Metagenome / Metatranscriptome Family F039802

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F039802
Family Type	Metagenome / Metatranscriptome
Number of Sequences	163
Average Sequence Length	38 residues
Representative Sequence	MWIIWYVAMMASLRAMGLAPSPVPVRTDEDRTPYGDI
Number of Associated Samples	112
Number of Associated Scaffolds	163

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	74.23 %
% of genes near scaffold ends (potentially truncated)	26.99 %
% of genes from short scaffolds (< 2000 bps)	87.12 %
Associated GOLD sequencing projects	108
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (55.828 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (16.564 % of family members)
Environment Ontology (ENVO)	Unclassified (37.423 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (69.939 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 26.15% β-sheet: 0.00% Coil/Unstructured: 73.85%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.39
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 163 Family Scaffolds
PF02481	DNA_processg_A	36.81
PF01751	Toprim	26.38
PF13368	Toprim_C_rpt	1.84
PF02660	G3P_acyltransf	0.61
PF02548	Pantoate_transf	0.61
PF13577	SnoaL_4	0.61
PF00571	CBS	0.61
PF01510	Amidase_2	0.61

COG ID	Name	Functional Category	% Frequency in 163 Family Scaffolds
COG0758	Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake	Replication, recombination and repair [L]	73.62
COG0344	Phospholipid biosynthesis protein PlsY, probable glycerol-3-phosphate acyltransferase	Lipid transport and metabolism [I]	0.61
COG0413	Ketopantoate hydroxymethyltransferase	Coenzyme transport and metabolism [H]	0.61

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	55.83 %
Unclassified	root	N/A	44.17 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	55.83 %
Unclassified	root	N/A	44.17 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	55.83 %
Unclassified	root	N/A	44.17 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	53.37 %
Unclassified	root	N/A	44.17 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.61 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	50.92 %
Unclassified	root	N/A	44.17 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.61 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.17 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	28.83 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.61 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.61 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.17 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	10.43 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	7.98 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.61 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.61 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.61 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.17 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	7.98 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.68 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.61 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.61 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.61 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.61 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.17 %
Methylobacterium aquaticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	7.98 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.68 %
Actinoplanes	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes	0.61 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.61 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.61 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.61 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.17 %
Methylobacterium aquaticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	7.98 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.68 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.61 %
Actinoplanes globisporus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus	0.61 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.61 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.61 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.61 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2065487018\|GPINP_F5MS3JC02F96T1	Not Available	502	Open in IMG/M
2124908045\|KansclcFeb2_ConsensusfromContig824991	Not Available	806	Open in IMG/M
2124908045\|KansclcFeb2_ConsensusfromContig99619	Not Available	628	Open in IMG/M
2170459003\|FZN2CUW02H59IV	Not Available	511	Open in IMG/M
3300000550\|F24TB_10179078	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1211	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10030927	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1445	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10032318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1409	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10178303	Not Available	503	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1024538	All Organisms → cellular organisms → Bacteria → Proteobacteria	1128	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1044869	Not Available	796	Open in IMG/M
3300001867\|JGI12627J18819_10053125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1690	Open in IMG/M
3300002908\|JGI25382J43887_10193813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	984	Open in IMG/M
3300004629\|Ga0008092_11222635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	725	Open in IMG/M
3300005181\|Ga0066678_10031072	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2907	Open in IMG/M
3300005332\|Ga0066388_103557401	Not Available	795	Open in IMG/M
3300005363\|Ga0008090_10044908	All Organisms → cellular organisms → Bacteria → Proteobacteria	1369	Open in IMG/M
3300005363\|Ga0008090_15873323	Not Available	932	Open in IMG/M
3300005540\|Ga0066697_10453253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	737	Open in IMG/M
3300005552\|Ga0066701_10023136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3124	Open in IMG/M
3300005554\|Ga0066661_10053496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2317	Open in IMG/M
3300005555\|Ga0066692_10434780	Not Available	835	Open in IMG/M
3300005556\|Ga0066707_10032012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2920	Open in IMG/M
3300005559\|Ga0066700_10235922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1274	Open in IMG/M
3300005575\|Ga0066702_10422082	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	816	Open in IMG/M
3300005576\|Ga0066708_10497973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	785	Open in IMG/M
3300005587\|Ga0066654_10149168	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1185	Open in IMG/M
3300005713\|Ga0066905_100009669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4488	Open in IMG/M
3300005713\|Ga0066905_100276587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1305	Open in IMG/M
3300005713\|Ga0066905_100280249	All Organisms → cellular organisms → Bacteria	1298	Open in IMG/M
3300005713\|Ga0066905_100293312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1273	Open in IMG/M
3300005713\|Ga0066905_100796415	Not Available	819	Open in IMG/M
3300005713\|Ga0066905_100844259	Not Available	797	Open in IMG/M
3300005713\|Ga0066905_102018148	Not Available	535	Open in IMG/M
3300005713\|Ga0066905_102042757	Not Available	532	Open in IMG/M
3300005764\|Ga0066903_102088168	Not Available	1090	Open in IMG/M
3300005764\|Ga0066903_103259601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	877	Open in IMG/M
3300005764\|Ga0066903_103641461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	829	Open in IMG/M
3300005764\|Ga0066903_104331564	Not Available	758	Open in IMG/M
3300005764\|Ga0066903_104514685	Not Available	742	Open in IMG/M
3300005764\|Ga0066903_105915655	Not Available	641	Open in IMG/M
3300005937\|Ga0081455_10015330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	7452	Open in IMG/M
3300005983\|Ga0081540_1006286	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus	8693	Open in IMG/M
3300006028\|Ga0070717_10097069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	2496	Open in IMG/M
3300006028\|Ga0070717_10302502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1422	Open in IMG/M
3300006028\|Ga0070717_11687027	Not Available	573	Open in IMG/M
3300006034\|Ga0066656_11142185	Not Available	501	Open in IMG/M
3300006046\|Ga0066652_100539657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1090	Open in IMG/M
3300006058\|Ga0075432_10147073	Not Available	903	Open in IMG/M
3300006172\|Ga0075018_10481269	Not Available	644	Open in IMG/M
3300006173\|Ga0070716_100818100	Not Available	723	Open in IMG/M
3300006173\|Ga0070716_101257351	Not Available	597	Open in IMG/M
3300006791\|Ga0066653_10195873	Not Available	1021	Open in IMG/M
3300006796\|Ga0066665_10598383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	887	Open in IMG/M
3300006796\|Ga0066665_11562499	Not Available	518	Open in IMG/M
3300006797\|Ga0066659_10214835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1417	Open in IMG/M
3300006804\|Ga0079221_10896573	Not Available	650	Open in IMG/M
3300006844\|Ga0075428_100119637	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2867	Open in IMG/M
3300006854\|Ga0075425_100054752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	4468	Open in IMG/M
3300006854\|Ga0075425_102728100	Not Available	544	Open in IMG/M
3300006854\|Ga0075425_103004907	Not Available	516	Open in IMG/M
3300006914\|Ga0075436_100390084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	1008	Open in IMG/M
3300006939\|Ga0081244_1504355	Not Available	675	Open in IMG/M
3300007076\|Ga0075435_100440980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1122	Open in IMG/M
3300007255\|Ga0099791_10057027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1754	Open in IMG/M
3300009147\|Ga0114129_10820287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	1185	Open in IMG/M
3300009162\|Ga0075423_10340428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1572	Open in IMG/M
3300009792\|Ga0126374_10702575	Not Available	760	Open in IMG/M
3300009792\|Ga0126374_10725185	Not Available	750	Open in IMG/M
3300010046\|Ga0126384_10212154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	1540	Open in IMG/M
3300010046\|Ga0126384_10451429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1098	Open in IMG/M
3300010046\|Ga0126384_10999481	Not Available	761	Open in IMG/M
3300010046\|Ga0126384_11167387	Not Available	709	Open in IMG/M
3300010047\|Ga0126382_10013360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4033	Open in IMG/M
3300010159\|Ga0099796_10340075	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300010322\|Ga0134084_10014686	Not Available	2031	Open in IMG/M
3300010323\|Ga0134086_10307581	Not Available	617	Open in IMG/M
3300010358\|Ga0126370_11314550	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	678	Open in IMG/M
3300010359\|Ga0126376_10302517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1391	Open in IMG/M
3300010359\|Ga0126376_12851183	Not Available	533	Open in IMG/M
3300010360\|Ga0126372_10296305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	1419	Open in IMG/M
3300010360\|Ga0126372_10561776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1086	Open in IMG/M
3300010360\|Ga0126372_11877138	Not Available	644	Open in IMG/M
3300010361\|Ga0126378_10937917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	971	Open in IMG/M
3300010361\|Ga0126378_11591253	Not Available	742	Open in IMG/M
3300010366\|Ga0126379_10495526	Not Available	1292	Open in IMG/M
3300010366\|Ga0126379_11953917	Not Available	689	Open in IMG/M
3300010366\|Ga0126379_12982688	Not Available	566	Open in IMG/M
3300010376\|Ga0126381_100487035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1737	Open in IMG/M
3300010398\|Ga0126383_11059476	Not Available	900	Open in IMG/M
3300010863\|Ga0124850_1120876	Not Available	675	Open in IMG/M
3300010863\|Ga0124850_1134632	Not Available	598	Open in IMG/M
3300011106\|Ga0151489_1714148	Not Available	586	Open in IMG/M
3300012022\|Ga0120191_10017978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	974	Open in IMG/M
3300012198\|Ga0137364_10208884	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1433	Open in IMG/M
3300012199\|Ga0137383_10118601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1928	Open in IMG/M
3300012199\|Ga0137383_10301435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1173	Open in IMG/M
3300012208\|Ga0137376_10189577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	1777	Open in IMG/M
3300012354\|Ga0137366_10212911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1440	Open in IMG/M
3300012355\|Ga0137369_10298792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1195	Open in IMG/M
3300012362\|Ga0137361_11324446	Not Available	644	Open in IMG/M
3300012948\|Ga0126375_11213470	Not Available	628	Open in IMG/M
3300012951\|Ga0164300_10525722	Not Available	682	Open in IMG/M
3300012986\|Ga0164304_10505966	Not Available	883	Open in IMG/M
3300015373\|Ga0132257_103905313	Not Available	542	Open in IMG/M
3300015374\|Ga0132255_100141878	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3337	Open in IMG/M
3300016341\|Ga0182035_10229225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	1487	Open in IMG/M
3300016371\|Ga0182034_10550369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	968	Open in IMG/M
3300018431\|Ga0066655_10069435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1883	Open in IMG/M
3300018433\|Ga0066667_10435746	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1067	Open in IMG/M
3300018468\|Ga0066662_11464637	Not Available	709	Open in IMG/M
3300018468\|Ga0066662_11900244	Not Available	623	Open in IMG/M
3300020579\|Ga0210407_11226058	Not Available	563	Open in IMG/M
3300020581\|Ga0210399_10380408	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	1178	Open in IMG/M
3300020581\|Ga0210399_10492518	All Organisms → cellular organisms → Bacteria → Proteobacteria	1019	Open in IMG/M
3300021168\|Ga0210406_11289727	Not Available	527	Open in IMG/M
3300021178\|Ga0210408_10300730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1279	Open in IMG/M
3300021439\|Ga0213879_10005293	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2530	Open in IMG/M
3300021560\|Ga0126371_10642943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1209	Open in IMG/M
3300021560\|Ga0126371_11474643	All Organisms → cellular organisms → Bacteria	809	Open in IMG/M
3300021560\|Ga0126371_12068556	Not Available	686	Open in IMG/M
3300021560\|Ga0126371_12202533	Not Available	665	Open in IMG/M
3300021560\|Ga0126371_12485643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	627	Open in IMG/M
3300021560\|Ga0126371_12889780	Not Available	582	Open in IMG/M
3300024288\|Ga0179589_10423380	Not Available	612	Open in IMG/M
3300025898\|Ga0207692_11036529	Not Available	542	Open in IMG/M
3300025939\|Ga0207665_11368155	Not Available	564	Open in IMG/M
3300026304\|Ga0209240_1004662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5178	Open in IMG/M
3300026310\|Ga0209239_1015943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3844	Open in IMG/M
3300026310\|Ga0209239_1050656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1874	Open in IMG/M
3300026327\|Ga0209266_1175637	Not Available	821	Open in IMG/M
3300026528\|Ga0209378_1109478	Not Available	1206	Open in IMG/M
3300026538\|Ga0209056_10166027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1664	Open in IMG/M
3300026550\|Ga0209474_10022916	Not Available	4795	Open in IMG/M
3300027548\|Ga0209523_1040291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	949	Open in IMG/M
3300027646\|Ga0209466_1001783	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4370	Open in IMG/M
3300027874\|Ga0209465_10121350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1289	Open in IMG/M
3300027874\|Ga0209465_10436049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	655	Open in IMG/M
3300027903\|Ga0209488_10843577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	646	Open in IMG/M
3300028718\|Ga0307307_10040171	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1351	Open in IMG/M
3300028881\|Ga0307277_10000014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	56671	Open in IMG/M
3300031543\|Ga0318516_10060441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2083	Open in IMG/M
3300031543\|Ga0318516_10180840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1215	Open in IMG/M
3300031543\|Ga0318516_10424198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	765	Open in IMG/M
3300031544\|Ga0318534_10106447	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1607	Open in IMG/M
3300031545\|Ga0318541_10138966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	1327	Open in IMG/M
3300031545\|Ga0318541_10209141	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	1080	Open in IMG/M
3300031545\|Ga0318541_10511981	Not Available	671	Open in IMG/M
3300031573\|Ga0310915_10029376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3418	Open in IMG/M
3300031573\|Ga0310915_10107094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1895	Open in IMG/M
3300031724\|Ga0318500_10333897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	746	Open in IMG/M
3300031744\|Ga0306918_10311138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1215	Open in IMG/M
3300031744\|Ga0306918_10707078	Not Available	788	Open in IMG/M
3300031770\|Ga0318521_10471988	Not Available	752	Open in IMG/M
3300031794\|Ga0318503_10118548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	846	Open in IMG/M
3300031846\|Ga0318512_10281621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	824	Open in IMG/M
3300031893\|Ga0318536_10188090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1051	Open in IMG/M
3300031912\|Ga0306921_12453015	Not Available	542	Open in IMG/M
3300031941\|Ga0310912_11248682	Not Available	564	Open in IMG/M
3300031954\|Ga0306926_12451374	Not Available	573	Open in IMG/M
3300032001\|Ga0306922_11011249	Not Available	857	Open in IMG/M
3300032001\|Ga0306922_11233792	Not Available	759	Open in IMG/M
3300032054\|Ga0318570_10062174	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum	1573	Open in IMG/M
3300032076\|Ga0306924_11703897	Not Available	660	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.02%
Host-Associated	Host-Associated	7.98%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	91.41%
Plants	Host-Associated → Plants	7.98%
Aquatic	Environmental → Aquatic	0.61%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	91.41%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.52%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.45%
Sediment	Environmental → Aquatic → Sediment	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	73.01%
Loam	Environmental → Terrestrial → Soil → Loam	18.40%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.52%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.23%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.23%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	28.83%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	21.47%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	19.63%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	13.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.52%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.29%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	2.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.23%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.23%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.61%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.61%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.61%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	16.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	14.11%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	12.88%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	12.27%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.52%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.52%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.29%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.91%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	3.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.45%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	2.45%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.23%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.23%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.23%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.23%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.61%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.61%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.61%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.61%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.61%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2065487018	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
2124908045	Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011	Environmental	Open in IMG/M
2170459003	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300002908	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental	Open in IMG/M
3300004629	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006939	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010863	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)	Environmental	Open in IMG/M
3300011106	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300012022	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021439	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026327	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300027548	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300028718	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194	Environmental	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031724	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031794	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23	Environmental	Open in IMG/M
3300031846	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032054	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPINP_00371430	2065487018	Soil	MWIVMYIAMMASLRAMGLAPGFVPVRTDEDRPPFGEI
KansclcFeb2_16490030	2124908045	Soil	MWIIWYIGMMASLRAMGLAPGVVPVRIDEDRKPYGDF
KansclcFeb2_09812290	2124908045	Soil	MWIIWYIGMMASLRAMGFAPNLVPIRTDEDRTPFDGV
E4A_10276500	2170459003	Grass Soil	AMWIIMYVVMMASLRAMGVAPSVVPVRTDEDPRPPFGEI
F24TB_101790782	3300000550	Soil	MWIIWYIGMMASLRAMGLAPNLLPIRTDEDRTPFGDV*
AF_2010_repII_A1DRAFT_100309272	3300000597	Forest Soil	MWIIWYVAMMASLRAVGLAPNPVPVRIXEDRKPYGDF*
AF_2010_repII_A1DRAFT_100323182	3300000597	Forest Soil	MWIIWYIGMMASLRAMGLAPSLVPIKIDEDRKPFGDM*
AF_2010_repII_A1DRAFT_101783031	3300000597	Forest Soil	MWIIWYVAMMASLRAMGLAPSPVLVRTDVDRKPYGDF*
AF_2010_repII_A100DRAFT_10245383	3300000655	Forest Soil	MWIIWYVAMVASLRAMGLAPSPVPVRTDEDRTPFTDI*
AF_2010_repII_A100DRAFT_10448692	3300000655	Forest Soil	MWIIWYIGLMASLRAMGLAPSLVPIKIDEDRKPFGDM*
JGI12627J18819_100531253	3300001867	Forest Soil	MWIIWYIGMMASLRAMGLAPGVVPVRTDEDRKPYGDF*
JGI25382J43887_101938131	3300002908	Grasslands Soil	DWAMWIIWYVAMVASLRAMGLAPSVVPVRTDEDRTPFGDI*
Ga0008092_112226351	3300004629	Tropical Rainforest Soil	GDWAMWIIWYVAMVASLRATGLAPSPVPVRTDEDRTPFTDI*
Ga0066678_100310722	3300005181	Soil	LIRGDWAMWIIWYIGMMASLRAMGLAPGVVPVRIDEDRKPYGDF*
Ga0066388_1035574011	3300005332	Tropical Forest Soil	VGDGAMWIIWYIGLMASLRAMGLAPSLVPIKIDEDRKPFGDM*
Ga0008090_100449082	3300005363	Tropical Rainforest Soil	VGFVGDGAMWIIWYIGLMASLRAMGLAPSLVPIKIDEDRKPFGDM*
Ga0008090_158733231	3300005363	Tropical Rainforest Soil	LGYVDIWYVAMMASLRAMGLAPSPVLVRTDVDRKPYGDF*
Ga0066697_104532532	3300005540	Soil	GSRAMWIIMYIAMVASLRAMGLAPSMVPVRTDEDRPPFGEI*
Ga0066701_100231362	3300005552	Soil	MWIIMYIAVMASLRAMGLAPDLVQVRTDDDHRPPYGDI*
Ga0066661_100534962	3300005554	Soil	MWIIWYIGMMASLRAMGLAPGVVPVRIDEDRKPYGDF*
Ga0066692_104347801	3300005555	Soil	MWIIWYVAMVASLRAMGLAPSVVPVRTDEDRTPFGDI*
Ga0066707_100320124	3300005556	Soil	MWIIWYIGMMASLRTMGLAPGVVPVRIDEDRKPYGDF*
Ga0066700_102359221	3300005559	Soil	MWIIMYIAVMASLQAMGLEPSLVPVKTDDDDRPPCGDI*
Ga0066702_104220822	3300005575	Soil	MWIIMYIAMVASLRAMGLAPSMVPVRTDEDRPPFGEI*
Ga0066708_104979733	3300005576	Soil	IMYIAVMASLRAMGLAPDLVQVRTDDDHRPPYGDI*
Ga0066654_101491681	3300005587	Soil	AMWIIMYIAVMASLRAMGLAPDLVQVRTDDDHRPPYGDI*
Ga0066905_1000096695	3300005713	Tropical Forest Soil	MWIIMYIAMVASMRAMGLAPSLVPVRTDEDRPPFGEM*
Ga0066905_1002765872	3300005713	Tropical Forest Soil	MWIIMYVAVMASLRAMGLAPSFVPIRNDDDRRPPFGEI*
Ga0066905_1002802493	3300005713	Tropical Forest Soil	MWIVFYVAMMGSLRAMGLAPNLMQVETDEDLDSEI*
Ga0066905_1002933122	3300005713	Tropical Forest Soil	MWIIWYIGMMASLRAMGLAPGVVPVRINEDRKPYGDF*
Ga0066905_1007964153	3300005713	Tropical Forest Soil	MWIIWYVAMVASLRALGLAPSPVPVRTDEDRKPYGDF*
Ga0066905_1008442591	3300005713	Tropical Forest Soil	MWIIWYVAMMASLRAMGLAPIAVPVRTDDERTPFSDI*
Ga0066905_1020181481	3300005713	Tropical Forest Soil	MWIIWYVAMVASLRAIGLAPSPVPVRTDEDRKPYGDF*
Ga0066905_1020427571	3300005713	Tropical Forest Soil	MWIIWYVAMVASLRAMGLAPSPVPVRTDEDRKPYGDF*
Ga0066903_1020881682	3300005764	Tropical Forest Soil	MWIIWYVAMVASLRAMGLAPSPVPVRTDEDRKPYGEF*
Ga0066903_1032596012	3300005764	Tropical Forest Soil	MWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYG
Ga0066903_1036414613	3300005764	Tropical Forest Soil	GDWAMWIIWYVAMMASLRAMGLAPSPVLVRTDVDRKPYGDF*
Ga0066903_1043315642	3300005764	Tropical Forest Soil	MWIIWYVAMVASLRALGLAPSVVPVRIDEDRTPYGDV*
Ga0066903_1045146851	3300005764	Tropical Forest Soil	MWIIWYVAMMASLRAMGLAPIAVPVRTDEERTPFCDI*
Ga0066903_1059156552	3300005764	Tropical Forest Soil	FRLGEWAMWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF*
Ga0081455_100153302	3300005937	Tabebuia Heterophylla Rhizosphere	MWIIWYIGMMASLRAMGLAPSLVPIRTDEDRKPFGDM*
Ga0081540_10062863	3300005983	Tabebuia Heterophylla Rhizosphere	MWIIMYIAMVASLRAMGLAPSMVPVRTDEDRPPFGEM*
Ga0070717_100970693	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MWIVMYIAMMASLRAMGLAPGFVPVRTDEDRPPFGEI*
Ga0070717_103025021	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MWIIMYVAMIASLRAMGLAPSSVPVRTDDDHRPPFGEI*
Ga0070717_116870271	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	AMWIIWYIGMMASLRAMGLAPGVVPVRIDEDRKPYGDF*
Ga0066656_111421851	3300006034	Soil	MWIIWYIGMLASLRAMGLAHGVVPVRIDEDRKPYGDF*
Ga0066652_1005396572	3300006046	Soil	MWIIWYIGMMASLRAMGFAPNLLPIRTDEDRKPFGDM*
Ga0075432_101470732	3300006058	Populus Rhizosphere	MWIVMYIAMMASLRAMGLAPSFVSVRTDEDRPPFGEI*
Ga0075018_104812692	3300006172	Watersheds	MWIIWYIGMMASLRAMGLAPGVVPVRIDEDHTPYGDV*
Ga0070716_1008181002	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	GRGSRAMWIVMYIAMMASLRAMGLAPSFVSVRTDEDRPPFGEI*
Ga0070716_1012573511	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	AMWIVMYIAMMASLRAMGLAPNLVTVRTDEDRPPFGEI*
Ga0066653_101958731	3300006791	Soil	MWIIMYIAVMASLRAMGLAPDLVQVWTDDDHRPPYGDI*
Ga0066665_105983832	3300006796	Soil	MWIIWYVAMMASLRAMGLAPSVVPVRTDEDRTPFSDI*
Ga0066665_115624991	3300006796	Soil	MWIIMYIAVMASLQAMGLEPGLVPIRTDDDDRPPCGDI*
Ga0066659_102148352	3300006797	Soil	MWIIMYIAVMASLQAMGLEPSLVPIRTDDDDRPPCGDI*
Ga0079221_108965731	3300006804	Agricultural Soil	MWIIWYVAMMASPSAMGLAPSVVPVRTDEDRTPFSDT*
Ga0075428_1001196372	3300006844	Populus Rhizosphere	MWIIWYIGMMASLRAMGLAPSLVPIRTDEDRKPYGDM*
Ga0075425_1000547522	3300006854	Populus Rhizosphere	MWIIMYIAMVASLRAMGLSPSMVPVRTDEDRPPFGDI*
Ga0075425_1027281002	3300006854	Populus Rhizosphere	WAMWIIWYIGMMASLRAMGLAPGVVPVRIDEDRKPYGDF*
Ga0075425_1030049071	3300006854	Populus Rhizosphere	MWIIMYIAMVASLRAMGLSPSMVPVRTDEDRPPFG
Ga0075436_1003900842	3300006914	Populus Rhizosphere	MWIIWYIGMMASLRAMGLAPSPVLMRTDEDRKPYGDF*
Ga0081244_15043552	3300006939	Tropical Rainforest Soil	MWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF*
Ga0075435_1004409802	3300007076	Populus Rhizosphere	MWIIWYVAMMASLRAMGLAPSPVLMRTDEDRKPYGDF*
Ga0099791_100570272	3300007255	Vadose Zone Soil	MWIIWYIGMMASLRAMGLAPDVVPVRIDEDHTPYGDV*
Ga0114129_108202871	3300009147	Populus Rhizosphere	MWIIWYIGMMASLRAMGLAPSPVLMRTDEDRKPYGGF*
Ga0075423_103404281	3300009162	Populus Rhizosphere	MWIVMYIAMMASLRAMGLAPSFVPVRTDEDRPPFGEI*
Ga0126374_107025751	3300009792	Tropical Forest Soil	MWIIWYIGMMASLRAMGLAPSPVPVRIDEDRKPYGDF*
Ga0126374_107251851	3300009792	Tropical Forest Soil	MWIIIYIAMVASMRAMGLAPSLVSVRTDEDRPPFGDI*
Ga0126384_102121542	3300010046	Tropical Forest Soil	MWIIWYVAMMASLRAMGLAPSPVPVRTDEDRTPYGDI*
Ga0126384_104514292	3300010046	Tropical Forest Soil	MWIIWYVAMMASLRAMGLAPIAVPVRTDEDRTPFSDI*
Ga0126384_109994811	3300010046	Tropical Forest Soil	MWIIWYVAMVASLRAMGLAPDPVPVRIDEDRTPYGDI*
Ga0126384_111673871	3300010046	Tropical Forest Soil	MWIIWYIGMMASLRAMGLAPSPVLVRTDEDRKPYGDL*
Ga0126382_100133602	3300010047	Tropical Forest Soil	MWIIWYVAMMASLRAMGLAASPVPVRTDEDRTPYGDI*
Ga0099796_103400753	3300010159	Vadose Zone Soil	MWIVMYIAMMASLRAMGLAPNLVTVRTDEDRPPFGEI*
Ga0134084_100146862	3300010322	Grasslands Soil	MWIIMYIAVMASLQAMGLEPSLVPIRTDDDHRPPYGDI*
Ga0134086_103075811	3300010323	Grasslands Soil	RAMWIIWYIGMMASLRAMGFAPNLLPIRTDEDRKPFGDM*
Ga0126370_113145502	3300010358	Tropical Forest Soil	GDWAMWIIWYVAMMASLRAMGLAPIAVPVRTDEDRTPFSDI*
Ga0126376_103025172	3300010359	Tropical Forest Soil	MWIIWYVAMMASLRAMGLAPIAVPVRTDEERTPFSDI*
Ga0126376_128511832	3300010359	Tropical Forest Soil	MWIIWYIGMMASLRAMGLAPSPVPGIDEDRTPYGDV*
Ga0126372_102963051	3300010360	Tropical Forest Soil	MWIIWYIGMMASLRAMGLAPGMVPVRINEDRKPYGDF*
Ga0126372_105617762	3300010360	Tropical Forest Soil	MWIIWYVAMVASLRAMGLAPSPVPVRIDEDRKPYGDL*
Ga0126372_118771382	3300010360	Tropical Forest Soil	MWIIWYVAMMASLRAMGLAPSPLPVRIDEERKPYGDF*
Ga0126378_109379172	3300010361	Tropical Forest Soil	MWIIWYIGMMASLRAMGLAPSLVPIKIDEDRKPFG
Ga0126378_115912531	3300010361	Tropical Forest Soil	MWIIWYVAIMASLRAMGLAPIAVPVRTDEDRAPFSDI*
Ga0126379_104955262	3300010366	Tropical Forest Soil	MWIIWYVAMVASLRAMGLAPSAVPVRTDEDRKPYGEF*
Ga0126379_119539173	3300010366	Tropical Forest Soil	IIWYIGMMASLRAMGLAPSLVPIKIDEDRKPFGDM*
Ga0126379_129826881	3300010366	Tropical Forest Soil	MWIIMYIAMVASMRAMGLAPSVVPVRTDEDRPPFGEI*
Ga0126381_1004870352	3300010376	Tropical Forest Soil	MWIIWYVGMMASLRAMGLAPSLVPIKIDEDRKPFGDM*
Ga0126383_110594761	3300010398	Tropical Forest Soil	MWIIWYVAMVASLRAMGLAPSPVPMRTDEDLTPFTDI*
Ga0124850_11208762	3300010863	Tropical Forest Soil	SIGGWAMWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF*
Ga0124850_11346322	3300010863	Tropical Forest Soil	VVGFAGDGAMWIIWYIGMMASLRAMGLAPSLVPIKIDEDRKPFGDM*
Ga0151489_17141481	3300011106	Soil	MWIIWYIGMMASLRAMGLAPGVVPVRTDEDRTPYGDV*
Ga0120191_100179781	3300012022	Terrestrial	MWIIWYIGMMASLRAMGLAPNLVPIRTDEDRTPFGDV*
Ga0137364_102088842	3300012198	Vadose Zone Soil	MWIIWYIGMMASLRAMGFAPNLVPIRTDEDRKPFGDM*
Ga0137383_101186012	3300012199	Vadose Zone Soil	MWIIMYIAVMASLQAMGLEPSLVPVRTDDDDRPPCGDI*
Ga0137383_103014352	3300012199	Vadose Zone Soil	MWIIWYVAMVASLRAMGLAPSVVPVRTDEDRTPFSDI*
Ga0137376_101895772	3300012208	Vadose Zone Soil	MWIIMYIAMVASMRAMGLAPSVVPVRIDEDRPPFGEM*
Ga0137366_102129112	3300012354	Vadose Zone Soil	MWIIWYVAMVASLRATGLAPSVVPVRTDEDRTPFSDI*
Ga0137369_102987921	3300012355	Vadose Zone Soil	MWIIWYIGMMASLRAMGLAPSLVPIRTDEDRTPFGDV*
Ga0137361_113244461	3300012362	Vadose Zone Soil	IWYVAMMASLRAMGIAPSPVPVRTDEDRKPYGDF*
Ga0126375_112134702	3300012948	Tropical Forest Soil	GDWAMWIIWYVAMVASLRAMGLAPSPVPVRTDEDRTPFTDI*
Ga0164300_105257222	3300012951	Soil	MWIIWYIGMMASLRALGLAPGVVPVWIDEDRKPYGDF*
Ga0164304_105059662	3300012986	Soil	MWIIWYIGMMASLRALGLAPGVVPVRIDEDRKPYGDF*
Ga0132257_1039053131	3300015373	Arabidopsis Rhizosphere	MWIIWYIGMMASLRAMGLAPGVVPVRTDEARKPYGDF*
Ga0132255_1001418785	3300015374	Arabidopsis Rhizosphere	DRAMWIIMYIAMVASLRAMGLSPSMVPVRTDEDRPPFGDI*
Ga0182035_102292251	3300016341	Soil	MWIIWYIGMMASLRAMELAPSLVPVKIDEDRKPFCDM
Ga0182034_105503692	3300016371	Soil	MWIIWYVAMMASLRAMGLAPIAVPVRTDDERTPFSDI
Ga0066655_100694352	3300018431	Grasslands Soil	MWIIMYIAVMASLRAMGLAPDLVQVRTDDDHRPPYGDI
Ga0066667_104357461	3300018433	Grasslands Soil	MWIIWYIGMMASLRAMGFAPNLQPIRTDEDRKPFCDM
Ga0066662_114646372	3300018468	Grasslands Soil	MWIIMYIAVMASLQAMGLEPSLVPIRTDDDDRPPCGDI
Ga0066662_119002442	3300018468	Grasslands Soil	MWIIWYVAMMASLRAMGLAPSVVPVRTDEDRTPFSDI
Ga0210407_112260582	3300020579	Soil	MWIIMYVAMIASLRAMGLAPSSVPVRTDDDHRPPFGEI
Ga0210399_103804082	3300020581	Soil	MWIIWYIGMMASLRAMGLAPGVVLVRTDEDRKPYGDF
Ga0210399_104925181	3300020581	Soil	MWIVMYIAMMASLRAMGLAPNLATVRTDEDRPPFGEV
Ga0210406_112897271	3300021168	Soil	MWIIWYIGMMASLRAMGLAPSPLPVRIDEDRTPYGDV
Ga0210408_103007302	3300021178	Soil	WAMWIIWYIGMMASLRAMGLAPSPLPVRIDEDRTPYGDV
Ga0213879_100052931	3300021439	Bulk Soil	MWIIWYIGMMASLRAMGLAPSVVPVRIDEDRKPYGDF
Ga0126371_106429432	3300021560	Tropical Forest Soil	MWIIWYVAMMASLRAMGLAPIAVPVRTDEERTPFSDI
Ga0126371_114746432	3300021560	Tropical Forest Soil	MWIIWYVAMVASLRAMGLAPSPVPVRTDEDRTPFTDI
Ga0126371_120685561	3300021560	Tropical Forest Soil	MWIIWYVAMVASLRAMGLAPSPVPVRIDEDRKPYGDF
Ga0126371_122025332	3300021560	Tropical Forest Soil	MWIIMYIAMVASMRAMGLAPSLVPVRTDEDRPPFGDI
Ga0126371_124856431	3300021560	Tropical Forest Soil	MWIIWYIGMMASLRAMGLAPSPVLVRTDEDRKPYGDL
Ga0126371_128897802	3300021560	Tropical Forest Soil	AMWIIMYIAMVASLRAMGLAPSMVPVRTDEDRPPFGEI
Ga0179589_104233802	3300024288	Vadose Zone Soil	MWIIWYIGMMASLRAMGLAPGVVPVRIDEDHTPYGDV
Ga0207692_110365292	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	IVMYIAMMASLRAMGLAPGFVPVRTDEDRPPFGEI
Ga0207665_113681552	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	VRPGTRAMWIVMYIAMMASLRAMGLAPNLVTVRTDEDRPPFGEI
Ga0209240_10046623	3300026304	Grasslands Soil	MWIIWYIGMMASLRAMGLAPDVVPVRIDEDHTPYGDV
Ga0209239_10159433	3300026310	Grasslands Soil	MWIIWYIGMMASLRAMGLAPSPVPVRIDEDRTPYGDV
Ga0209239_10506562	3300026310	Grasslands Soil	MWIIWYIGMMASLRAMGFAPNLLPIRTDEDRKPFGDM
Ga0209266_11756371	3300026327	Soil	MWIIMYIAVMASLRAMGLAPDLVQVRTDDDHRPPYG
Ga0209378_11094782	3300026528	Soil	MWIIWYIGMMASLRTMGLAPGVVPVRIDEDRKPYGDF
Ga0209056_101660271	3300026538	Soil	MWIIMYIAVMASLQAMGLEPGLVPIRTDDDDRPPCGDI
Ga0209474_100229162	3300026550	Soil	MWIIMYIAMVASLRAMGLAPSMVPVRTDEDRPPFGEI
Ga0209523_10402911	3300027548	Forest Soil	MWIIWYIGMMASLRAMGLAPGVVPVRTDEDRKPYGDF
Ga0209466_10017832	3300027646	Tropical Forest Soil	MWIIWYVAMVASLRAMGLAPSPVPVRTDEDRKPYGDF
Ga0209465_101213502	3300027874	Tropical Forest Soil	MWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF
Ga0209465_104360491	3300027874	Tropical Forest Soil	MWIIWYIGMMASLRAMGLAPSPVLVRTDEDRKPYGDF
Ga0209488_108435772	3300027903	Vadose Zone Soil	MWIIMYIAMVASMRAMGLAPSVVPVRTDEDRPPFGEM
Ga0307307_100401712	3300028718	Soil	MWIVMYIAMMASLRAMGMAPGFVPVRTDEDRPPFGEI
Ga0307277_100000143	3300028881	Soil	MWIVMYIAMMASLRAMGLAPSFVPVRTDEDRPPFGEI
Ga0318516_100604413	3300031543	Soil	WIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF
Ga0318516_101808402	3300031543	Soil	MWIIWYVAMMASLRAMGLAPSPVLVRTDEDRKPYGDF
Ga0318516_104241982	3300031543	Soil	GGWAMWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF
Ga0318534_101064472	3300031544	Soil	MWIIWYVAMVASLRAMGLAPDPVPVRIDEDRTPYGDI
Ga0318541_101389662	3300031545	Soil	MWIIWYIGMMASLRAMGLAPSLVPVKIDEDRKPFGDM
Ga0318541_102091412	3300031545	Soil	MWIIWYVAMVASLRAMGLAPDPVPVRIDEDRTPYG
Ga0318541_105119811	3300031545	Soil	WAMWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF
Ga0310915_100293762	3300031573	Soil	VWIIWYIGMMASLRAMGLAPSLVPVKIDEDRKPFGDM
Ga0310915_101070942	3300031573	Soil	MWIIWYIGMMASLRAMGLAPSPVPIRTDENRKPYGDF
Ga0318500_103338972	3300031724	Soil	IIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF
Ga0306918_103111381	3300031744	Soil	AMWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF
Ga0306918_107070782	3300031744	Soil	MWIIWYVAMVASLRAMGLAPSPLPVRTDEDRTPFTDI
Ga0318521_104719882	3300031770	Soil	DGAMWIIWYIGMMASLRAMGLAPSLVPVKIDEDRKPFGDM
Ga0318503_101185482	3300031794	Soil	AMWIIWYIGMMASLRAMGLAPSPVPVRIDEDRKPYGDF
Ga0318512_102816211	3300031846	Soil	GLIRGDWAMWIIWYIGMMASLRAMGLAPGVVPVRTDEERKPYGDF
Ga0318536_101880902	3300031893	Soil	MWIIWYIGMMASLRAMGLAPGVVPVRTDEDRTPYGDV
Ga0306921_124530151	3300031912	Soil	AMWIIWYIGMMASLRAVGLAPSPVPIRTDEDRKPYGDF
Ga0310912_112486821	3300031941	Soil	MWIIWYVAMVASLRAMGLAPSPVPVRIDEDRKPYGDLLV
Ga0306926_124513741	3300031954	Soil	WAMWIIWYIGMMASLRAVGLAPSPVPIRTDEDRKPYGDF
Ga0306922_110112492	3300032001	Soil	MWIIWYVAMMASLRAVGLAPNPVPVRMDEDRKPYGDF
Ga0306922_112337921	3300032001	Soil	MWIIWYVAMVASLRAMGLAPSPVPVRIDEDRKPYGD
Ga0318570_100621741	3300032054	Soil	MWIIWYVAMVASLRAMGLAPSPLPVRTDEDRTPFT
Ga0306924_117038971	3300032076	Soil	MWIIWYIGMMASLRAVGLAPSPVPIRTDEDRKPYGDF

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F039802

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences