Basic Information | |
---|---|
Family ID | F039060 |
Family Type | Metagenome |
Number of Sequences | 164 |
Average Sequence Length | 43 residues |
Representative Sequence | VKSAHRVRADERESVALVLEGRGKTVRFVAEPHEIVTILVT |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 164 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.83 % |
% of genes near scaffold ends (potentially truncated) | 96.95 % |
% of genes from short scaffolds (< 2000 bps) | 82.93 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.561 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.488 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 17.39% Coil/Unstructured: 78.26% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 164 Family Scaffolds |
---|---|---|
PF00528 | BPD_transp_1 | 23.78 |
PF02230 | Abhydrolase_2 | 6.10 |
PF12695 | Abhydrolase_5 | 3.66 |
PF12697 | Abhydrolase_6 | 3.05 |
PF03959 | FSH1 | 3.05 |
PF07969 | Amidohydro_3 | 2.44 |
PF00496 | SBP_bac_5 | 1.83 |
PF01738 | DLH | 1.83 |
PF08544 | GHMP_kinases_C | 0.61 |
PF09261 | Alpha-mann_mid | 0.61 |
PF10282 | Lactonase | 0.61 |
PF00288 | GHMP_kinases_N | 0.61 |
PF00561 | Abhydrolase_1 | 0.61 |
COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
---|---|---|---|
COG0400 | Predicted esterase | General function prediction only [R] | 3.05 |
COG0383 | Alpha-mannosidase | Carbohydrate transport and metabolism [G] | 0.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002560|JGI25383J37093_10040141 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300002562|JGI25382J37095_10091607 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300002562|JGI25382J37095_10170150 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 682 | Open in IMG/M |
3300002562|JGI25382J37095_10200277 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300002909|JGI25388J43891_1022418 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300002911|JGI25390J43892_10139673 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
3300004019|Ga0055439_10017829 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300005166|Ga0066674_10004735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5252 | Open in IMG/M |
3300005180|Ga0066685_10373471 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300005440|Ga0070705_100427706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 987 | Open in IMG/M |
3300005444|Ga0070694_101164032 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300005447|Ga0066689_10733986 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
3300005450|Ga0066682_10025250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3416 | Open in IMG/M |
3300005471|Ga0070698_101070470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 754 | Open in IMG/M |
3300005540|Ga0066697_10794779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 514 | Open in IMG/M |
3300005545|Ga0070695_100050264 | All Organisms → cellular organisms → Bacteria | 2671 | Open in IMG/M |
3300005553|Ga0066695_10826466 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
3300005555|Ga0066692_10813658 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300005555|Ga0066692_11036080 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
3300005557|Ga0066704_10018496 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4063 | Open in IMG/M |
3300005557|Ga0066704_10776108 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 597 | Open in IMG/M |
3300005574|Ga0066694_10236611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 865 | Open in IMG/M |
3300005576|Ga0066708_10215191 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300005586|Ga0066691_10012015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4070 | Open in IMG/M |
3300006797|Ga0066659_10092007 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
3300006797|Ga0066659_10454511 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300006797|Ga0066659_10753660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 801 | Open in IMG/M |
3300006806|Ga0079220_10044081 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
3300006845|Ga0075421_102346756 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
3300006852|Ga0075433_10930424 | All Organisms → cellular organisms → Bacteria → FCB group | 758 | Open in IMG/M |
3300006854|Ga0075425_101471996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 769 | Open in IMG/M |
3300006871|Ga0075434_101847810 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 610 | Open in IMG/M |
3300006871|Ga0075434_102582694 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
3300006914|Ga0075436_101030218 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300007764|Ga0102950_1234816 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300007788|Ga0099795_10088863 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300007788|Ga0099795_10531223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
3300009012|Ga0066710_100084426 | All Organisms → cellular organisms → Bacteria | 4161 | Open in IMG/M |
3300009012|Ga0066710_103633286 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300009012|Ga0066710_103869441 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
3300009012|Ga0066710_104362830 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
3300009137|Ga0066709_100226211 | All Organisms → cellular organisms → Bacteria | 2482 | Open in IMG/M |
3300009137|Ga0066709_101117186 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300009147|Ga0114129_11190882 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300009610|Ga0105340_1127591 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300010301|Ga0134070_10139438 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 864 | Open in IMG/M |
3300010303|Ga0134082_10354849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 621 | Open in IMG/M |
3300010304|Ga0134088_10125052 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300010304|Ga0134088_10161630 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1067 | Open in IMG/M |
3300010304|Ga0134088_10302104 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 773 | Open in IMG/M |
3300010320|Ga0134109_10024224 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300010322|Ga0134084_10391430 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
3300010326|Ga0134065_10485686 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
3300010329|Ga0134111_10113754 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1048 | Open in IMG/M |
3300010329|Ga0134111_10529477 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
3300010335|Ga0134063_10555603 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
3300010336|Ga0134071_10513496 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300010361|Ga0126378_11124642 | All Organisms → cellular organisms → Bacteria → FCB group | 885 | Open in IMG/M |
3300010401|Ga0134121_13089214 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300010403|Ga0134123_11313635 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 759 | Open in IMG/M |
3300011271|Ga0137393_10248132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1510 | Open in IMG/M |
3300011428|Ga0137456_1022236 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300011443|Ga0137457_1312606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 536 | Open in IMG/M |
3300012096|Ga0137389_11809891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 506 | Open in IMG/M |
3300012198|Ga0137364_11157072 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 581 | Open in IMG/M |
3300012200|Ga0137382_10107127 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
3300012200|Ga0137382_11157961 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
3300012200|Ga0137382_11283900 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
3300012200|Ga0137382_11337262 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
3300012201|Ga0137365_10360548 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1074 | Open in IMG/M |
3300012204|Ga0137374_10182189 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1832 | Open in IMG/M |
3300012207|Ga0137381_10153438 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
3300012208|Ga0137376_10116551 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
3300012208|Ga0137376_11665176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
3300012209|Ga0137379_10778254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 862 | Open in IMG/M |
3300012210|Ga0137378_10046860 | All Organisms → cellular organisms → Bacteria | 3879 | Open in IMG/M |
3300012211|Ga0137377_10236508 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
3300012211|Ga0137377_11296036 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 658 | Open in IMG/M |
3300012211|Ga0137377_11539031 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
3300012226|Ga0137447_1030581 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300012349|Ga0137387_10199809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1435 | Open in IMG/M |
3300012349|Ga0137387_11310278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
3300012356|Ga0137371_10457276 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 987 | Open in IMG/M |
3300012356|Ga0137371_10477492 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300012357|Ga0137384_10661788 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300012359|Ga0137385_10607521 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 919 | Open in IMG/M |
3300012361|Ga0137360_11645435 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
3300012683|Ga0137398_10825734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 648 | Open in IMG/M |
3300012922|Ga0137394_10021620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5164 | Open in IMG/M |
3300012925|Ga0137419_10046975 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
3300012927|Ga0137416_10368876 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300012929|Ga0137404_11460472 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 632 | Open in IMG/M |
3300012972|Ga0134077_10003700 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4572 | Open in IMG/M |
3300012972|Ga0134077_10028325 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
3300012972|Ga0134077_10089267 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300012972|Ga0134077_10274880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 702 | Open in IMG/M |
3300012972|Ga0134077_10454493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
3300012976|Ga0134076_10011852 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
3300014314|Ga0075316_1218026 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
3300015241|Ga0137418_10104211 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
3300015264|Ga0137403_10485856 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300015264|Ga0137403_10890397 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 740 | Open in IMG/M |
3300015356|Ga0134073_10001894 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4140 | Open in IMG/M |
3300015357|Ga0134072_10037500 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
3300015357|Ga0134072_10270961 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 620 | Open in IMG/M |
3300015358|Ga0134089_10495563 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
3300017654|Ga0134069_1102765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 932 | Open in IMG/M |
3300017654|Ga0134069_1226587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 644 | Open in IMG/M |
3300017657|Ga0134074_1312073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 574 | Open in IMG/M |
3300018071|Ga0184618_10397251 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300018076|Ga0184609_10391817 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300018433|Ga0066667_11748707 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300018482|Ga0066669_10784331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 843 | Open in IMG/M |
3300019789|Ga0137408_1252930 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
3300020020|Ga0193738_1074083 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300020170|Ga0179594_10119334 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300021080|Ga0210382_10041279 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
3300021080|Ga0210382_10049094 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
3300022756|Ga0222622_10527473 | All Organisms → cellular organisms → Bacteria → FCB group | 846 | Open in IMG/M |
3300024325|Ga0247678_1096616 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
3300024330|Ga0137417_1461008 | All Organisms → cellular organisms → Bacteria | 5073 | Open in IMG/M |
3300025319|Ga0209520_10443887 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300025551|Ga0210131_1102050 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300025885|Ga0207653_10097633 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1036 | Open in IMG/M |
3300025910|Ga0207684_10957504 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300025917|Ga0207660_10748946 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 797 | Open in IMG/M |
3300025922|Ga0207646_10009684 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 9498 | Open in IMG/M |
3300026277|Ga0209350_1019073 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
3300026296|Ga0209235_1234447 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300026306|Ga0209468_1189848 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 519 | Open in IMG/M |
3300026307|Ga0209469_1017554 | All Organisms → cellular organisms → Bacteria | 2559 | Open in IMG/M |
3300026307|Ga0209469_1031054 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
3300026310|Ga0209239_1044979 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
3300026310|Ga0209239_1170817 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 833 | Open in IMG/M |
3300026310|Ga0209239_1358131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
3300026313|Ga0209761_1184604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 941 | Open in IMG/M |
3300026313|Ga0209761_1305751 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 550 | Open in IMG/M |
3300026317|Ga0209154_1222728 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 704 | Open in IMG/M |
3300026323|Ga0209472_1051668 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
3300026323|Ga0209472_1260962 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
3300026325|Ga0209152_10012184 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2976 | Open in IMG/M |
3300026326|Ga0209801_1017242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3599 | Open in IMG/M |
3300026330|Ga0209473_1164991 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 883 | Open in IMG/M |
3300026342|Ga0209057_1000899 | All Organisms → cellular organisms → Bacteria | 25128 | Open in IMG/M |
3300026523|Ga0209808_1028135 | All Organisms → cellular organisms → Bacteria | 2728 | Open in IMG/M |
3300026523|Ga0209808_1192052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 696 | Open in IMG/M |
3300026524|Ga0209690_1011844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4635 | Open in IMG/M |
3300026527|Ga0209059_1010956 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4095 | Open in IMG/M |
3300026537|Ga0209157_1119976 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300026537|Ga0209157_1327014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 555 | Open in IMG/M |
3300026538|Ga0209056_10677729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
3300026540|Ga0209376_1113743 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300026548|Ga0209161_10125741 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300027573|Ga0208454_1037066 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300027576|Ga0209003_1107025 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
3300027587|Ga0209220_1097562 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300027633|Ga0208988_1153112 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
3300027748|Ga0209689_1154840 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300031576|Ga0247727_10447897 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1022 | Open in IMG/M |
3300031740|Ga0307468_100191906 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300031740|Ga0307468_102315306 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
3300031962|Ga0307479_10962509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 824 | Open in IMG/M |
3300032783|Ga0335079_10672835 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300032829|Ga0335070_10746121 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 15.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.27% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.27% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.05% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.83% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.83% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.22% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.22% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.22% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.22% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.22% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.61% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.61% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.61% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.61% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007764 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25383J37093_100401411 | 3300002560 | Grasslands Soil | RFGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEIVTVLVT* |
JGI25382J37095_100916071 | 3300002562 | Grasslands Soil | NGVKTAHHVRADEREAVALVLEQRGNIVRFVAEPHEIVSILVT* |
JGI25382J37095_101701501 | 3300002562 | Grasslands Soil | GAWRFGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEIVTILVT* |
JGI25382J37095_102002771 | 3300002562 | Grasslands Soil | GVKSAHRVRADERESLALVLEGRGQRVRFVAGPHEIVTILVT* |
JGI25388J43891_10224182 | 3300002909 | Grasslands Soil | VKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
JGI25390J43892_101396732 | 3300002911 | Grasslands Soil | WRFGAGIKTAHRVRADEREAVALVLEQRGRIVRFVAEPHEIVSILVT* |
Ga0055439_100178291 | 3300004019 | Natural And Restored Wetlands | WRFGAAVRAAYRVRADERESVPLVLEDRGRAVRFTAGPHEIVTLMVE* |
Ga0066674_100047351 | 3300005166 | Soil | GAWRFTEGVKSAHRVRADERESQALVLEHRGRTLRFVAKPYEIVTIQIT* |
Ga0066685_103734713 | 3300005180 | Soil | AWRFGNGVKTAHRVRADEREAVALVLEQRGNIVRFVAEPHEIVSILVT* |
Ga0070705_1004277061 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AGAWRFGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0070694_1011640322 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | RTVHRVRADERESVPLVLEGRGKRVRFVAEPHEIVTLLVT* |
Ga0066689_107339861 | 3300005447 | Soil | SVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0066682_100252505 | 3300005450 | Soil | AGAWRFGEGVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0070698_1010704702 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AWRFGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0066697_107947792 | 3300005540 | Soil | FGEGVKSAHRVRADERESVALVLEGRGKTVRFTAEPREIVTILVT* |
Ga0070695_1000502644 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | SAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0066695_108264661 | 3300005553 | Soil | TAHRVRADEREAVALVLEQRGNVVRFVAEPYEIVSILVT* |
Ga0066692_108136582 | 3300005555 | Soil | VWRFGDTVKSAHRVRADERESTALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0066692_110360801 | 3300005555 | Soil | AGAWRFGEGVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0066704_100184965 | 3300005557 | Soil | VKSAHRVRADERESTALVLEGRGKVVRFTAQPHELVTILVT* |
Ga0066704_107761082 | 3300005557 | Soil | KTAHRVRADEREAVALVLEQRGNIVRFVAEPHEIVSILVT* |
Ga0066694_102366112 | 3300005574 | Soil | WRFGEGVKSAHRVRADERESTALVLEGRGKTVRFVAEPHELVTILVT* |
Ga0066708_102151911 | 3300005576 | Soil | RFAEGVKSAHRVRADERESTALVLEGRGKVVRFTAEPHEIVTILVT* |
Ga0066691_100120151 | 3300005586 | Soil | DGVKSAHRVRADERESTALVLEGRGKVVRFTAQPHELVTILVT* |
Ga0066659_100920071 | 3300006797 | Soil | KSAHRVRADERESTALVLEGRGKVVRFTAEPQEVVTILVT* |
Ga0066659_104545113 | 3300006797 | Soil | RVRADERESTALVLEGRGKVVRFTAEPHELVTILVT* |
Ga0066659_107536602 | 3300006797 | Soil | ESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0079220_100440814 | 3300006806 | Agricultural Soil | ERVVGAWRLPDTIRTAHRVRADEKSAEPLVVEGRGHTVRFIAEPYEIVTLLIT* |
Ga0075421_1023467562 | 3300006845 | Populus Rhizosphere | AGAWHFGTGVKTAHRVRADEREAVALVLEQRGNVVRFVAEPRELVSIMVT* |
Ga0075433_109304241 | 3300006852 | Populus Rhizosphere | GVKSAHRVRADERESIALVLEQRGNVVRFVAEPHEVVTILVT* |
Ga0075425_1014719962 | 3300006854 | Populus Rhizosphere | GVKTAHRVRADEREAVALVLEQRGNVVRFVAEPHEIVSILVT* |
Ga0075434_1018478102 | 3300006871 | Populus Rhizosphere | KSAHRVRADERESVSLVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0075434_1025826941 | 3300006871 | Populus Rhizosphere | TAHRVRADEREAVALVLEQRGNLVRFVAEPHEIVSILVT* |
Ga0075436_1010302182 | 3300006914 | Populus Rhizosphere | AHRVRADEREAQGLVIENRGRTVRFLAEPHEIVTILIT* |
Ga0102950_12348161 | 3300007764 | Soil | TAHRVRADERESRELTVEIRGKTVRFLAEPHEIVTLLVT* |
Ga0099795_100888633 | 3300007788 | Vadose Zone Soil | VRADERESVALVLEQRGNVVRFVAEAHEIVTILVT* |
Ga0099795_105312231 | 3300007788 | Vadose Zone Soil | AHRVRADEREAVALVLEQRGNIVRFVAEPHEIVSILVT* |
Ga0066710_1000844265 | 3300009012 | Grasslands Soil | SAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT |
Ga0066710_1036332861 | 3300009012 | Grasslands Soil | AWRFSEGVKTAHRVRADERDSQGLLLEHRGRTLRFVAKPYEIITIQIT |
Ga0066710_1038694412 | 3300009012 | Grasslands Soil | SVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT |
Ga0066710_1043628302 | 3300009012 | Grasslands Soil | AGDLVKSAHRVRADERESVALVLEGRGQTVRFTAEPHEIVTILVT |
Ga0066709_1002262114 | 3300009137 | Grasslands Soil | VKSAHRVRADERESTALVLEGRGKTVRFVAEPYEIVTILVT* |
Ga0066709_1011171861 | 3300009137 | Grasslands Soil | AHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0114129_111908823 | 3300009147 | Populus Rhizosphere | VRADEREAVALVLEQRGNLVRFVAEPHEIVSVLVT* |
Ga0105340_11275911 | 3300009610 | Soil | HRVRADERESTPLVLEGRGHRVRFVAEPHEIVTILVT* |
Ga0134070_101394381 | 3300010301 | Grasslands Soil | RFGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTIFVT* |
Ga0134082_103548491 | 3300010303 | Grasslands Soil | AHRVRADERESTALVLEGRGKVVRFTAEPHELVTILVT* |
Ga0134088_101250523 | 3300010304 | Grasslands Soil | FGDGVKSAHRVRADERESLALVLEGRGQRVRFVAGPHEIVTILVT* |
Ga0134088_101616303 | 3300010304 | Grasslands Soil | GVKSAHRVRADERESTALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0134088_103021042 | 3300010304 | Grasslands Soil | RVRADERESLALVLEGRGQTVRFVAEPHEVVTILVT* |
Ga0134109_100242244 | 3300010320 | Grasslands Soil | GGEAVKSAHRVRADERESLALVLEGRGQTVRFVAEPHEVVTILVT* |
Ga0134084_103914301 | 3300010322 | Grasslands Soil | AGAWRFAQGVKTAHRVRADEREAVALVLEQRGNVVRFVAEPHEIVSILVT* |
Ga0134065_104856862 | 3300010326 | Grasslands Soil | WRFGEGVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0134111_101137541 | 3300010329 | Grasslands Soil | KSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0134111_105294772 | 3300010329 | Grasslands Soil | VRADERESTALVLEGRGKTVRFAAEPHEIVTILVT* |
Ga0134063_105556031 | 3300010335 | Grasslands Soil | GAWRFAQGVKTAHRVRADEREAVALVLEQRGNVVRFVAEPHEIVSLLVT* |
Ga0134071_105134962 | 3300010336 | Grasslands Soil | WSFGGSEGVKSAHRVRADERESMALVLEGRGKTVRFAAEPHEVVTILVT* |
Ga0126378_111246421 | 3300010361 | Tropical Forest Soil | RDERVVGAWRLPDAIKTAHRVRADEKAAEPLVVEGRGHTVRFIAEAHEIVTLLIT* |
Ga0134121_130892142 | 3300010401 | Terrestrial Soil | GGTWRFGEGVRSAHRVRADERESAPLALEARGRILRFVAEPHQIVTILVT* |
Ga0134123_113136352 | 3300010403 | Terrestrial Soil | HRVRADEREAVALVLEQRGNVVRFVAEPHEIVSIMVT* |
Ga0137393_102481323 | 3300011271 | Vadose Zone Soil | KSAHRVRADERESVALVLEGRGKTVRFIAEPHEIVTILVT* |
Ga0137456_10222363 | 3300011428 | Soil | GAWRFGEGIRTAHRVRADERESTPLVLEGRGHRVRFVAEPHEIVTILVT* |
Ga0137457_13126062 | 3300011443 | Soil | GAWRFGHGVKTAHRVRADEREAVALVLEQRGNIVRFVAEPHEIVSILVT* |
Ga0137389_118098912 | 3300012096 | Vadose Zone Soil | HRVRADERDSVALVLESRGRTVRFLAGPREIVTILVT* |
Ga0137364_111570722 | 3300012198 | Vadose Zone Soil | VRADEREAVAIVLEQRGNVVRFVAEPHEIVSIMVT* |
Ga0137382_101071274 | 3300012200 | Vadose Zone Soil | RADERESTALVLEGRGKVVRFAAEPHEMVTILVT* |
Ga0137382_111579612 | 3300012200 | Vadose Zone Soil | FGDGVKNAHRVRADERESVALVLEQRGHVVRFVAEPHEIVTILVT* |
Ga0137382_112839002 | 3300012200 | Vadose Zone Soil | KTAHRVRADEREAVALVLEQRGNVVRFVAEPHEIVSILVT* |
Ga0137382_113372621 | 3300012200 | Vadose Zone Soil | FGEGVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0137365_103605481 | 3300012201 | Vadose Zone Soil | KSAHRVRADERESVALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0137374_101821891 | 3300012204 | Vadose Zone Soil | KSAHRVRADERESVALVLEGRGKTVRFAAEPHEIVTILVT* |
Ga0137381_101534381 | 3300012207 | Vadose Zone Soil | DTVKSAHRVRADERESTALVLEGRGKTVRFVAEPHEIVTILVI* |
Ga0137376_101165511 | 3300012208 | Vadose Zone Soil | ADGVKSAHRVRADERDSTALVLEGRGKVVRFTAEPYELVTILVT* |
Ga0137376_116651761 | 3300012208 | Vadose Zone Soil | GAWRFGESVKSAHRVRADERESVALVLEGRGKTVRFIAEPHEIVTILVT* |
Ga0137379_107782543 | 3300012209 | Vadose Zone Soil | AHRVRADERESVPVVLENRGRVVRFSAGPHEVVTILVS* |
Ga0137378_100468605 | 3300012210 | Vadose Zone Soil | VKSAHRVRADERESTALVLEGRGKTVRFVAEPHEIVTILVI* |
Ga0137377_102365081 | 3300012211 | Vadose Zone Soil | RVRADERESTALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0137377_112960362 | 3300012211 | Vadose Zone Soil | VRADERESTALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0137377_115390312 | 3300012211 | Vadose Zone Soil | WRFGGGADSVKTAHRVRADERESVGLVLEGRGKTVRFTAEPHEIVTILVT* |
Ga0137447_10305811 | 3300012226 | Soil | WRFGDGVKNAHRVRADERESVALVLEQRGRAVRFVAEPHEIVTILVT* |
Ga0137387_101998094 | 3300012349 | Vadose Zone Soil | AWSFGDGVKNAHRVRADEREAVALVLEQRGNVVRFVAEPHELVSILVT* |
Ga0137387_113102781 | 3300012349 | Vadose Zone Soil | GAWRFGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0137371_104572761 | 3300012356 | Vadose Zone Soil | RADERESLALVLEGRGQTVRFTAEPHEIVTILVT* |
Ga0137371_104774921 | 3300012356 | Vadose Zone Soil | AWRFAQGVKTAHRVRADEREAVALVLEQRGNVVRFVAEPHEIVSLLVT* |
Ga0137384_106617883 | 3300012357 | Vadose Zone Soil | VRADEREAVALVLEQRGNIVRFVAEPHEIVSILVT* |
Ga0137385_106075211 | 3300012359 | Vadose Zone Soil | VRSAHRVRADERESAPLVLEARGKTVRFVAEPHEIVTIMVT* |
Ga0137360_116454352 | 3300012361 | Vadose Zone Soil | WRFGESVKSAHRVRADERESVALVLEGRGKTVRFIAEPHEIVTILVT* |
Ga0137398_108257341 | 3300012683 | Vadose Zone Soil | VKTAHRVRADEREAVALILEQRGNVVRFVAEPHEIVSILVT* |
Ga0137394_100216207 | 3300012922 | Vadose Zone Soil | DGVKSAHRVRADERESVALVLEQRGNVVRFVAEPHEIVTILVT* |
Ga0137419_100469751 | 3300012925 | Vadose Zone Soil | RVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0137416_103688761 | 3300012927 | Vadose Zone Soil | RTAHRVRADERESQALVLEHRGRTLRFVAKAYEIVTIQIT* |
Ga0137404_114604722 | 3300012929 | Vadose Zone Soil | RFGEGVKSAHRVRADERESVALVLEGRSKTVRFVAEPYEIVTILVT* |
Ga0134077_100037006 | 3300012972 | Grasslands Soil | FGEGVKSAHRVRADERESTALVLEGRGKTVRFVAEPYEIVTILVT* |
Ga0134077_100283251 | 3300012972 | Grasslands Soil | HRVRADERESTALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0134077_100892671 | 3300012972 | Grasslands Soil | RVRADERESAPLVLEARGKTVRFVAEPHEIVTILVT* |
Ga0134077_102748802 | 3300012972 | Grasslands Soil | AWRFGGGDSVKTAHRVRADERESVALVLEGRGQTVRFVAEPHEIVTILVT* |
Ga0134077_104544932 | 3300012972 | Grasslands Soil | GESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0134076_100118524 | 3300012976 | Grasslands Soil | WRFGEGVKSAHRVRADERESTALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0075316_12180261 | 3300014314 | Natural And Restored Wetlands | AGAWRFGAGVKTAHRVRADEREAVALVLEQRGNVVRFVAEPHEIVSILVT* |
Ga0137418_101042114 | 3300015241 | Vadose Zone Soil | SAHRVRADERESTALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0137403_104858563 | 3300015264 | Vadose Zone Soil | RFGESVKSAHRVRADERESVALVLEGRGKTVRFEAGPHEIVTILVT* |
Ga0137403_108903972 | 3300015264 | Vadose Zone Soil | RFGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT* |
Ga0134073_100018941 | 3300015356 | Grasslands Soil | WRFAEGVKSAHRVRADERESTALVLEGRGKVVRFTAEPHEVVTILVT* |
Ga0134072_100375001 | 3300015357 | Grasslands Soil | ADGVKSAHRVRADERESTALVLEGRGKVVRFAAEPHEMVTILVT* |
Ga0134072_102709611 | 3300015357 | Grasslands Soil | PGAWRFGEGVKSAHRVRADERESTALVLEGRGKTVRFVAEPHEIVTILVT* |
Ga0134089_104955632 | 3300015358 | Grasslands Soil | RFAQGVKTAHRVRADEREAVALVLEQRGNVVRFVAEPHEIVSLLVT* |
Ga0134069_11027651 | 3300017654 | Grasslands Soil | RFGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT |
Ga0134069_12265872 | 3300017654 | Grasslands Soil | KSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTIFVT |
Ga0134074_13120732 | 3300017657 | Grasslands Soil | RFGEGVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT |
Ga0184618_103972512 | 3300018071 | Groundwater Sediment | HRVRADERESAPLVLDGRGQRVRFIAEPHEIVTILVT |
Ga0184609_103918171 | 3300018076 | Groundwater Sediment | TAHRVRADERESQEQVLEQRGKIVRFVAEPHEIVTMLIT |
Ga0066667_117487071 | 3300018433 | Grasslands Soil | HRVRADERESTPLVLEGRGNVVRFVAEPHEIVTILIT |
Ga0066669_107843311 | 3300018482 | Grasslands Soil | SAHRVRADERESTALVLEGRGKVVRFEAGPHEIVTILVT |
Ga0137408_12529303 | 3300019789 | Vadose Zone Soil | AHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT |
Ga0193738_10740831 | 3300020020 | Soil | GAWRFVEPVRSAHRVRADERESTALVLEERGRVARFNAGPRELVTLLVS |
Ga0179594_101193343 | 3300020170 | Vadose Zone Soil | FGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT |
Ga0210382_100412791 | 3300021080 | Groundwater Sediment | VKSAHRVRADERESVALVLEGRGKTVRFTAEPHEIVTILVT |
Ga0210382_100490943 | 3300021080 | Groundwater Sediment | DGVKSAHRVRADERESVALVLEQRGNVVRFVAESHEVVTILVT |
Ga0222622_105274732 | 3300022756 | Groundwater Sediment | GVKSAHRVRADERESVALVLEQRGNVVRFVAEPHEIVTILVT |
Ga0247678_10966162 | 3300024325 | Soil | HRVRADEKEAVALVLEQRGNIVRFVAEPHEIVSIMVT |
Ga0137417_14610082 | 3300024330 | Vadose Zone Soil | VRADERESVALVLEGRGKTVRFVAEAHEIVTILVT |
Ga0209520_104438871 | 3300025319 | Soil | GAWRFGDGIKNAHRVRADERESVALVLEQRGRAVRFVAEPHEIVTILVT |
Ga0210131_11020502 | 3300025551 | Natural And Restored Wetlands | AVRAAYRVRADERESVPLVLEDRGRAVRFTAGPHEIVTLMVE |
Ga0207653_100976333 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VKTAHRVRADEKEAVALVLEQRGNIVRFVAEPHEIVSIMVT |
Ga0207684_109575041 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FGDGVRSAHRVRADERESVALVLEQRGNVVRFVAEPHEIVTILVT |
Ga0207660_107489461 | 3300025917 | Corn Rhizosphere | KTAHRVRADEREAVALVLEQRGNVVRFVAEPHEIVSIMVT |
Ga0207646_100096849 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT |
Ga0209350_10190732 | 3300026277 | Grasslands Soil | VRADERESTALVLEGRGKTVRFVAEPHEIVTILVT |
Ga0209235_12344471 | 3300026296 | Grasslands Soil | AHRVRADERESLALVLEGRGQRVRFVAAPHEIVTILVT |
Ga0209468_11898481 | 3300026306 | Soil | TAHRVRADEHEAVALVLEQRGNVVRFVAEPHEIVSILVT |
Ga0209469_10175541 | 3300026307 | Soil | FTEGVKSAHRVRADERESQALVLEHRGRTLRFVAKPYEIVTIQIT |
Ga0209469_10310543 | 3300026307 | Soil | VRADERESLALVLEGRGQTVRFVAEPHEVVTILVT |
Ga0209239_10449793 | 3300026310 | Grasslands Soil | FGDGVKSAHRVRADERESLALVLEGRGQRVRFVAGPHEIVTILVT |
Ga0209239_11708171 | 3300026310 | Grasslands Soil | VRADERESVALVLEGRGKTVRFVAEPHEIVTILVT |
Ga0209239_13581312 | 3300026310 | Grasslands Soil | SAHRVRADERESVALVLEGRGKTVRFVAEPHEIVTILVT |
Ga0209761_11846041 | 3300026313 | Grasslands Soil | HRVRADERESVALVLEGRGKTVRFVAEPHEVVTIFVT |
Ga0209761_13057512 | 3300026313 | Grasslands Soil | WRFADGVKSAHRVRADERESAPIVLEGRGQVVRFAAEPHEIVTILVT |
Ga0209154_12227282 | 3300026317 | Soil | WRFGEGVKTAHRLRADERESTALVLEQRGRVVRFAAGPHEIVTILVT |
Ga0209472_10516683 | 3300026323 | Soil | VRADERESTALVLEGRGKVVRFTAEPHEMVTILVT |
Ga0209472_12609622 | 3300026323 | Soil | AGAWRFGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTIFVT |
Ga0209152_100121845 | 3300026325 | Soil | AWRFAEGVKSAHRVRADERESTALVLEGRGKVVRFTAEPHEIVTILVT |
Ga0209801_10172421 | 3300026326 | Soil | GESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT |
Ga0209473_11649911 | 3300026330 | Soil | APGAWRFGEGVKSAHRVRADERESTALVLEGRGKTVRFVAEPHEIVTILVT |
Ga0209057_10008995 | 3300026342 | Soil | VKSAHRVRADERESTALVLEGRGKVVRFTAEPHEIVTILVT |
Ga0209808_10281351 | 3300026523 | Soil | VRADERESTALVLEGRGKTVRFVAEPYEIVTILVT |
Ga0209808_11920522 | 3300026523 | Soil | KTAHRVRADEREAVALVLEQRGNVVRFVAEPHEIVSLLVT |
Ga0209690_10118446 | 3300026524 | Soil | VKSAHRVRADERESTALVLEGRGKTVRFVAEPHEIVTILVT |
Ga0209059_10109565 | 3300026527 | Soil | AAGAWRFAEGVKSAHRVRADERESTALVLEGRGKVVRFTAEPHEVVTILVT |
Ga0209157_11199763 | 3300026537 | Soil | GVRSAHRVRADERESAPLVLEARGKTVRFVAEPHEIVTILVT |
Ga0209157_13270142 | 3300026537 | Soil | AWRFGESVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEVVTILVT |
Ga0209056_106777292 | 3300026538 | Soil | GAWRFGEGVKSAHRVRADERESVALVLEGRGKTVRFVAEPHEIVTILVT |
Ga0209376_11137433 | 3300026540 | Soil | HRVRADEREAVALVLEQRGNIVRFVAEPHEIVSILVT |
Ga0209161_101257411 | 3300026548 | Soil | VRADEREAVALVLEQRGNIVRFVAEPHEIVSILVT |
Ga0208454_10370663 | 3300027573 | Soil | HGVKTAHRVRADEREAVALVLEQRGNIVRFVAEPHEIVSILVS |
Ga0209003_11070251 | 3300027576 | Forest Soil | AWRFADGVKSAHRVRADERESTALVLEGRGKVVRFVAEPYEPVTILVT |
Ga0209220_10975621 | 3300027587 | Forest Soil | GEGVRTAHRVRADERESAPLVLEGRGHRIRFVAAPHEIVTILVT |
Ga0208988_11531122 | 3300027633 | Forest Soil | VKSAHRVRADERESVALVLEGRGKTVRFVAEPHEIVTILVT |
Ga0209689_11548401 | 3300027748 | Soil | VRADERESVALVLEGRGKTVRFVAEPHEVVTILVT |
Ga0247727_104478972 | 3300031576 | Biofilm | GTWRFTEGARTAHRVRADERESASLPLEDRGRTLRFEAGPGEIVTILVT |
Ga0307468_1001919061 | 3300031740 | Hardwood Forest Soil | GVRTAQRVRADERESAPLVLEGRGHRVRFLAEPHEIVTILVT |
Ga0307468_1023153062 | 3300031740 | Hardwood Forest Soil | GAWRFGNGVKTAHRVRADEREAVALVLEQRGNIVRFVAEPHEIVSILVT |
Ga0307479_109625092 | 3300031962 | Hardwood Forest Soil | GVKSAHRVRADERESTALVLEGRGKVVRFTAQPHELVTILVT |
Ga0335079_106728351 | 3300032783 | Soil | HRVRADEHEAEPLVVEGRGHTVRFLAEPHEIVTILIT |
Ga0335070_107461211 | 3300032829 | Soil | FSESVHSAHRVRADERESTPVVLEGRGNAVRFVAEPYEIVTMLIT |
⦗Top⦘ |