISIPRAEAPVIRYLQARMPHGLVVPDVP
Ga0310910_1026195513300031946SoilTYIVEFRTAAGEALAISIPRSEASVVRYFQERMPYGLFVPDIP
Ga0310909_1026214533300031947SoilTNGTYVVEFRTAQGAVLAISIPRTEAAVIRHFQERMPYGLFVPDEP
Ga0310909_1076924133300031947SoilTPPVPVGEALAISIPRTEAAVIKYFQERMPHGLVVPDG
Ga0310909_1125036323300031947SoilMGVALAISIPRTEAAVIRHFQERMPYGLFVPDARL
Ga0306922_1011109913300032001SoilTYIVEFRTADGEALAISIPGGEARVIRHFQERMPYGLFVPDVP
Ga0306922_1139768813300032001SoilTYIVEFRTAEGEVLAISIPRTETAVIRHFQKRMPYGLFVPDEPRRTA
Ga0318507_1033513913300032025SoilGTYVVEFRTAAGEALAISIPRTEAAVIRHFHERMPYGLFVPDVNGV
Ga0318570_1030988623300032054SoilTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDEP
Ga0318533_1076909023300032059SoilTAAGEALAISIPRTEAAVARHFQERMPYGLFVPDVP
Ga0318514_1078447313300032066SoilVEFKTAAGEALAISIPRTETAVIRHFQERMPYGLFVPDVDAGAFGKK
Ga0306924_1240318313300032076SoilTSEGDVLAISIPRTETAVIRHFQERMPYGLFVPDNAI
Ga0318518_1045721113300032090SoilYVVEFRTAAGEALAISIPRTEAAVIRHFHERMPYGLFVPDVNGV
Ga0307471_10283969113300032180Hardwood Forest SoilVDFRTAEGEALAISIPRTEAAVIRHFQSKMPYGLVVPDVKPDTDR
Ga0306920_100029805133300032261SoilMTYVVEFRTAAGEALAISLPASETRVIRHFQERMPSGLFVPDTP
Ga0310914_1113076523300033289SoilDDGAYIVEFRTAAGEALAISIPRSEAVVRYFQERMPYGLFVPDIS
Ga0318519_1027245413300033290SoilVEFRTAQGAVLAISIPRTEAAVIRHFQERMPYGLFVPDEP
Ga0318519_1038765423300033290SoilFRTAAGKALAITIPRTECAVIRHFQERMPYGLFVPDVP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.