NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039748

Metagenome / Metatranscriptome Family F039748

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039748
Family Type Metagenome / Metatranscriptome
Number of Sequences 163
Average Sequence Length 45 residues
Representative Sequence MLIERSEGLQLYVRGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Number of Associated Samples 138
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.45 %
% of genes near scaffold ends (potentially truncated) 97.55 %
% of genes from short scaffolds (< 2000 bps) 91.41 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(41.718 % of family members)
Environment Ontology (ENVO) Unclassified
(36.810 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(39.877 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.99%    β-sheet: 0.00%    Coil/Unstructured: 63.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 163 Family Scaffolds
PF07478Dala_Dala_lig_C 50.31
PF06206CpeT 7.36
PF00326Peptidase_S9 4.29
PF13535ATP-grasp_4 1.23
PF07676PD40 0.61
PF13419HAD_2 0.61



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10106495All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1156Open in IMG/M
3300001867|JGI12627J18819_10376621All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium576Open in IMG/M
3300002908|JGI25382J43887_10172442All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1073Open in IMG/M
3300002909|JGI25388J43891_1035377All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium797Open in IMG/M
3300003328|Ga0006576J49610_1030408All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1186Open in IMG/M
3300004091|Ga0062387_101410003All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium555Open in IMG/M
3300005176|Ga0066679_10951566All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium538Open in IMG/M
3300005336|Ga0070680_100437026All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1117Open in IMG/M
3300005336|Ga0070680_101675090All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium551Open in IMG/M
3300005436|Ga0070713_101564606All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium640Open in IMG/M
3300005439|Ga0070711_100871537All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium767Open in IMG/M
3300005531|Ga0070738_10107515All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300005543|Ga0070672_101067746All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium717Open in IMG/M
3300005556|Ga0066707_10123485All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1616Open in IMG/M
3300005560|Ga0066670_10411263All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium830Open in IMG/M
3300005578|Ga0068854_102264451All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium503Open in IMG/M
3300005615|Ga0070702_100730703All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium758Open in IMG/M
3300005616|Ga0068852_100626002All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1082Open in IMG/M
3300005842|Ga0068858_100301848All Organisms → cellular organisms → Bacteria → Proteobacteria1528Open in IMG/M
3300006059|Ga0075017_101277611All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales576Open in IMG/M
3300006175|Ga0070712_100110212All Organisms → cellular organisms → Bacteria2053Open in IMG/M
3300006175|Ga0070712_101993619All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium508Open in IMG/M
3300006176|Ga0070765_100943459All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium816Open in IMG/M
3300009174|Ga0105241_12424576All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium524Open in IMG/M
3300009551|Ga0105238_12179223All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium589Open in IMG/M
3300009623|Ga0116133_1130382All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300009826|Ga0123355_10368730All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300009826|Ga0123355_11864403All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium564Open in IMG/M
3300010048|Ga0126373_10559230All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1192Open in IMG/M
3300010048|Ga0126373_13208351All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium509Open in IMG/M
3300010049|Ga0123356_10140811All Organisms → cellular organisms → Bacteria2379Open in IMG/M
3300010360|Ga0126372_11684065All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium675Open in IMG/M
3300010373|Ga0134128_11104730All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium875Open in IMG/M
3300010373|Ga0134128_11245175All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium820Open in IMG/M
3300010398|Ga0126383_12027404All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium663Open in IMG/M
3300012351|Ga0137386_10478766All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium897Open in IMG/M
3300012361|Ga0137360_11531852All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium571Open in IMG/M
3300012362|Ga0137361_11378352All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium629Open in IMG/M
3300012582|Ga0137358_10459855All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium859Open in IMG/M
3300012917|Ga0137395_10914390All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium634Open in IMG/M
3300012948|Ga0126375_10388059All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1005Open in IMG/M
3300012971|Ga0126369_11273366All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium825Open in IMG/M
3300012971|Ga0126369_12320123All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium623Open in IMG/M
3300012977|Ga0134087_10233874All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium836Open in IMG/M
3300013100|Ga0157373_11474501All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium519Open in IMG/M
3300013104|Ga0157370_12143652All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium501Open in IMG/M
3300013306|Ga0163162_13354283All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium512Open in IMG/M
3300014654|Ga0181525_10560338All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium635Open in IMG/M
3300016371|Ga0182034_10752747All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium831Open in IMG/M
3300016371|Ga0182034_11527724All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium585Open in IMG/M
3300017930|Ga0187825_10090911All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1051Open in IMG/M
3300017936|Ga0187821_10435014All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium542Open in IMG/M
3300017937|Ga0187809_10062079All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1216Open in IMG/M
3300017970|Ga0187783_11103764All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium571Open in IMG/M
3300017972|Ga0187781_10456266All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium915Open in IMG/M
3300018064|Ga0187773_11256856All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium501Open in IMG/M
3300018090|Ga0187770_10021933All Organisms → cellular organisms → Bacteria4341Open in IMG/M
3300018482|Ga0066669_10379007All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1188Open in IMG/M
3300021088|Ga0210404_10064446All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1765Open in IMG/M
3300021088|Ga0210404_10157227All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1195Open in IMG/M
3300021168|Ga0210406_10736841All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium756Open in IMG/M
3300021171|Ga0210405_10068396All Organisms → cellular organisms → Bacteria2802Open in IMG/M
3300021180|Ga0210396_10072921All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3123Open in IMG/M
3300021180|Ga0210396_11226590All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium627Open in IMG/M
3300021361|Ga0213872_10155643All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium996Open in IMG/M
3300021402|Ga0210385_10285395All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1220Open in IMG/M
3300021402|Ga0210385_10514877All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium908Open in IMG/M
3300021474|Ga0210390_11074830All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium654Open in IMG/M
3300022532|Ga0242655_10302914All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium521Open in IMG/M
3300025905|Ga0207685_10255530All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium849Open in IMG/M
3300025910|Ga0207684_11497084All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium549Open in IMG/M
3300025914|Ga0207671_10330066All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1208Open in IMG/M
3300025914|Ga0207671_11013093All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium654Open in IMG/M
3300025922|Ga0207646_11879077All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium511Open in IMG/M
3300025924|Ga0207694_10508162All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1009Open in IMG/M
3300025940|Ga0207691_10940947All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium722Open in IMG/M
3300025944|Ga0207661_10314506All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1406Open in IMG/M
3300025981|Ga0207640_11973841All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium528Open in IMG/M
3300026142|Ga0207698_10850007All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium917Open in IMG/M
3300026285|Ga0209438_1069827All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1147Open in IMG/M
3300026304|Ga0209240_1259604All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium533Open in IMG/M
3300026310|Ga0209239_1045696All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1997Open in IMG/M
3300026355|Ga0257149_1004026All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1715Open in IMG/M
3300026376|Ga0257167_1031642All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium788Open in IMG/M
3300026550|Ga0209474_10253837All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1081Open in IMG/M
3300026880|Ga0209623_1008155All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium663Open in IMG/M
3300026959|Ga0207852_1009076All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300027073|Ga0208366_1014362All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium853Open in IMG/M
3300027530|Ga0209216_1057057All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium659Open in IMG/M
3300027537|Ga0209419_1005071All Organisms → cellular organisms → Bacteria2026Open in IMG/M
3300027648|Ga0209420_1074301All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium988Open in IMG/M
3300027884|Ga0209275_10252490All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium968Open in IMG/M
3300027889|Ga0209380_10265414All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1009Open in IMG/M
3300027910|Ga0209583_10051817All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1447Open in IMG/M
3300028877|Ga0302235_10329219All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium659Open in IMG/M
3300030007|Ga0311338_12089277All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium500Open in IMG/M
3300030862|Ga0265753_1012056All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1157Open in IMG/M
3300031057|Ga0170834_113386097All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1776Open in IMG/M
3300031231|Ga0170824_122834054All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium858Open in IMG/M
3300031545|Ga0318541_10053091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2086Open in IMG/M
3300031545|Ga0318541_10601678All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium615Open in IMG/M
3300031546|Ga0318538_10111770All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1420Open in IMG/M
3300031561|Ga0318528_10065986All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1856Open in IMG/M
3300031561|Ga0318528_10387626All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium750Open in IMG/M
3300031564|Ga0318573_10165136All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1165Open in IMG/M
3300031572|Ga0318515_10084793All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1646Open in IMG/M
3300031573|Ga0310915_10661890All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium738Open in IMG/M
3300031616|Ga0307508_10518540All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium788Open in IMG/M
3300031640|Ga0318555_10400592All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium743Open in IMG/M
3300031680|Ga0318574_10442573All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium760Open in IMG/M
3300031681|Ga0318572_10100452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1632Open in IMG/M
3300031681|Ga0318572_10385316All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium833Open in IMG/M
3300031681|Ga0318572_10942988All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium512Open in IMG/M
3300031682|Ga0318560_10563142All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium617Open in IMG/M
3300031713|Ga0318496_10037021All Organisms → cellular organisms → Bacteria2489Open in IMG/M
3300031715|Ga0307476_10622411All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium800Open in IMG/M
3300031719|Ga0306917_10114146All Organisms → cellular organisms → Bacteria1958Open in IMG/M
3300031723|Ga0318493_10411890All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium740Open in IMG/M
3300031723|Ga0318493_10631235All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium598Open in IMG/M
3300031736|Ga0318501_10080842All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1588Open in IMG/M
3300031748|Ga0318492_10139874All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1215Open in IMG/M
3300031748|Ga0318492_10360600All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium761Open in IMG/M
3300031751|Ga0318494_10077889All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1796Open in IMG/M
3300031763|Ga0318537_10194381All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium755Open in IMG/M
3300031763|Ga0318537_10198100All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium747Open in IMG/M
3300031764|Ga0318535_10096941All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1288Open in IMG/M
3300031768|Ga0318509_10025562All Organisms → cellular organisms → Bacteria2824Open in IMG/M
3300031768|Ga0318509_10381712All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium788Open in IMG/M
3300031770|Ga0318521_10150064All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1323Open in IMG/M
3300031779|Ga0318566_10259592All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium861Open in IMG/M
3300031794|Ga0318503_10166708All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium712Open in IMG/M
3300031796|Ga0318576_10065777All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1603Open in IMG/M
3300031805|Ga0318497_10461859All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium711Open in IMG/M
3300031819|Ga0318568_10260819All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1074Open in IMG/M
3300031819|Ga0318568_10406502All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium848Open in IMG/M
3300031821|Ga0318567_10418688All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium759Open in IMG/M
3300031831|Ga0318564_10020353All Organisms → cellular organisms → Bacteria2747Open in IMG/M
3300031832|Ga0318499_10269090All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium660Open in IMG/M
3300031835|Ga0318517_10537361All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium526Open in IMG/M
3300031846|Ga0318512_10015491All Organisms → cellular organisms → Bacteria3047Open in IMG/M
3300031859|Ga0318527_10318584All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium662Open in IMG/M
3300031894|Ga0318522_10138716All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium914Open in IMG/M
3300031896|Ga0318551_10001895All Organisms → cellular organisms → Bacteria → Proteobacteria7508Open in IMG/M
3300031912|Ga0306921_10500221All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1413Open in IMG/M
3300031912|Ga0306921_11135574All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium874Open in IMG/M
3300031945|Ga0310913_10144570All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1640Open in IMG/M
3300031959|Ga0318530_10136939All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium990Open in IMG/M
3300032008|Ga0318562_10385167All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium815Open in IMG/M
3300032009|Ga0318563_10309887All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium854Open in IMG/M
3300032009|Ga0318563_10520471All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium642Open in IMG/M
3300032039|Ga0318559_10107732All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1239Open in IMG/M
3300032041|Ga0318549_10123401All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1142Open in IMG/M
3300032041|Ga0318549_10545918All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium520Open in IMG/M
3300032042|Ga0318545_10210652All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium696Open in IMG/M
3300032059|Ga0318533_10522264All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium870Open in IMG/M
3300032067|Ga0318524_10036798All Organisms → cellular organisms → Bacteria → Proteobacteria2284Open in IMG/M
3300032067|Ga0318524_10304817All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300032174|Ga0307470_10785392All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium736Open in IMG/M
3300032805|Ga0335078_10731725All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1219Open in IMG/M
3300032897|Ga0335071_10207447All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1913Open in IMG/M
3300033289|Ga0310914_11483037All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium581Open in IMG/M
3300033290|Ga0318519_10294623All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium948Open in IMG/M
3300034384|Ga0372946_0034172All Organisms → cellular organisms → Bacteria2267Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil41.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.29%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.68%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.45%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.45%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.84%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut1.84%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.23%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.23%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.23%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.23%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.23%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.61%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.61%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.61%
Ionic Liquid And High Solid EnrichedEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002909Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cmEnvironmentalOpen in IMG/M
3300003328Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-6-R (Metagenome Metatranscriptome, Counting Only)EngineeredOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300026376Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-BEnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026880Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027073Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes)EnvironmentalOpen in IMG/M
3300027530Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1010649513300001867Forest SoilLRLYVRGNRRDTLRYCRWMLERLTAVYSQGETPHLPL*
JGI12627J18819_1037662113300001867Forest SoilSEHLGLYVRGNRRDALRYSRWMLERLTGLYSQGETPHLPL*
JGI25382J43887_1017244223300002908Grasslands SoilLIERCERLGLYVHGNRRDARRYSRWMLERLAGLYSQGETPHLPL*
JGI25388J43891_103537713300002909Grasslands SoilERSERLKLYVYGNRRDALRYSRWMLERLTGLYSERETPHLPL*
Ga0006576J49610_103040813300003328Ionic Liquid And High Solid EnrichedSDTLKLYVRGTVRDARRHARWMLARVARVYTQGETPQLHL*
Ga0062387_10141000313300004091Bog Forest SoilRSEHLRLYVRGNQRDARRYSRWMLERLTGLYSQGETPHLSL*
Ga0066679_1095156613300005176SoilIERSERLKLYVYGNRRDALRYSRWMLERLTGLYSERETPHLPL*
Ga0070680_10043702623300005336Corn RhizosphereLIERSEELKLFVRGNKREAVRHSRSMLERITRFYAQGETPHLPL*
Ga0070680_10167509013300005336Corn RhizosphereTIQQILRMLIERSEKLKLFVRGSKRQTLRNARWILQRITRFYAQGETPQLPL*
Ga0070713_10156460613300005436Corn, Switchgrass And Miscanthus RhizosphereERCETLKLYVRGGRRDAVGHSRWMLERLASLYSQGETPLLPL*
Ga0070711_10087153713300005439Corn, Switchgrass And Miscanthus RhizosphereSVARELSMERYTVQQVLRMLVERSEKLKLFARGSKREALRNARWMLQRITRFYVQGETPQLPL*
Ga0070738_1010751533300005531Surface SoilETLKLYVRGNRRDAVRSACWLLERLASLYAQGETPHLHL*
Ga0070672_10106774623300005543Miscanthus RhizosphereLYVRGNQRDARRYSRWMLERLTGLYSQRETPHLSL*
Ga0066707_1012348513300005556SoilLGLYVHGNRRDARRYSRWMLERLAGLYSQGETPHLPL*
Ga0066670_1041126323300005560SoilQVLGMLIERCERLGLYVHGNRRDARRYSRWMLERLAGLYSQGETPHLPL*
Ga0068854_10226445123300005578Corn RhizosphereKLYVRGNRRDAIRSARWLLERLAGLYSQGETPHLRL*
Ga0070702_10073070323300005615Corn, Switchgrass And Miscanthus RhizosphereQVLRMLIERTERLDLYVRGNQRDARRYSRWMLERLTGLYSQRETPHLSL*
Ga0068852_10062600223300005616Corn RhizosphereTVQQVLRMLIERSEALRLYVRGGKREAVRHSRSMLERITRFYAQGETPQLPL*
Ga0068858_10030184813300005842Switchgrass RhizosphereLKLYVRGNRRDAVAHSRWMLERLASLYSQGETPQLSL*
Ga0075017_10127761133300006059WatershedsEQVLRLLIERCERRNLYVRGNQRAARRYARWMLERLTGLYSQGETPHLPL*
Ga0070712_10011021213300006175Corn, Switchgrass And Miscanthus RhizosphereILQILIERCEHMRLYVRGNRRDARRYSRWMLERLTGLYSQGETPHLPL*
Ga0070712_10199361913300006175Corn, Switchgrass And Miscanthus RhizosphereEALQLFVPGNRRDAIHHCRWMLERLARLYSQGETPQLSL*
Ga0070765_10094345913300006176SoilQILRMLIERSERLRLYVRGNRRDALSYSRWMLERLAGLYSQSETPHLPL*
Ga0105241_1242457613300009174Corn RhizosphereMRLYVRGNRRDARRYSRWMLERLTGLYSQGETPHLPL*
Ga0105238_1217922313300009551Corn RhizosphereILRMLIERSEALQLFVPGNRRDAIHHCRWMLERLARLYSQGETPQLSL*
Ga0116133_113038223300009623PeatlandRMLIERSESLGLYVRGNRRDALRYSRWMLERLTATYSQGETPHLPL*
Ga0123355_1036873013300009826Termite GutMLIERSEGLQLYVRGNRRDALRYSRWMLERLTGLYSQGETPHLPL*
Ga0123355_1186440313300009826Termite GutMLIERSEGLQLYVRGNRRDALRYSRWMLERLTGLYSQGETPNLPL*
Ga0126373_1055923023300010048Tropical Forest SoilVGERYSAEQVLRMLIDRSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL*
Ga0126373_1320835113300010048Tropical Forest SoilMLIERTAALRLYVRGNRRDALRYSRWMLERLTTVYSQGETPHLPL*
Ga0123356_1014081113300010049Termite GutLRMLIERSEGLQLYVRGNRRDALRYSRWMLERLTGLYSQGETPHLPL*
Ga0126372_1168406523300010360Tropical Forest SoilHMLIERTAALRLYVRGNRRDALRYSRWMLERLTQVYSQGETPHLPL*
Ga0134128_1110473013300010373Terrestrial SoilTWKLYVRGNRRDAVPSARWLLERLASLYAQGETPHLHL*
Ga0134128_1124517523300010373Terrestrial SoilLKLYVRGNRRDAIRSARWLLERLATLYRQGETPHLHL*
Ga0126383_1202740423300010398Tropical Forest SoilLRMLIERSDTLRLHIRGGRREALRQSRRMLERITRFYAQGETPQLPL*
Ga0137386_1047876623300012351Vadose Zone SoilYSVDQILRMVIERSESLELFVQCNRRDAIRHSRWMLERLVRLYSQGETPHLPL*
Ga0137360_1153185223300012361Vadose Zone SoilLRMLIERSERLKLYVCGNRRDALRYSRWMLERLTGLYSQGETPHLPL*
Ga0137361_1137835223300012362Vadose Zone SoilYSVEQVLRMLIERSERLKLYVCGNRRDALRYSRWMLERLTGLYSQGETPHLPL*
Ga0137358_1045985523300012582Vadose Zone SoilERLKLYVYGNRRDALRYSRWMLERLTGLYSQGETPHLPL*
Ga0137395_1091439013300012917Vadose Zone SoilAERLQLYVSGNRRDALRYSRWMLERLTGLYSQRETPHLPL*
Ga0126375_1038805923300012948Tropical Forest SoilEQVLNMLIERSAELRLYVRGNRRDALRYSRWMVERLTAVYSQGETPHLPL*
Ga0126369_1127336613300012971Tropical Forest SoilVLNMLIDRSAALQLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL*
Ga0126369_1232012313300012971Tropical Forest SoilQVLHMLIERTAALRLYVRGNRRDALRYTRWMLERLTAVYSQGETPHLPL*
Ga0134087_1023387423300012977Grasslands SoilVLRMLIERSERLKLYVYGNRRDALRYSRWMLERLTGLYSERETPHLPL*
Ga0157373_1147450113300013100Corn RhizosphereYTVQQILRMLIERSEALKLYVRTNKREAVRHSRSMLERITRFYAQGETPQLPL*
Ga0157370_1214365223300013104Corn RhizosphereEPYTVRQILRMLIERSEELKLFVRGNKREAVRHSRSMLERITRFYAQGETPHLPL*
Ga0163162_1335428323300013306Switchgrass RhizosphereLFVQGNRRDAIRHSRWMLERLARLYSQSETPQLAL*
Ga0181525_1056033823300014654BogMLIERCETLKLYVRGGRRDAVRHSRWMLERLASLYSQGETPLLPL*
Ga0182034_1075274723300016371SoilYSVEQVLHMLIERSGALRLYVRGNQRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0182034_1152772423300016371SoilMLIDRSAALQLYVRGNRREALRYSRWMLARLTAVYSRGETPHLPL
Ga0187825_1009091113300017930Freshwater SedimentLIERSDHLGLYLRGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0187821_1043501423300017936Freshwater SedimentRNLDSAPYSVEQVLRMLIERSAELALYVSGNRRDALRYSRWMLERLTAVYSQGETPQLPL
Ga0187809_1006207923300017937Freshwater SedimentLKLYVRGNRRDALRSARWLLERLASLYAQGETPHLRL
Ga0187783_1110376423300017970Tropical PeatlandLRMLIERSERLQLYLRGNRRDALYYSRWMLERLTGLYSQGGTPHLPL
Ga0187781_1045626613300017972Tropical PeatlandVERYSVAQILRMLIERSERLQLHVRGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0187773_1125685613300018064Tropical PeatlandEQILRMLIERSERLNLHVRGNCRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0187770_1002193313300018090Tropical PeatlandVAQILRMLIERSERLRLHVRGNRRDALRYSRWMLERLTGLYSQGETPQLPL
Ga0066669_1037900713300018482Grasslands SoilGMLIERCERLGLYVHGNRRDARRYSRWMLERLAGLYSQGETPHLPL
Ga0210404_1006444633300021088SoilTERYNVEQILRMLIERSEHLGLYVRGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0210404_1015722723300021088SoilQQVLRMLIERSTRLKLYVRGNRRDARRYARWMLERLTGLYSQGETPHLPL
Ga0210406_1073684113300021168SoilQVLRLLIERCERRDLYVRGSQRAARRYARWMLERLTGLYSQGETPHLPL
Ga0210405_1006839613300021171SoilQILRMLVERSARLQLYVRGNRRDALRYSRWMLERLAGLYSQGETPHLPL
Ga0210396_1007292113300021180SoilQQVLRMLIERSEALNLYVRGNQRDAKRYSRWMLERLTGLYSQGETPHLPL
Ga0210396_1122659023300021180SoilYSVQQVLRMLIERSERLQLYVRGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0213872_1015564313300021361RhizosphereERYTAEQVLRMLIERSERLRLYVRGNRRDALRYSRWMLERLTGLYSQGETPQLAL
Ga0210385_1028539523300021402SoilMLIERTEALNLYVRGNQRDAKRYSRWMLERLTGLYSQGETPHLPL
Ga0210385_1051487723300021402SoilERLQLYVRGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0210390_1107483023300021474SoilLYVRGNRRDALRYSRWMLERLAGLYSQGETPHLPL
Ga0242655_1030291413300022532SoilRMLIERSEHLGLYVRGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0207685_1025553013300025905Corn, Switchgrass And Miscanthus RhizosphereRCEHMRLHLRGNRRDARRYSRWMLERLTGLYSQGETPHLPL
Ga0207684_1149708413300025910Corn, Switchgrass And Miscanthus RhizosphereERTERLDLYVRGNQRDARRYSRWMLERLTGLYSQRETPHLSL
Ga0207671_1033006623300025914Corn RhizosphereDQVLRMLIERTERLDLYVRGNQRDARRYSRWMLERLTGLYSQRETPHLSL
Ga0207671_1101309323300025914Corn RhizosphereRMLIERSESLQLFVQGNRRDAIRHSRWMLGRLARLYSQGETPQLAL
Ga0207646_1187907733300025922Corn, Switchgrass And Miscanthus RhizosphereAELRLYVRGNRRDALRYSRWMVERLTAVYSQGETPHLPL
Ga0207694_1050816213300025924Corn RhizosphereMLIDRCEALKLYVRGNRRDAEGYSRWMLERLASLYSQGETPQLPL
Ga0207691_1094094723300025940Miscanthus RhizosphereDLYVRGNQRDARRYSRWMLERLTGLYSQRETPHLSL
Ga0207661_1031450633300025944Corn RhizosphereMLIERSESLRLFVQGNRRDALHHSRWMLERLTRLYSQGETPHLQL
Ga0207640_1197384123300025981Corn RhizosphereSETLKLYVRGNRRDAIRSARWLLERLAGLYSQGETPHLRL
Ga0207698_1085000713300026142Corn RhizosphereTVQQVLRMLIERSEALRLYVRGGKREAVRHSRSMLERITRFYAQGETPQLPL
Ga0209438_106982713300026285Grasslands SoilERSERLKLYVYGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0209240_125960423300026304Grasslands SoilYSVEQVLRMLIERSERLKLYVYGNRRDALRYSRWMLERLTGLYSERETPHLPL
Ga0209239_104569613300026310Grasslands SoilLIERSERLKLYVYGNRRDALRYSRWMLERLTGLYSERETPHLPL
Ga0257149_100402613300026355SoilERSERLKLYVNGNRRDALRYSRWMLERLTGLYSERETPHLPL
Ga0257167_103164213300026376SoilERLKLYVCGRRRDALRYSRWMLERLTELYSQGETPHLPL
Ga0209474_1025383713300026550SoilQVLRMLIERSERLKLYVYGNRRDALRYSRWMLERLTGLYSERETPHLPL
Ga0209623_100815513300026880Forest SoilKLYVCGSRRDALRYSRWMLERLTELYSEGETPHLPL
Ga0207852_100907613300026959Tropical Forest SoilEHYSVLQILHMLIERSEALQLHVRGNRRDALRYSRWMLERLAGLYSQNETPHLPL
Ga0208366_101436213300027073Forest SoilLKLYVCGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0209216_105705723300027530Forest SoilQILGILIERTEALELWVQGSQREAVWYSRWLLARISRLYSQGETPHLPL
Ga0209419_100507113300027537Forest SoilQVLRMLIERSERLKLYVCGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0209420_107430123300027648Forest SoilLQLYVRGNRRDALRYSRWMLERLTGLYSQGETPHLPL
Ga0209275_1025249013300027884SoilGLYVRGNQRDARRYARWMLERLTGLYSQGETPHLSL
Ga0209380_1026541413300027889SoilEQVLRMLIERSERLKLYVCGNRRDALRYSRWMLERLTGLYSDGETPHLPL
Ga0209583_1005181713300027910WatershedsLIERSERLRLHVHGNRRNALRYSRWMLERLTGLYSEGETPHLPL
Ga0302235_1032921923300028877PalsaLYVRGNRREALRDARAMLARITRLYAAGETPHLPL
Ga0311338_1208927713300030007PalsaTLKLYVRGGRRDAVAHARWMLGRLASLYSQGETPLLPL
Ga0265753_101205613300030862SoilMKLHVRGNRRDALYYSRWMLERLTGLYSQGETPHLPL
Ga0170834_11338609733300031057Forest SoilDQVLRLLIERCERRDLYVRGSQREERRYARWMLERLTGLYSQGETPHLPL
Ga0170824_12283405413300031231Forest SoilALKLHVRGNRRDAGRHVRWMLIRLARLYAQGETPHFPL
Ga0318541_1005309113300031545SoilVVQVLHMLIDRSAALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0318541_1060167823300031545SoilLYVRGARRDALHYSRWMLERLTVVYSQGETPHMPL
Ga0318538_1011177013300031546SoilVEQVLRMLIERSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL
Ga0318528_1006598613300031561SoilHMLIDRSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL
Ga0318528_1038762613300031561SoilYSVVQVLHMLIDRSAALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0318573_1016513613300031564SoilVLRMLIERSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL
Ga0318515_1008479333300031572SoilHMLIERSGALRLYVRGNQRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0310915_1066189023300031573SoilIERSGALRLYVRGNQRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0307508_1051854023300031616EctomycorrhizaILRMLIERSESLQLFVQGNRRDAIRHSRWMLERLVRLYSQGETPHLPL
Ga0318555_1040059213300031640SoilVEQVLHMLIERSAALRLYVRGNRRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0318574_1044257323300031680SoilQVLHMLIERSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL
Ga0318572_1010045213300031681SoilYSVEQVLHMLIERSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL
Ga0318572_1038531623300031681SoilLGLYVRGNRRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0318572_1094298813300031681SoilHMLIDRSAALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0318560_1056314213300031682SoilVLHMLIDRSAALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0318496_1003702143300031713SoilTVALARERYSVVQVLHMLIDRSAALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLP
Ga0307476_1062241123300031715Hardwood Forest SoilMLIERSAALGLYVRGARRDALHYSRWMLERLTAVYSHGETPHLPL
Ga0306917_1011414643300031719SoilLRLYVRGNRRDALRYSRWMVERLTAVYSQGETPHLPL
Ga0318493_1041189013300031723SoilYSVEQVLRMLIERSAGLRLYVRGNRREALRYSRWMLERLTTVYSQGETPHLPL
Ga0318493_1063123513300031723SoilQVLHMLIERSAALGLYVRGNRRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0318501_1008084213300031736SoilMLIDRSAALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0318492_1013987413300031748SoilHMLIERSAGLRLYVRGNRREALRYSRWMLERLTTVYSQGETPNLAL
Ga0318492_1036060023300031748SoilVALASERYSVVQVLHMLIDRSAALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0318494_1007788913300031751SoilLYVRGNRRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0318537_1019438123300031763SoilEQVLHMLIERSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL
Ga0318537_1019810013300031763SoilLRMLIERSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL
Ga0318535_1009694133300031764SoilLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0318509_1002556243300031768SoilVLNMLIERSAELRLYVRGNRRDALRYSRWMVERLTAVYSQGETPHLPL
Ga0318509_1038171223300031768SoilMLIERSAGLRLYVRGNRREALRYSRWMLERLTTVYSQGETPHLPL
Ga0318521_1015006433300031770SoilGLYVRGARRDALHYSRWMLERLTAVYSQGETPHMPL
Ga0318566_1025959213300031779SoilLIERSEHLRLYVRGNQRDARRYSRWMLERLTGLYSQGETPHLSL
Ga0318503_1016670813300031794SoilVQVLHMLIDRSAALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0318576_1006577713300031796SoilVLRMLIERSAALGLYVRGARRDALHYSRWMLERLTAVYSQGETPHMPL
Ga0318497_1046185923300031805SoilGSERYSAEQVLRMLIERSAALGLYVRGARRDALHYSRWMLERLTAVYSQGETPHMPL
Ga0318568_1026081923300031819SoilGLYVRGNRRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0318568_1040650223300031819SoilSVEQVLRMLIERSAGLRLYVCGNRREALRYSRWMLERLTTVYSQGETPHLPL
Ga0318567_1041868823300031821SoilLHMLIERSAGLRLYVRGNRREALRYSRWMLERLTTVYSQGETPHLAL
Ga0318564_1002035313300031831SoilLYVRGNRREALRYSRWMLERLTTVYSQGETPHLAL
Ga0318499_1026909023300031832SoilVEQVLHMLIDRSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL
Ga0318517_1053736113300031835SoilYSAEQVLRMLIERSAALGLYVRGARRDALHYSRWMLERLTAVYSQGETPHMPL
Ga0318512_1001549133300031846SoilMLIERSAGLRLYVRGNRREALRYSRWMLERLTTVYSQGETPHLAL
Ga0318527_1031858423300031859SoilVLHMLIERSAELRLYVRGNRRDVLRYSRWMLERLTAVYSQGETPHLPL
Ga0318522_1013871613300031894SoilMLIERSAGLRLYVCGNRREALRYSRWMLERLTTVYSQGETPHLPL
Ga0318551_1000189513300031896SoilVLHMLIERSGALRLYVRGNQRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0306921_1050022113300031912SoilRSAALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0306921_1113557423300031912SoilHLQLYVRGNCRDALRYSRWMLGRLTGLYSQGETPHLPL
Ga0310913_1014457033300031945SoilLHMLIDRSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL
Ga0318530_1013693923300031959SoilERSAALRLYVRGNRRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0318562_1038516723300032008SoilSLASERYSVVQVLHMLIDRSAALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0318563_1030988723300032009SoilALGLYVRGNRRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0318563_1052047123300032009SoilALQLYVRGNRREALRYSRWMLERLTAVYSRGETPHLPL
Ga0318559_1010773213300032039SoilYSVEQVLRMLIERSAELALYVRGNRRDALRYSRWMLERLTAVYSQGETPQLPL
Ga0318549_1012340113300032041SoilRMLIERSAGLRLYVCGNRREALRYSRWMLERLTTVYSQGETPHLPL
Ga0318549_1054591813300032041SoilAGLRLYVRGNRREALRYSRWMLERLTTVYSQGETPHLAL
Ga0318545_1021065213300032042SoilVLHMLIERSAALRLYVRGNRREALRYSRWMLERLTAVYSQGETPHLPL
Ga0318533_1052226413300032059SoilAGLRLYVCGNRREALRYSRWMLERLTTVYSQGETPHLPL
Ga0318524_1003679813300032067SoilRSAALGLYVRGNRRDALRYSRWMLERLTAVYSQGETPHLPL
Ga0318524_1030481733300032067SoilGLYVRGARRDALHYSRWMLERLTVVYSQGETPHMPL
Ga0307470_1078539223300032174Hardwood Forest SoilPYSVDQVLRLLIERCERRDLYVRGSQREARRYARWMLERLTGLYSQGETPHLPL
Ga0335078_1073172513300032805SoilIERCTQLQLHVRGNRREALRYSRWMLERLTGLYSQGATPQLPL
Ga0335071_1020744713300032897SoilNMLIERSERLGLYVRGNRRDARRYTRWMLERLTGLYSQGETPQLPL
Ga0310914_1148303723300033289SoilVLRMLIERSAGLRLYVRGNRREALRYSRWMLERLTTVYSQGETPHLPL
Ga0318519_1029462313300033290SoilLIERSAGLRLYVCGNRREALRYSRWMLERLTTVYSQGETPHLPL
Ga0372946_0034172_2131_22653300034384SoilLIERSESLQLFVQGNRRDAIRHSRWMLERLVRLYSQGETPHLPL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.