NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039666

Metagenome / Metatranscriptome Family F039666

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039666
Family Type Metagenome / Metatranscriptome
Number of Sequences 163
Average Sequence Length 213 residues
Representative Sequence MKSAVIALFLGATSAVKMGDAPPYFNEATWNERMPSAGGFLQVSACVNSGVAGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKKGGQRLAQWNPVVVETTGALPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDSVPHYNTDPTAGRPYQTSGDITATSPEATSAHSWPASQTFVQMEAEPVSDEAEKVSVLQTPYGHTHTSFY
Number of Associated Samples 110
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 93.25 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(39.264 % of family members)
Environment Ontology (ENVO) Unclassified
(67.485 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.663 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 12.10%    β-sheet: 5.65%    Coil/Unstructured: 82.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005516|Ga0066831_10076113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium908Open in IMG/M
3300006357|Ga0075502_1558293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani798Open in IMG/M
3300006374|Ga0075512_1213637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300006379|Ga0075513_1302948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300006383|Ga0075504_1322945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300008958|Ga0104259_1021799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300009022|Ga0103706_10067782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani771Open in IMG/M
3300009025|Ga0103707_10083263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300009071|Ga0115566_10267208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1019Open in IMG/M
3300009077|Ga0115552_1164588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300009263|Ga0103872_1015033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani869Open in IMG/M
3300009265|Ga0103873_1038146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani886Open in IMG/M
3300009526|Ga0115004_10265788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1020Open in IMG/M
3300009543|Ga0115099_10826687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani782Open in IMG/M
3300009543|Ga0115099_10968767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300009599|Ga0115103_1287976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300009606|Ga0115102_10711415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani854Open in IMG/M
3300009608|Ga0115100_11054791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani766Open in IMG/M
3300009608|Ga0115100_11181362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani788Open in IMG/M
3300009677|Ga0115104_10030984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300009677|Ga0115104_10715690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300009679|Ga0115105_10088086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani636Open in IMG/M
3300010883|Ga0133547_12136434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1019Open in IMG/M
3300010981|Ga0138316_10795277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani729Open in IMG/M
3300010981|Ga0138316_10975333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300010981|Ga0138316_11176078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300010985|Ga0138326_10781761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300010985|Ga0138326_11188106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300010987|Ga0138324_10156789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1022Open in IMG/M
3300010987|Ga0138324_10324642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300010987|Ga0138324_10329238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300010987|Ga0138324_10420407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300010987|Ga0138324_10527753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300012472|Ga0129328_1129478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani803Open in IMG/M
3300012518|Ga0129349_1066922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300012518|Ga0129349_1209365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300012523|Ga0129350_1124202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani773Open in IMG/M
3300012523|Ga0129350_1249409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani775Open in IMG/M
3300012524|Ga0129331_1129036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani806Open in IMG/M
3300012525|Ga0129353_1842055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300012525|Ga0129353_1855440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani795Open in IMG/M
3300012525|Ga0129353_1872040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani812Open in IMG/M
3300012528|Ga0129352_10619071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani759Open in IMG/M
3300012965|Ga0129346_1214865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300016737|Ga0182047_1268416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani628Open in IMG/M
3300016749|Ga0182053_1056150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300017697|Ga0180120_10142611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1019Open in IMG/M
3300018671|Ga0193571_1017055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300018692|Ga0192944_1024946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani855Open in IMG/M
3300018692|Ga0192944_1025515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani846Open in IMG/M
3300018735|Ga0193544_1014052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani799Open in IMG/M
3300018741|Ga0193534_1036092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani766Open in IMG/M
3300018741|Ga0193534_1040245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani722Open in IMG/M
3300018763|Ga0192827_1037618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani840Open in IMG/M
3300018765|Ga0193031_1029663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani855Open in IMG/M
3300018765|Ga0193031_1030934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani842Open in IMG/M
3300018765|Ga0193031_1038039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani777Open in IMG/M
3300018765|Ga0193031_1040360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300018787|Ga0193124_1028876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani787Open in IMG/M
3300018831|Ga0192949_1057226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300018838|Ga0193302_1047001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani734Open in IMG/M
3300018846|Ga0193253_1068569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani866Open in IMG/M
3300018846|Ga0193253_1082585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300018846|Ga0193253_1085117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani755Open in IMG/M
3300018870|Ga0193533_1061602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani821Open in IMG/M
3300018885|Ga0193311_10034704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani723Open in IMG/M
3300018905|Ga0193028_1056496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300018926|Ga0192989_10081536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300018926|Ga0192989_10093771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani761Open in IMG/M
3300018926|Ga0192989_10094003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300018979|Ga0193540_10120036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300018982|Ga0192947_10130679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani838Open in IMG/M
3300018989|Ga0193030_10092616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani915Open in IMG/M
3300018989|Ga0193030_10093445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium912Open in IMG/M
3300018989|Ga0193030_10104968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani873Open in IMG/M
3300018989|Ga0193030_10125041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani815Open in IMG/M
3300018989|Ga0193030_10126071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani812Open in IMG/M
3300018989|Ga0193030_10130935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani800Open in IMG/M
3300018989|Ga0193030_10140629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani775Open in IMG/M
3300018989|Ga0193030_10143569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani768Open in IMG/M
3300018989|Ga0193030_10196559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300018997|Ga0193257_10145037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani726Open in IMG/M
3300019017|Ga0193569_10221705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300019022|Ga0192951_10123243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani883Open in IMG/M
3300019031|Ga0193516_10141446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium815Open in IMG/M
3300019032|Ga0192869_10210450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani830Open in IMG/M
3300019032|Ga0192869_10251933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani764Open in IMG/M
3300019032|Ga0192869_10333205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300019036|Ga0192945_10123406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300019045|Ga0193336_10229235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300019045|Ga0193336_10330573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300019051|Ga0192826_10160389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani829Open in IMG/M
3300019051|Ga0192826_10175732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani791Open in IMG/M
3300019051|Ga0192826_10201268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300019051|Ga0192826_10283154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300019095|Ga0188866_1017627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani744Open in IMG/M
3300019111|Ga0193541_1034579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani862Open in IMG/M
3300019117|Ga0193054_1059472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300019118|Ga0193157_1014257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani777Open in IMG/M
3300019125|Ga0193104_1021145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani867Open in IMG/M
3300019125|Ga0193104_1027079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300019149|Ga0188870_10083841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani774Open in IMG/M
3300019149|Ga0188870_10084615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300019149|Ga0188870_10084778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300019150|Ga0194244_10022714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani856Open in IMG/M
3300019150|Ga0194244_10023228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani850Open in IMG/M
3300021169|Ga0206687_1342493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani796Open in IMG/M
3300021350|Ga0206692_1365227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani773Open in IMG/M
3300021353|Ga0206693_1595701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani739Open in IMG/M
3300021866|Ga0063109_119087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300021881|Ga0063117_1002771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300021892|Ga0063137_1035914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani728Open in IMG/M
3300021896|Ga0063136_1010656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani782Open in IMG/M
3300021912|Ga0063133_1127682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300021924|Ga0063085_1090809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani629Open in IMG/M
3300021934|Ga0063139_1008068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani785Open in IMG/M
3300021935|Ga0063138_1192419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300021941|Ga0063102_1027458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani787Open in IMG/M
3300023679|Ga0232113_1016231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300023683|Ga0228681_1023060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani721Open in IMG/M
3300023698|Ga0228682_1024103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300025680|Ga0209306_1077195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1019Open in IMG/M
3300026465|Ga0247588_1052439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani803Open in IMG/M
3300026468|Ga0247603_1083976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300026470|Ga0247599_1022446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1320Open in IMG/M
3300026500|Ga0247592_1086434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani759Open in IMG/M
3300026503|Ga0247605_1106472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300027780|Ga0209502_10234116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300028106|Ga0247596_1054732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani890Open in IMG/M
3300028134|Ga0256411_1125585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani859Open in IMG/M
3300028137|Ga0256412_1193319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300028233|Ga0256417_1101283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani776Open in IMG/M
3300028233|Ga0256417_1187705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300028282|Ga0256413_1186336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300028575|Ga0304731_10258243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani729Open in IMG/M
3300028575|Ga0304731_10480552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300028575|Ga0304731_10657394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300028575|Ga0304731_10920058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300030856|Ga0073990_10006350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300030856|Ga0073990_11965774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani721Open in IMG/M
3300030856|Ga0073990_12054698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani766Open in IMG/M
3300030856|Ga0073990_12056821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300031038|Ga0073986_11992276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300031038|Ga0073986_12022092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani767Open in IMG/M
3300031062|Ga0073989_13526352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani699Open in IMG/M
3300031062|Ga0073989_13532196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300031062|Ga0073989_13554963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani662Open in IMG/M
3300031579|Ga0308134_1071862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium788Open in IMG/M
3300031626|Ga0302121_10107054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani818Open in IMG/M
3300031725|Ga0307381_10159025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani776Open in IMG/M
3300031725|Ga0307381_10236360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300031739|Ga0307383_10358799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300031743|Ga0307382_10234468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani818Open in IMG/M
3300032492|Ga0314679_10453243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300032517|Ga0314688_10470026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300032616|Ga0314671_10341912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300032616|Ga0314671_10450309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300032650|Ga0314673_10417337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300032707|Ga0314687_10554164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300032708|Ga0314669_10418741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani734Open in IMG/M
3300032711|Ga0314681_10439798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani732Open in IMG/M
3300032744|Ga0314705_10438532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300032752|Ga0314700_10316886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani823Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine39.26%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.77%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.20%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.59%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.13%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.45%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.84%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.84%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.84%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.23%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.23%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300018671Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018735Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399747-ERR1328127)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021892Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S15 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066831_1007611313300005516MarineMKYTIALFISGAAALRDAPAFYDAKTWTEKMPSAGGFLQISSCLNSNVEGVTCTPANNELFATGNNGDEDMGEDIIMKGDAFHYAQNLAQWNPVVVASTGPLPVCHGNNGPDGVNCAREACTGTNGPMDGPSGTPCTRAEPDAIPHYNTDPVAGRAYQTSGDITRTQPEVTSANAWPASNFVQTEEAPVSDEAEKVSVLQTPYGKGHTTFYAQH*
Ga0075502_155829313300006357AqueousTMKSAVIALFLGATSAVKMNDADPYFNEPTWNERMPSAGGFVQITACVNANATGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYEQRNASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTTGDITKTSPEPTTAHSWPASQSFVQMEEAPVSDEAEKVSVLQTPYGHTHTSFY*
Ga0075512_121363713300006374AqueousMKSAVIALFLGATSAVKMNDADPYFNEPTWNERMPSAGGFVQITACVNANATGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYEQRNASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTTGDITKTSPEPTTAHSWPASQSFVQMEEAPVSDEAEKVSVLQTPYGHTHTSFY*
Ga0075513_130294813300006379AqueousAVIALFLGATSAVKMNDADPYFNEPTWNERMPSAGGFVQITACVNANATGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYEQRNASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTTGDITKTSPEPTTAHSWPASQSFVQMEEAPVSDEAEKVSVLQTPYGHTHTSFY*
Ga0075504_132294513300006383AqueousADPYFNEPTWNERMPSAGGFVQITACVNANATGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYEQRNASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTTGDITKTSPEPTTAHSWPASQSFVQMEEAPVSDEAEKVSVLQTPYGHTHTSFY*
Ga0104259_102179913300008958Ocean WaterVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDAVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY*
Ga0103706_1006778213300009022Ocean WaterKSAVIALFLGATSAVKLGDAPPYFNEPTWTERMPSAGGFVQITACVNSGVAGVTCQPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKSATNLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPAGTPCTKEEPDAVPHYNTDPTAGRPYQTTGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY*
Ga0103707_1008326313300009025Ocean WaterMKSAVIALFLGATSAVKLNDAPPYFNEPTWNERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATSLAQWTPVVVESTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEQPDDIPHYNTDPTAGRPYQTTGDITPTSPEITTAHSWPASQSFVQMKDDAVPSPEAEKVSVLQTPYGHT
Ga0115566_1026720823300009071Pelagic MarineMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDSVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY*
Ga0115552_116458813300009077Pelagic MarineGIIFFIILIKTMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDSVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY*
Ga0103872_101503313300009263Surface Ocean WaterKTMKSGVIALFLGAVTADAPPFFNEPTWNERMPSAGGFLQVNACINSGASGVTCIPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKPKAAALVQWNPVAVESTGPLPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDAIPHYNTDPTAGRPYQTTGDITPTSPEPTTAHSWPASQSLVQMREEPAVPSPEAEKVSVLQTPYGHTHTSFY*
Ga0103873_103814613300009265Surface Ocean WaterEIKTMKSAVIALFLGAVTADAPPFFNEPTWNERMPSAGGFLQVNACINSGASGVTCIPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKPKAAALVQWNPVAVESTGPLPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDAIPHYNTDPTAGRPYQTTGDITPTSPEPTTAHSWPASQSLVQMREEPAVPSPEAEKVSVLQTPYGHTHTSFY*
Ga0115004_1026578823300009526MarineMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPIDGPSGTPCTREEPEAVPSYNTDPQAGRPYQTSGDITKTSPEATSANSWPAAQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY*
Ga0115099_1082668713300009543MarineMKSAVIALFLGATSALKMKDADPYFNEPTWNERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKKASLAQWTPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPKDGPSGTPCTKEQPDSVPHYNTDPTAGRPYQTSGDITATSPEPTTAHSWPASQSLVQVAAEPVSDEAEKVSVLQTPYGHTHTSFY*
Ga0115099_1096876713300009543MarineMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDAVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY*
Ga0115103_128797613300009599MarineMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDAVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY*
Ga0115102_1071141513300009606MarineMKSAVIALFLGATSAIKMQDADPYFNEQTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDAVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY*
Ga0115100_1105479113300009608MarineMKSAVIALFLGATSAVKLNDAPPYFNEPTWTERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEEPEAVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY*
Ga0115100_1118136213300009608MarineQIKTMKSGVIALFLGSAAAIRDAPPFFNEPTWNEKMPSAGGFLQVSSCINAGVAGVTCVPNSQLFATGMNGDEDMGEDIIMKGEPYHYHQKKESSLVQWNPVDVASTGALPNCHGNNGPDGTNCDREVCSGTNGPKDGPSGTPCTREQPAAVPHYNTDPTAGRPYQTSGDITATSPEATSANSWPASQTLVQIKDDAVSAEAEKVSVLQTPYGHTHTSFY*
Ga0115104_1003098413300009677MarineMKSAVIALFLGATSALKMKDADPYFNEPTWNERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKKASLAQWTPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPKDGPSGTPCTKEQPDSVPHYNTDPTAGRPYQTSGDITATSPEATTAHSWPASQSLVQVAAEPVSDEAEKVSVL*
Ga0115104_1071569013300009677MarineVQDAPPYFNEPTWNERMSSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKPQKLVQWNPVVVESTGPLPKCHGNNGPDGVNCDKEVCSGTNGPMDGPSGTPCTREQPDDVPHYNTDPTAGRPYQTSGDITATSPEATSAKSWPASQTFVQLKAEPVSDEAEKVSVLQ
Ga0115105_1008808613300009679MarineNEPTWTERMPSAGGFLQINACLNSGVAGVTCTPANHELFATGMNGDEDLGEDIIMKGEPYHYHQKRENNFVQWNPVVVESTGPLPACHGNNGPDGTNCAREVCSGTNGPVDGPSGTPCTREQPDDIPHYNTDPVAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLNGDEGGKVPDDGAEKVSVLQTPYGHTHTSFY*
Ga0133547_1213643423300010883MarineMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFSTGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPIDGPSGTPCTREEPEAVPSYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY*
Ga0138316_1079527713300010981MarineKTMKSAVIALFLGAVTADAPPYFNEPTWTEKMPSAGGFLQVNACINSGAAGVTCIPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKRESSLVQWNPVDVASTGPLPACHGNNGPDGTNCDREVCSGTNGPMDGPSGTPCTREQPASIPHYNTDVTAGRPYQTSGDITATSPEPTSAHSWPASQTLVQMNAEPVSDEAEKVSVLQTPYGHTHTSFY*
Ga0138316_1097533313300010981MarineAVIALFLGATSAVKMQDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKQSLAQWNPVEVATTGALPACHGNNGPDGVNCARETCSGTNGPVDGPSGTPCTRDEPASIPHYNTDPEAGRPYQTSGDITATSPEATSAHSWPASQTLVQTEDDAVPSAEAEKVSVLQTPYGHTHTSFY*
Ga0138316_1117607813300010981MarineYTVALFISGAAALRDAPAYFNQPTWTERMPSAGGFVQLNSCLSANVDGITCLPGNSELFATGMNGDEDLGEDIIMKGEGYHYAQGQNLAQWNPVVVASTGPLPVCHGNNGPDGVNCAREACTGTNGPMDGPTGTPCNRAEPDAIPHYNTDPTQGRPYQTSGDITRSQPEVTTANAWPASNFVQIDEAPVSDEAEKVSVLQTPYGKGHTTFYAQH*
Ga0138326_1078176113300010985MarineMKSAVIALFLGATSALKVQDAPPYFNEPTWTERMPSAGGFLQMSACVNSGVAGVTCTPANHELFATGMNGDEDLGEDIIMKGEPFHYHQKKDSSFVQWNPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDDVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLKADPVDDGAEKVSVLQTPY*
Ga0138326_1118810613300010985MarineKSAVIALFLGATSAVKMQDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKQSLAQWNPVEVATTGALPACHGNNGPDGVNCARETCSGTNGPVDGPSGTPCTRDEPASIPHYNTDPEAGRPYQTSGDITATSPEATSAHSWPASQTLVQTEDDAVPSAEAEKVSVLQTPYGHTHTSFY*
Ga0138324_1015678913300010987MarineSAVIALFLGATSAVKLQDAPPYFNEPTWNERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNSTSLAQWTPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTREEPDAVPHYNTDPTAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPIGATRTTFYDKKSTNQAIA*
Ga0138324_1032464213300010987MarineQDAPPYFNEPTWTERMPSAGGFLQVSACVNAGVNGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKKEHSLVQWNPVVVESTGALPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDVTATSPEATSAHSWPASQTFVETQDDVSPEAEKVSVLQTPYGHTHTSFY*
Ga0138324_1032923813300010987MarineYVIALFLGVAAAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCTPGNSELFATGMNGDEDLGEDIIMKGEPYHYNQKRDASLVQWNPVTVESTGPLPECHGNNGPDGKNCARATCTGTNGPMDGPSGTPCTRDQPDDVPHYNTDPQAGRPYQTSGDITATSPEATSAHSWPASQTLVQMNAEPVDDQAEKVSVLQTPYGHTHTSFY*
Ga0138324_1042040713300010987MarineYTVALFISGAAALRDAPAFFNQPTWTERMPSAGGFVQLNSCLSANVDGITCLPGNSELFATGMNGDEDLGEDIIMKGEGYHYAQGQNLAQWNPVVVASTGPLPVCHGNNGPDGVNCAREACTGTNGPMDGPTGTPCNRAEPDAIPHYNTDPTQGRPYQTSGDITRSQPEVTTANAWPASNFVQIDEAPVSDEAEKVSVLQTPYGKGHTTFYAQH*
Ga0138324_1052775313300010987MarineTMKSAVIALFLGANSALKVQDAPPYFNEPTWTERMPSAGGFLQMSACVNSGVAGVTCTPANHELFATGMNGDEDLGEDIIMKGEPFHYHQKKDSSFVQWNPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDDVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQMED
Ga0129328_112947813300012472AqueousMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDSVPHYNTDPKAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY*
Ga0129349_106692213300012518AqueousSATIALFLGAASAVKIQDAPPYFNEPTWNERMASAGGFLQISACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKTGQRLAQWNPVVVETTGTLPKCHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREEPADIPHYNTDTKAGRPYQTTGDITPTSPEATSAHSWPASQTFVELADDAVVSAEAEKVSTLQTPYGHTHTSFY*
Ga0129349_120936513300012518AqueousMKSAVIALFLGATSAVKMNDADPYFNEPTWNERMPSAGGFVQITACVNANATGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTREEPDSVPHYNTDPTAGRPYQTSGDITKTSPEPTTAHSWPASQSFVQMEEAPVSDEAEKVSVLQTPYGHTHTSFY*
Ga0129350_112420213300012523AqueousMKSATIALFLGAASAVKIQDAPPYFNEPTWNERMASAGGFLQISACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKTGQRLAQWNPVVVETTGTLPKCHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREEPADIPHYNTDTKAGRPYQPSGDITPTSPEATSANSWPASQTFVELADDAVVSAEAEKVSTLQTPYGHTHTSFY*
Ga0129350_124940913300012523AqueousAVIALFLGASSAVKMNDADPYFNEPTWNERMPSAGGFVQITACVNANATGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTREEPDSVPHYNTDPTAGRPYQTSGDITKTSPEPTTAHSWPASQSFVQMEAEPVSDEAEKVSVLQTPYGHTHTSFY*
Ga0129331_112903613300012524AqueousTMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDSVPHYNTDPKAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY*
Ga0129353_184205513300012525AqueousKSATIALFLGAASAVKIQDAPPYFNEPTWNERMASAGGFLQISACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKTGQRLAQWNPVVVETTGTLPKCHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREEPADIPHYNTDTKAGRPYQTTGDITPTSPEATSANSWPASQTFVELADDAVVSAE
Ga0129353_185544013300012525AqueousMKSAVIALFLGATSAIKLGDAPPYFNEPTWNERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATSLAQWTPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPVAGRPYQTTGDITKTSPEATSAHSWPASQTFVQLADPPVDDQAEKVSVLQTPWGHTHTTYY*
Ga0129353_187204013300012525AqueousFFIILIKTMKSAVIALFLGATSAVKMNDADPYFNEPTWNERMPSAGGFVQITACVNANATGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTREEPDSVPHYNTDPTAGRPYQTSGDITKTSPEPTTAHSWPASQSFVQMEAEPVSDEAEKVSVLQTPYGHTHTSFY*
Ga0129352_1061907113300012528AqueousMKSATIALFLGAASAVKIQDAPPYFNEPTWNERMASAGGFLQISACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKTGQRLAQWNPVVVETTGTLPKCHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREEPADIPHYNTDTKAGRPYQTSGDITPTSPEATSAHSWPASQTFVELADDAVVSAEAEKVSTLQTPYGHTHTSFY*
Ga0129346_121486513300012965AqueousGFVQITACVNANATGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYEQRNASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTTGDITKTSPEPTTAHSWPASQSFVQMEEAPVSDEAEKVSVLQTPYGHTHTSFY
Ga0182047_126841613300016737Salt MarshAVIALFLGATSAVKMNDADPYFNEPTWNERMPSAGGFVQITACVNANATGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYEQRNASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTTGDITKTSPEPTTAHSWPASQSFVQMEEAPVSDEAEKVSVLQTPYGH
Ga0182053_105615013300016749Salt MarshAVIALFLGATSAVKMNDADPYFNEPTWNERMPSAGGFVQITACVNANATGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYEQRNASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTTGDITKTSPEPTTAHSWPASQSFVQMEEAPVSDEAEKVSVL
Ga0180120_1014261123300017697Freshwater To Marine Saline GradientMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDSVPHYNTDPKAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0193571_101705513300018671MarineQIKTMKSAVIALFLGATSAVKLGDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPDNQLFATGMNGDEDLGEDIIMKGKPFHYDQKKSTASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEPTSAHSWP
Ga0192944_102494613300018692MarineMKYAIALFIGAASAIKVQDAPPYFNEPTWNERMGSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLAEDIIMKGEPYHYNQKQKQQKLVQWNPVVVESTGPLPTCHGNNGPDGKNCDRAVCSGTNGPLDGPSGTPCTHEEPDSIPHYNTDAAAGRPYATTGDISSSAPEPMSSHSWPASQEHPTEAGPITQNYVQLKAEPATYAAVDDGAEKVSDLQTPYGHTHTTFY
Ga0192944_102551513300018692MarineHGDNQIKTMKSAVIALFLGATSALKLQDADPFFNEPTWTERMPSAGGFVQLTACVNSGVAGVTCSPPNQQLFATGMNGDEDLGEDIIMKGKPFHYDQKKASLAQWTPVVVETTGALPACHGNNGPDGVNCAKETCSGTNGPKDGETGTPCTREEPDAVPHYNTDPQAGRPYQTSGDITTTSPEATSAHSWPASQTFVQLNEVPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193544_101405213300018735MarineRDNQIKTMKSAVIALFLGATSAVKLQDAPPYFNEPTWNERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193534_103609213300018741MarineSAVIALFLGATSAVKLGDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPDNQLFATGANGDEDLGEDIIMKGKPFHYDQKKSTASLAQWTPVVVETTGPLPACHGNNGPDGANCAKEVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193534_104024513300018741MarineSAVIALFLGATSAVKLGDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPDNQLFATGANGDEDLGEDIIMKGKPFHYDQKKSTASLAQWTPVVVETTGPLPACHGNNGPDGANCAKEVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0192827_103761813300018763MarineHGENQIKTMKYTVALFLGVASAMKVQDAPPYFNEPTWTERMPSAGGFLQVSACVNAGVNGVTCSPPNQELFATGMNGDEDLGEDIIMKGEPYHYNQKKGASLVQWNPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDDIPHYNTDPTAGRPYQTSGDITKTSPEPTSAHSWPASQTFVQTQDDAVSPEAEKVSVLQTPYGHTHTSFY
Ga0193031_102966313300018765MarineTWGYFSINQIKTMKSAVIALFLGAAVAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCNPPNSELFATGMNGDEDLQEDIIMKGEPYHYNQKKGQKLAQWNPVEVETTGALPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTRDQPDDIPHYNTDTTAGRPYQTSGDITATSPEATSAHSWPASQTLVELPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0193031_103093413300018765MarineTWGFYNQIKTMKSAVIALFLGATSAVKLGDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPDNQLFATGANGDEDLGEDIIMKGKPFHYDQKKSTASLAQWTPVVVETTGPLPACHGNNGPDGANCAKEVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193031_103803913300018765MarineTWGYFSINQIKTMKSAVIALFLGAAVAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCNPPNSELFATGMNGDEDLQEDIIMKGEPYHYNQKKGQKLAQWNPVEVETTGALPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDDIPHYNTDVTAGRPYQTSGDITATSPEATSAHSWPASQTLVALPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0193031_104036013300018765MarineWDKSKEKTMKSAVIALFLGAASAVKVQDAPPYFNEPTWNERMSSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKAQKLVQWNPVVVETTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREQPDDVPHYNTDPTAGRPYQTSGDITATSPEATSAHSWPASQTFVQLEPVDD
Ga0193124_102887613300018787MarineKSAVIALFLGATSAIKMGDAPPYFNEPTWTERMPSAGGFLQISACVNSGVAGVTCAPPNHELFATGMNGDEDLGEDIIMKGEPYHYHQKGQALAQQKFVPVVVESTGPLPACHGNNGPDGKNCARETCSGTNGPMDGPAGTPCTREEPDSVPHYNTDPTAGRPYQTSGDITKTSPEATSAHSWPASQTFVQIQGDDAVPSAEAEKVSVLQTPYGHTHTSFY
Ga0192949_105722623300018831MarineSAVIALFLGATSALKLQDADPFFNEPTWTERMPSAGGFVQLTACVNSGVAGVTCSPPNQQLFATGMNGDEDLGEDIIMKGKPFHYDQKKASLAQWTPVVVETTGALPACHGNNGPDGVNCAKETCSGTNGPKDGETGTPCTREEPDAVPHYNTDPQAGRPYQTSGDITTTSPEATSAHSWPASQTFVQLNEVPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193302_104700113300018838MarineTVALFLGVASAIKVQDAPPYFNEPTWTERMPSAGGFLQVSACVNAGVNGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKKEHSLVQWNPVVVESTGALPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDITATSPEATSAHSWPASQTFVQTQDDAVSPEAEKVSVLQTPYGHTHTSFY
Ga0193253_106856913300018846MarineTMKSAVIALFLGATSALKMKDADPYFNEPTWNERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKKASLAQWTPVVVESTGPLPACHGNNGPDGVNCAKEVCSGTNGPKDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTSGDITKTSPEPTSANSWPASQSLVQVVAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0193253_108258513300018846MarineTMKSAVIALFLGATSAVKLNDAPPYFNEPTWTERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTKEEPDAVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPAS
Ga0193253_108511713300018846MarineKTMKSGVIALFLGSAAAIRSGDAPPFFNEPTWNEKMPSAGGFLQVSSCINAGVAGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYTQKKESSLVQWNPVDVASTGPLPNCHGNNGPDGTNCDREVCSGTNGPMDGPSGTPCTREQPAAVPHYNTDPTAGRPYQTSGDITATSPEATSANSWPASQTLIQMKDDSVSAEAEKVSVLQTPYGHTHTSFY
Ga0193533_106160223300018870MarineFYNQIKTMKSAVIALFLGATSAVKLGDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPDNQLFATGANGDEDLGEDIIMKGKPFHYDQKKSTASLAQWTPVVVETTGPLPACHGNNGPDGANCAKEVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193311_1003470413300018885MarineSAVIALFLGATSALKMKDADPYFNEPTWNERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKKASLAQWTPVVVESTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTSGDITKTSPEPTSANSWPASQSLVQVVAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0193028_105649613300018905MarineKSAVIALFLGATSAVKLGDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPDNQLFATGANGDEDLGEDIIMKGKPFHYDQKKSTASLAQWTPVVVETTGPLPACHGNNGPDGANCAKEVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0192989_1008153613300018926MarineMKSAVIALFLGATSALKMKDADPYFNEPTWNERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKKASLAQWTPVVVESTGPLPACHGNNGPDGVNCAKEVCSGTNGPKDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTSGDITKTSPEPTSANSWPASQSLVQVVAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0192989_1009377113300018926MarineQIKTMKSGVIALFLGSAAAIRSGDAPPFFNEPTWNEKMPSAGGFLQVSSCINAGVAGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYTQKKESSLVQWNPVDVASTGPLPNCHGNNGPDGTNCDREVCSGTNGPMDGPSGTPCTREQPAAVPHYNTDPTAGRPYQTSGDITATSPEATSANSWPASQTLIQMKDDSVSAEAEKVSVLQTPYGHTHTSFY
Ga0192989_1009400313300018926MarineSAVIALFLGATSAVKLNDAPPYFNEPTWTERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTKEEPDAVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPAS
Ga0193540_1012003613300018979MarineDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCNPPNSELFATGMNGDEDLGEDIIMKGEPYHYNQKKGQKLAQWNPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTRDQPDDIPHYNTDTTAGRPYQTSGDITATSPEATSAHSWPASQTLVELPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0192947_1013067913300018982MarineGEIKTMKSAVIALFLGATSALKLQDADPFFNEPTWTERMPSAGGFVQLTACVNSGVAGVTCSPPNQQLFATGMNGDEDLGEDIIMKGKPFHYDQKKASLAQWTPVVVETTGALPACHGNNGPDGVNCAKETCSGTNGPKDGETGTPCTREEPDAVPHYNTDPQAGRPYQTSGDITTTSPEATSAHSWPASQTFVQLNEVPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193030_1009261623300018989MarineMKSAVIALFLGATSAVKMGDAPPYFNEATWNERMPSAGGFLQVSACVNSGVAGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKKGGQRLAQWNPVVVETTGALPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDSVPHYNTDPTAGRPYQTSGDITATSPEATSAHSWPASQTFVQMEAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0193030_1009344523300018989MarineMKSAVIALFLGAVTADADPYFNEPTWNERMPSAGGFLQVNACINSGAQGVTCIPANSQLFATGMNGDEDLGEDIIMKGEPYHYHQKKDSSFVQWNPVVVESTGPLPACHGNNGPDGKNCDKEVCSGTNGPMDGPSGTPCTREQPDDIPHYNTDPVAGRPYQTSGDITPTSPEATTAHSWPASQSFVQIKEDPVPSPEAEKVSVLQTPYGHTHTSFY
Ga0193030_1010496813300018989MarineMKIAIAALLGYVSAVAVAKKESPDCPTSQEVFSYNERVGTAAGFLQLSACSTSGINGAGLTCVPDHQYFATGMNGDEDLGEDIIMKGKPFHYDQKNATSLAQWTPVVVETTGTLPACHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193030_1012504113300018989MarineTWGNQIKTMKYVIALFLGVAAAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCTPGNSELFATGMNGDEDLGEDIIMKGEPYHYNQKRDASLVQWNPVTVESTGPLPECHGNNGPDGKNCARATCTGTNGPKDGPSGTPCTRDQPDDVPHYNTDPQAGRPYQTSGDITATSPEATSAHSWPASQTLVQMNAEPVDDQAEKVSVLQTPYGHTHTSFY
Ga0193030_1012607113300018989MarineTWGNQIKTMKSAVIALFLGAAVAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCNPPNSELFATGMNGDEDLGEDIIMKGEPYHYNQKKGQKLAQWNPVEVETTGALPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTRDQPDDIPHYNTDTTAGRPYQTSGDITATSPEATSAHSWPASQTLVELPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0193030_1013093513300018989MarineTWGNQIKTMKSAVIALFLGATTAIKMQDAPPYFNEPTWNERNPSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDILMKGEPFHYNQKKTQKLVQWNPVVVETTGPLPACHGNNGPDGKNCAKEVCSGTNGPLDGPAGTPCTREEPDSVPHYNTDPQAGRPYQTSGDISTGSPEPMSSKSWPASQSNPGEAGTISQNYVQLEAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0193030_1014062913300018989MarineTWGKSKKIKTMKSAVIALFLGAASAVKVQDAPPYFNEPTWTERMSSAGGFLQISACVNSGVAGVTCSPPNHELFATGMNGDEDMGEDIIMKGEPYHYNQRQSLAQWNPVEVATTGALPACHGNNGPDGVNCAREACSGTNGPVDGPSGTPCTRDEPASVPHYNTDPEAGRPYQTSGDITATSPEATSSHSWPASQTLIQTEDDAVPSAEAEKVSVLQTPYGHTHTSFY
Ga0193030_1014356913300018989MarineTWGNQIKTMKSAVIALFLGAAVAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCNPPNSELFATGMNGDEDLGEDIIMKGEPYHYNQKKGQKLAQWNPVEVETTGALPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDDIPHYNTDVTAGRPYQTSGDITATSPEATSAHSWPASQTLVQMNAEPVEDGAEKVSVLQTPYGHTHTSFY
Ga0193030_1019655913300018989MarineGFVQLNSCLSANVDGITCIPGNSELFATGNNGDEDLGEDIIMKGEGYHYAQNLAQWNPVVVASTGPLPVCHGNNGPDGVNCAREACTGTNGPMDGPSGTPCNRAEPDAIPHYNTDPTQGRPYQTSGDITRTQPEVTTANAWPASNFVQVDEAPVSDEAEKVSVLQTPYGKGHTTFYAQH
Ga0193257_1014503713300018997MarineALKMKDADPYFNEPTWNERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKAIPLRSKEGFPRSMTPVVVESTGPLPACHGNNGPDGVNCAKEVCSGTNGPKDGPSGTPCTKEEPDSVPHYNTDPTAGRPYQTSGDITKTSPEPTSANSWPASQSLVQVVAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0193569_1022170513300019017MarineIKTMKSAVIALFLGATSAVKLGDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPDNQLFATGANGDEDLGEDIIMKGKPFHYDQKKSTASLAQWTPVVVETTGPLPACHGNNGPDGANCAKEVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0192951_1012324313300019022MarineMGNQIKTMKSAVIALFLGATSALKLQDADPFFNEPTWTERMPSAGGFVQLTACVNSGVAGVTCSPPNQQLFATGMNGDEDLGEDIIMKGKPFHYDQKKASLAQWTPVVVETTGALPACHGNNGPDGVNCAKETCSGTNGPKDGETGTPCTREEPDAVPHYNTDPQAGRPYQTSGDITTTSPEATSAHSWPASQTFVQLNEVPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193516_1014144613300019031MarineHGEIIFIFKIMKYTVALFISGAAALRDAPAYFNQPTWTERMPSAGGFVQLNSCLSANVDGITCLPGNSELFATGMNGDEDLNEDIIMKGEGYHYAQGQNLAQWNPVVVASTGPLPVCHGNNGPDGVNCAREACSGTNGPMDGPTGTPCNRAEPDAIPHYNTDPTQGRPYQTSGDITRTQPEVTTANAWPASNFVQIDEAPVSDEAEKVSVLQTPYGKGHTTFYAQH
Ga0192869_1021045013300019032MarineMGINQIKTMKYVIALFLGVAAAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCTPGNSELFATGMNGDEDLGEDIIMKGEPYHYNQKRDASLVQWNPVTVESTGPLPECHGNNGPDGKNCARATCTGTNGPKDGPSGTPCTRDQPDDVPHYNTDPTAGRPYATSGDIQATSPEATSAHSWPASQTLVQMNAEPVDDQAEKVSVLQTPYGHTHTSFY
Ga0192869_1025193313300019032MarineMKSAVIALFLGAVTADAPPYFNEPTWNERMPSAGGFLQVNACINSGAQGVTCIPANSQLFATGMNGDEDLGEDIIMKGEPYHYNQKKDTNLVQWNPVVVESTGPLPYCHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTREQPDDIPHYNTDPTAGRPYQTSGDITHTSPEATTAHSWPASQSFVQIKEDPVPSPEAEKVSVLQTPYGHTHTSFY
Ga0192869_1033320513300019032MarineTWDAPAFFNQPTWTERMPSAGGFVQLNSCLSANVDGITCIPGNSELFATGNNGDEDLGEDIIMKGEGYHYAQNQNLAQWNPVVVASTGPLPVCHGNNGPDGVNCAREACTGTNGPMDGPSGTPCNRAEPDAIPHYNTDPTQGRPYQTSGDITRTQPEVTTANAWPASNFVQVDEAPVSDEAEKVSVLQTPYGKGHTTFYAQH
Ga0192945_1012340623300019036MarineNAEYMGNQIKTMKSAVIALFLGATSALKLQDADPFFNEPTWTERMPSAGGFVQLTACVNSGVAGVTCSPPNQQLFATGMNGDEDLGEDIIMKGKPFHYDQKKASLAQWTPVVVETTGALPACHGNNGPDGVNCAKETCSGTNGPKDGETGTPCTREEPDAVPHYNTDPQAGRPYQTSGDITTTSPEATSAHSWPASQTFVQLNEVPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193336_1022923513300019045MarineHGENQIKTMKYVIALFLGVAAAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCTPGNSELFATGMNGDEDLGEDIIMKGEPYHYNQKRDASLVQWNPVTVESTGPLPECHGNNGPDGKNCARATCTGTNGPMDGPSGTPCTRDQPDDIPHYNTDPQAGRPYQTSGDITATSPEATSAHSWPASQTLVQMNAEPVDDQAEKVSVLQTPYGHTHTSFY
Ga0193336_1033057313300019045MarineETDAPAFFNEPTWNERMPSAGGFLQVSACINSGASGVTCIPPNHELFATGMNGDEDLGEDIIMKGEPYHYHQKQDTSLVQVQRWNPVEVVSTGPLPACHGNNGPDGTNCDREVCSGTNGPMDGPSGTPCTREQPASIPHYNTDPTAGRPFQTSGDITPTSPEPTSANSWPASQTFVQVQDDAVPSPEAEKVSVLQTPYGHTHTSFY
Ga0192826_1016038913300019051MarineHGENQIKTMKYVIALFLGVAAAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCTPGNAELFATGMNGDEDLGEDIIMKGEPYHYNQKKEASLVQWNPVTVESTGPLPECHGNNGPDGKNCARATCTGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTTGDITKTSPEATSAHSWPASQTLVQMNAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0192826_1017573213300019051MarineMGFSINQIKTMKSAVIALFLGVTSAVKVQDAPPYFNEPTWNERMPSASGFLQVSACINSGVAGVTCSPPNAELFATGMNGDEDLGEDIIMKGEPYHYNQKTGQKLAQWNPVVVETEPGKLPPCHGNNGPDGKNCKREVCSGTNGPMDGESGTPCTKEEPDEVPHYNTDPKAGRPYQTTGDITPTSPEPTSAHSWPASQTFVQMSAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0192826_1020126813300019051MarineSAVIALFLGVTSAVKVQDAPPYFNEPTWNERMPSASGFLQVSACINSGVAGVTCSPPNAELFATGMNGDEDLGEDIIMKGEPYHYNQKKEQSLVQWNPVVVETEPGKLPPCHGNNGPDGKNCKREVCSGTNGPMDGPSGTPCTKEEPDEVPHYNTDPKAGRPYQTSGDITATSPEPTTAKSWPASQSFVQTDAEPVDAEAEKVSVLQTPYGHTHTSFY
Ga0192826_1028315413300019051MarineTWGNQIKTMKYTVALFLGVASAMKVQDAPPYFNEPTWTERMPSAGGFLQVSACVNAGVNGVTCSPPNQELFATGMNGDEDLGEDIIMKGEPYHYNQKKEASLVQWNPVVVETTGALPACHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREQPDSIPHYNTDPTAGRPYQTSGDITATSPEATSAHSWPASQTFVQTQDD
Ga0188866_101762713300019095Freshwater LakeQIKTMKSTVIALFLGAVTADAPPFFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKKESSLVQWNAVDVATTGALPNCHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDITPTSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSFY
Ga0193541_103457913300019111MarineHGDNQIKTMKSAVIALFLGATSAVKLGDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPDNQLFATGANGDEDLGEDIIMKGKPFHYDQKKSTASLAQWTPVVVETTGPLPACHGNNGPDGANCAKEVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193054_105947213300019117MarineNERMPSAGGFLQISACLNSGVQGVICSPPNNELFATGMNGDEDLGEDIIMKGEPYHYNQKKQSLVQYGDGTFGGGFNPVEVATTGALPACHGNNGPDGKNCAREACSGTNGPMDGPAGTPCTRAEPDDIPHYNTDPTAGRPYQTSGDITATSPEPTSAHSWPASQTLIQTKDDAVVTPEAEKVSVLQTPYG
Ga0193157_101425713300019118MarineHGENQIKTMKSVIALFLGTASALKVQDAPPYFNEPTWTERMPSAGGFLQINACMNSNVAGVTCTPANHELFATGMNGDEDLGEDIIMKGEPYHYNQKKEHSFVQWNPVVVETTGTLPACHGNNGPDGVNCAREVCSGTNGPIDGPSGTPCTREQPDDVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLKGDDGDAVPSAQAEKVSVLQTPYGHTHTSFY
Ga0193104_102114513300019125MarineHGDNQIKTMKSAVIALFLGATSAVKLNDAPPYFNEPTWTERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEEPEAVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0193104_102707913300019125MarineMGNQIKTMKSAVIALFLGAAVAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCNPPNSELFATGMNGDEDLQEDIIMKGEPYHYNQKKAQRLAQWNPVEVETTGALPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDDIPHYNTDVTAGRPYQTSGDITATSPEATSAHSWPASQTLVALPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0188870_1008384113300019149Freshwater LakeMKSAVIALFLGAASAIKVQDAPPYFNEPTWNERMSSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKAQKLVQWNPVVVESTGALPKCHGNNGPDGVNCAKEVCSGTNGPMDGPNGTPCTKEQPDDVPHYNTDPQAGRPYQTSGDITATSPEATSAHSWPASQTFVQIKAEPVSDEAEKLSVLQTPYGHTHTSFY
Ga0188870_1008461513300019149Freshwater LakeMKSAVIALFLGATSAVKLNDAPPYFNEPTWTERMPSAGGFIQVSACINSSVTGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPLDGPSGTPCTKEEPEAVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0188870_1008477813300019149Freshwater LakeIKTMKSTVIALFLGAVTADAPPFFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKKESSLVQWNAVDVATTGALPNCHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDITPTSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSFY
Ga0194244_1002271413300019150MarineLGVASAMKVQDAPPYFNEPTWTERMPSAGGFLQVSACVNAGVNGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKKEASLVQWNPVVVESTGPLPACHGNNGPDGTNCARETCSGTNGPVDGPSGTPCTREQPDDIPHYNTDPTAGRPYATSGDITHTSPEATSAHSWPASQTFVETGDDVSPEAEKVSVLQTPYGHTHTSFY
Ga0194244_1002322813300019150MarineTWDLFYNQIKTMKSAVIALFLGATSAVKLGDAPPYFNEPTWTERMPSAGGFVQITACVNSGVAGVTCQPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKSATNLAQWTPVVVETTGPLPACHGNNGPDGVNCAREVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEPTSAHSWPASQTFVQLNEAPVSDEAEKVSVLQTPYGHTHTSFY
Ga0206687_134249313300021169SeawaterTMKSAVIALFLGATSAVKLNDAPPYFNEPTWTERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEEPEAVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0206692_136522713300021350SeawaterTVKSAVIALFLGATSAVKLNDAPPYFNEPTWTERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEEPEAVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0206693_159570113300021353SeawaterMKSAVIALFLGATSAVKLNDAPPYFNEPTWTERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEEPEAVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0063109_11908713300021866MarineMGDAPPYFNDATWNERMPSAGGFLQVSACVNSGVAGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPFHYNQKKGQKLAQWNPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTRDQPDSVPHYNTDPQAGRPYQTSGDITATSPEATSANSWPASQTLVQMKAEPVSDEAEKVSVL
Ga0063117_100277113300021881MarineMKYVIALFLGVAAAIKDAPPYFNEPTWTERMPSAGGFLQVNACVNAGVAGVTCTPGNSELFATGMNGDEDLGEDIIMKGEPYHYNQKRDASLVQWNPVTVESTGPLPECHGNNGPDGKNCARATCTGTNGPMDGPSGTPCTRDQPDDVPHYNTDPQAGRPYQTSGDITATSPEATSAHSWPASQTLVQMNESPVDDQAEKVSVLQTPYGHTHTSFY
Ga0063137_103591413300021892MarineMKSAVIALFLGATSAVKLNDAPPYFNEPTWTERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPLDGPSGTPCTKEEPEAVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0063136_101065613300021896MarineMKSAVIALFLGATTAIKMQDAPPYFNEPTWNERMGSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDILMKGEPFHYNQKKAQKLVQWNPVVVETVGSLPACHGNNGPDGKNCAKEVCSGTNGPLDGPAGTPCTREEPDSVPHYNTDPQAGRPYQTSGDISTGSPEPMSSKSWPASQSNPGEAGTISQNYVQLEAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0063133_112768213300021912MarineGVIALFLGSAAAIKDAPAFFNEPTWNEKMPSAGGFLQVSSCINAGVAGVTCVPNSQLFATGMNGDEDMGEDIIMKGEPYHYHQKKEASLVQWNPVDVVSTGPLPACHGNNGPDGTNCDREVCSGTNGPMDGPSGTPCTREQPAGIPHYNTDPTAGRPYQTSGDITPTSPEATSANSWPAS
Ga0063085_109080913300021924MarineMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDSVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYG
Ga0063139_100806813300021934MarineKTMKSAVIALFLGAASAVKVQDAPPYFNEPTWNERMSSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKAQKLVQWNPVVVETTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREQPDDVPHYNTDPTAGRPYQTSGDITATSPEATSAHSWPASQTFVQLEPVDD
Ga0063138_119241913300021935MarineVIALFLGSATAVRDFDFNNMTPNTFTEKMPAAAGFVQVNACLNSGASGVTCIPENHQLYATGMNGDEDLGEDIIMKGEPYHYQQKKDTSFVQWNPVVVESTGPLPACHGNNGPDGKNCDKEVCSGTNGPKDGPSGTPCTREQPDDIPHYNTDPTAGRPYQTSGDITPTSPEPTTAHS
Ga0063102_102745813300021941MarineMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFSTGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPIDGPSGTPCTREEPEAVPSYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0232113_101623113300023679SeawaterSAVIALFLGATSAVKLNDAPPYFNEPTWTERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEEPEAVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0228681_102306023300023683SeawaterFNEPTWNERMSSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKPQKLVQWNPVVVESTGPLPKCHGNNGPDGVNCDKEVCSGTNGPMDGPSGTPCTREQPDDVPHYNTDPTAGRPYQTSGDITATSPEATSAKSWPASQTFVQLKAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0228682_102410323300023698SeawaterMKSAVIALFLGAASAVKVQDAPPYFNEPTWNERMSSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKPQKLVQWNPVVVESTGPLPKCHGNNGPDGVNCDKEVCSGTNGPMDGPSGTPCTREQPDDVPHYNTDPTAGRPYQTSGDITATSPEATSAKSWPASQTFVQLKAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0209306_107719523300025680Pelagic MarineMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDSVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0247588_105243913300026465SeawaterITMKSAVIALFLGAASAVKVQDAPPYFNEPTWNERMSSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKPQKLVQWNPVVVESTGPLPKCHGNNGPDGVNCDKEVCSGTNGPMDGPSGTPCTREQPDDVPHYNTDPTAGRPYQTSGDITATSPEATSAKSWPASQTFVQLKAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0247603_108397613300026468SeawaterFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKPQKLVQWNPVVVESTGPLPKCHGNNGPDGVNCDKEVCSGTNGPMDGPSGTPCTREQPDDVPHYNTDPTAGRPYQTSGDITATSPEATSAKSWPASQTFVQLKAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0247599_102244623300026470SeawaterDAPPYFNEPTWTERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATASLAQWTPVVVETTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEEPEAVPHYNTDPQAGRPYQTSGDITKTSPEATSAHSWPASQTFVQLAEPPVEDEAEKVSVLQTPWGHTHTTYY
Ga0247592_108643423300026500SeawaterASAVKVQDAPPYFNEPTWNERMSSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKPQKLVQWNPVVVESTGPLPKCHGNNGPDGVNCDKEVCSGTNGPMDGPSGTPCTREQPDDVPHYNTDPTAGRPYQTSGDITATSPEATSAKSWPASQTFVQLKAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0247605_110647213300026503SeawaterWNERMSSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKPQKLVQWNPVVVESTGPLPKCHGNNGPDGVNCDKEVCSGTNGPMDGPSGTPCTREQPDDVPHYNTDPTAGRPYQTSGDVTATSPEATSAKSWPASQTFVQLKAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0209502_1023411623300027780MarinePYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPIDGPSGTPCTREEPEAVPSYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0247596_105473213300028106SeawaterTMKSAVIALFLGAASAVKVQDAPPYFNEPTWNERMSSAGGFLQISACVNSGVQGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKPQKLVQWNPVVVESTGPLPKCHGNNGPDGVNCDKEVCSGTNGPMDGPSGTPCTREQPDDVPHYNTDPTAGRPYQTSGDITATSPEATSAKSWPASQTFVQLKAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0256411_112558513300028134SeawaterMASAGGFLQISACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKTGQKLAQWNPVVVETTGALPACHGNNGPDSVNCAREVCSGTNGPVDGPSGTPCTREEPADIPHYNTDTKAGRPYQTSGDITATSPEATSANSWPASQTFVELADDAVVSAEAEKVSTLQTPYGHTHTSFY
Ga0256412_119331913300028137SeawaterQIKTMKSGVIALFLGSAAAIRDAPPFFNEPTWNEKMPSAGGFLQVSSCINAGVAGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYHQKKESSLVQWNPVDVVSTGPLPACHGNNGPDGTNCDREVCSGTNGPMDGPSGTPCTREQPAAIPHYNTDPTAGRPYQTSGDITATSPEPTSANSWPASQTLVQMKDDAVSAEAEKVSVLQTPYGHTHTSFY
Ga0256417_110128313300028233SeawaterTMKSATIALFLGAASAVKIQDAPPYFNEPTWNERMASAGGFLQISACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKTGQKLAQWNPVVVETTGTLPACHGNNGPDSVNCAREVCSGTNGPVDGPSGTPCTREEPADIPHYNTDTKAGRPYQTSGDITATSPEATSANSWPASQTFVELADDAVVSAEAEKVSTLQTPYGHTHTSFY
Ga0256417_118770513300028233SeawaterVIIALVATSAAAVKLGDAPPFFNEPTWNEKMQSAGGFLQVSSCITANIEGVVCQPDDHMLFATGMNGAEDLGEDIIMKGEPYHYHQKKESSLVQWNPVDVVSTGPLPACHGNNGPDGTNCDREVCSGTNGPMDGPSGTPCTREQPAAIPHYNTDPTAGRPYQTSGDITATSPEPTSANSWPASQ
Ga0256413_118633613300028282SeawaterGVIALFLGSAAAIRDAPPFFNEPTWNEKMPSAGGFLQVSSCINAGVAGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYNYHQKKESSLVQWNPVDVVSTGPLPACHGNNGPDGTNCDREVCSGTNGPMDGPSGTPCTREQPAAIPHYNTDPTAGRPYQTSGDITATSPEPTSANSWPASQTLVQMKDDAVSAEAEKVSVLQTPYGHTHTSFY
Ga0304731_1025824313300028575MarineKTMKSAVIALFLGAVTADAPPYFNEPTWTEKMPSAGGFLQVNACINSGAAGVTCIPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKRESSLVQWNPVDVASTGPLPACHGNNGPDGTNCDREVCSGTNGPMDGPSGTPCTREQPASIPHYNTDVTAGRPYQTSGDITATSPEPTSAHSWPASQTLVQMNAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0304731_1048055213300028575MarineYTVALFISGAAALRDAPAYFNQPTWTERMPSAGGFVQLNSCLSANVDGITCLPGNSELFATGMNGDEDLGEDIIMKGEGYHYAQGQNLAQWNPVVVASTGPLPVCHGNNGPDGVNCAREACTGTNGPMDGPTGTPCNRAEPDAIPHYNTDPTQGRPYQTSGDITRSQPEVTTANAWPASNFVQIDEAPVSDEAEKVSVLQTPYGKGHTTFYAQH
Ga0304731_1065739413300028575MarineTMKSAVIALFLGANSALKVQDAPPYFNEPTWTERMPSAGGFLQMSACVNSGVAGVTCTPANHELFATGMNGDEDLGEDIIMKGEPFHYHQKKDSSFVQWNPVVVESTGPLPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDDVPHYNTDPQAGRPYQTSGDITKTSPEATS
Ga0304731_1092005813300028575MarineAVIALFLGATSAVKMQDAPPYFNEPTWTERMASAGGFLQISACVNSGVAGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKQSLAQWNPVEVATTGALPACHGNNGPDGVNCARETCSGTNGPVDGPSGTPCTRDEPASIPHYNTDPEAGRPYQTSGDITATSPEATSAHSWPASQTLVQTEDDAVPSAEAEKVSVLQTPYGHTHTSFY
Ga0073990_1000635013300030856MarineDAPPYFNEPTWNERMASAGGFLQISACVNSGVAGVTCSPPDHQLFATGMNGDEDLGEDIIMKGKPFHYDQKNSTASLAQWTPVVVETTGPLPACHGNNGPDGVNCAREVCSGTNGPMDGPAGTPCTKEEPDAVPHYNTDPTAGRPYQTSGDITKTSPEPTSAHSWPASQTFVQLAEPPVDDEAEKVSVLQTPWGHTHTTYY
Ga0073990_1196577413300030856MarineVIALFLGAVTADAPPFFNEPTWNEKMPSAGGFLQVSACINAGAPGVTCVPNSELFATGMNGDEDLGEDIIMKGEPYHYHQKREASLVQWNPVDVASTGPLPKCHGNNGPDGVNCDREVCSGTNGPKDGPSGTPCTREQPDAIPHYNTDPTAGRPYQTSGDITATSPEPTSAHSWPASQTLVQMNAEPVSDEAEKVSVLQTPYGHTHTSFY
Ga0073990_1205469813300030856MarineIKTMKSAVIALFLGATSAVKVQDAPPYFNEPTWNERMPSASGFLQVSACINSGVAGVTCSPPNNELFATGMNGDEDLGEDIIMKGEPYHYNQKPQRLAQWNPVVVETEPGKLPACHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTKEEPAAIPHYNTDPTAGRPYQTSGDITATSPEATSAHSWPASQTFVQLKESPVSDEAEKVSDLQTPYGHTHTTFY
Ga0073990_1205682113300030856MarineTGVTCTPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQGLAQWNPVVVESTGPLPECHGNNGPDGKNCAKAVCTGTNGPKDGPSGTPCTREEPDAVPHYNTDPTAGRPYQTTGDVGTTSPEATSAASWPASQSHATEAGTIGQNTFVQLHESPVSDEAEKVSDLQTPYGHTHTTF
Ga0073986_1199227613300031038MarineDAPPYFNEPTWNERMPSASGFLQVSACINSGVSGVTCSPPNAELFATGMNGDEDLGEDIIMKGEPYHYNQKTGQKLAQWNPVVVETEPGKLPPCHGNNGPDGKNCKREVCSGTNGPMDGESGTPCTKEEPDDVPHYNTDPKAGRPYQTTGDITPTSPEPTSAHSWPASQTFVQMSAEPVSDEAEKVSVLQTPYGHTHT
Ga0073986_1202209213300031038MarineSAVIALFLGATSAIKLNDAPPYFNEPTWNERMPSAGGFLMVSACVNSGVAGVTCSPPNSQLFATGMNGDEDLGEDIIMKGKPFHYDQKNATSLAQWTPVVVESTGPLPACHGNNGPDGVNCAKEVCSGTNGPMDGPSGTPCTKEEPDAVPHYNTDPQAGRPYQTTGDITKTSPEPTSAHSWPASQTFVQLAEPPVDDEAEKVSVLQTPWGHTHTTYY
Ga0073989_1352635213300031062MarineTMKSAVIALFLGATSAVKMNDAPAFFNEPTWNERMPSAGGFLQISACLNSGVQGVICSPPNNELFATGMNGDEDLGEDIIMKGEPYHYNQKKQSLVQYGDGTFGGGFNPVDVASTGPLPACHGNNGPDGKNCAREACSGTNGPMDGPAGTPCTRAEPDDIPHYNTDPTAGRPYQTSGDITATSPEPTSAHSWPASQTLIQTQDDSVSAEAEKVSVLQTPYGHTHTSFY
Ga0073989_1353219613300031062MarineKTMKSAVIALFLGATSAIKMGDAPPYFNEPTWNERMPSAGGFVQISACVNSGVAGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKRQSLVQDDLTERFNPVVVASTGPLPACHGNNGPDGTNCARETCSGTNGPKDGPSGTPCTREEPDSVPHYNTDPTAGRPYQTSGDI
Ga0073989_1355496313300031062MarinePTWTERMPSAGGFLQVSACVNAGVNGVTCSPPNHELFATGMNGDEDLGEDIIMKGEPYHYNQKKQSLAQWNPVEVATTGPLPACHGNNGPDGVNCAREVCSGTNGPVDGPSGTPCTREQPDDIPHYNTDPTAGRPYQTSGDITATSPEATSAHSWPASQTFAQTQDDVVSPEAEKVSVLQTPYGHTHTSFY
Ga0308134_107186213300031579MarineAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFSTGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPIDGPSGTPCTREEPEAVPSYNTDPQAGRPYQTSGDITKTSPEATSANSWPAAQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0302121_1010705423300031626MarineNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFSTGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPIDGPSGTPCTREEPEAVPSYNTDPQAGRPYQTSGDITKTSPEATSANSWPAAQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0307381_1015902513300031725MarineMKSAVIALFLGATSALKLQDADPFFNEPTWTERMPSAGGFVQLTACVNSGVAGVTCSPPNQQLFATGMNGDEDLGEDIIMKGKPFHYDQKKASLAQWTPVVVETTGALPACHGNNGPDGVNCAKETCSGTNGPKDGETGTPCTREEPDAVPHYNTDPQAGRPYQTSGDITTTSPEATSAHSWPASQTFVQLNEVPVEDEAEKVSVLQTPWGHTHTTYY
Ga0307381_1023636013300031725MarineKTMKSAVIALFLGAVTADAPGFFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGNNGDEDLGEDIIMKGEPYHYTQKKDSSLVQWNAVDVATTGALPNCHGNNGPDGTNCDREVCSGTNGPKDGPSGTPCTREQPDAVPHYNTDVTAGRPYQTSGDITATSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSF
Ga0307383_1035879913300031739MarineIALFLGAVTADAPGFFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGNNGDEDLGEDIIMKGEPYHYTQKKDSSLVQWNAVDVATTGALPNCHGNNGPDGTNCDREVCSGTNGPKDGPSGTPCTREQPDAVPHYNTDVTAGRPYQTSGDITATSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSFY
Ga0307382_1023446813300031743MarineMKSAVIALFLGAVTADAPGFFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGNNGDEDLGEDIIMKGEPYHYTQKKDSSLVQWNAVDVATTGALPNCHGNNGPDGTNCDREVCSGTNGPKDGPSGTPCTREQPDAVPHYNTDVTAGRPYQTSGDITATSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSFY
Ga0314679_1045324313300032492SeawaterFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKKESSLVQWNAVDVATTGALPNCHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDITPTSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSF
Ga0314688_1047002613300032517SeawaterMKSTVIALFLGAVTADAPPFFNEPTWTETMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKKESSLVQWNAVDVATTGALPNCHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDITPTSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSFY
Ga0314671_1034191213300032616SeawaterMKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPVSVPHYNTDPQAGRPYQTSGDLTKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0314671_1045030913300032616SeawaterTMKSTVIALFLGAVTADAPPFFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKKESSLVQWNAVDVATTGALPNCHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDITPTSPEATSAHSWPASQSLVQMNAEPVDDQAEKVSVLQTPYGHTHTSFY
Ga0314673_1041733713300032650SeawaterMKSTVIALFLGAVTADAPPFFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKKESSLVQWNAVDVATTGALPNCHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDITTTSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSFY
Ga0314687_1055416413300032707SeawaterMKSTVIALFLGAVTADAPPFFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKKESSLVQWNAVDVATTGALPNCHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDITPTSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSF
Ga0314669_1041874113300032708SeawaterKTMKSTVIALFLGAVTADAPPFFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKKESSLVQWNAVDVATTGALPNCHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDITPTSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSFY
Ga0314681_1043979813300032711SeawaterMKSTVIALFLGAVTADAPPFFNEPTWTEKMPSAGGFLQVNACINSGAPGVTCVPNSQLFATGMNGDEDLGEDIIMKGEPYHYNQKKESSLVQWNAVDVATTGALPNCHGNNGPDGKNCDREVCSGTNGPMDGPSGTPCTREQPDAVPHYNTDPTAGRPYQTSGDITPTSPEATSAHSWPASQSLVQMNESPVDAEAEKVSVLQTPYGHTHTSFY
Ga0314705_1043853213300032744SeawaterKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVVVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDSVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY
Ga0314700_1031688613300032752SeawaterKSAVIALFLGATSAIKMQDADPYFNEPTWTERMPSAGGFVQITACVNANASGVTCSPPNQQLFATGMNGDEDLGQDIIMKGKPFHYDQKSASLAQWTPVSVESTGPLPKCHGNNGPDGVNCAKEVCSGTNGPVDGPSGTPCTREEPDSVPHYNTDPQAGRPYQTSGDITKTSPEATSANSWPASQTFVQLPPVEDEAEKVSVLQTPYGHTHTSFY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.