NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F039931

Metatranscriptome Family F039931

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039931
Family Type Metatranscriptome
Number of Sequences 162
Average Sequence Length 185 residues
Representative Sequence MADAGEPQVQPLPEKVQRGLSASVKYMVSNLLAEKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDA
Number of Associated Samples 87
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 9.26 %
% of genes near scaffold ends (potentially truncated) 98.77 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(71.605 % of family members)
Environment Ontology (ENVO) Unclassified
(88.272 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(75.309 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Mixed Signal Peptide: No Secondary Structure distribution: α-helix: 65.33%    β-sheet: 0.00%    Coil/Unstructured: 34.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009028|Ga0103708_100187430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata592Open in IMG/M
3300009028|Ga0103708_100299842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300009606|Ga0115102_10992824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300009608|Ga0115100_10123250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300009608|Ga0115100_11005040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium catenella951Open in IMG/M
3300009677|Ga0115104_10296060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata581Open in IMG/M
3300009679|Ga0115105_10040616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata685Open in IMG/M
3300010981|Ga0138316_11502758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata566Open in IMG/M
3300010985|Ga0138326_11116581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata669Open in IMG/M
3300010987|Ga0138324_10373798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata693Open in IMG/M
3300010987|Ga0138324_10401814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata670Open in IMG/M
3300010987|Ga0138324_10660718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300012413|Ga0138258_1386026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata581Open in IMG/M
3300012415|Ga0138263_1466059All Organisms → cellular organisms → Eukaryota → Sar758Open in IMG/M
3300012418|Ga0138261_1117083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata626Open in IMG/M
3300012419|Ga0138260_10493693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata629Open in IMG/M
3300012782|Ga0138268_1234370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300018825|Ga0193048_1076872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300018846|Ga0193253_1104810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata655Open in IMG/M
3300018864|Ga0193421_1100454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata575Open in IMG/M
3300018871|Ga0192978_1095592All Organisms → cellular organisms → Eukaryota → Sar537Open in IMG/M
3300018879|Ga0193027_1091401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata603Open in IMG/M
3300019003|Ga0193033_10176625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata605Open in IMG/M
3300021345|Ga0206688_10329430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata587Open in IMG/M
3300021345|Ga0206688_10355886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata686Open in IMG/M
3300021359|Ga0206689_10151223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300021879|Ga0063113_124809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300021886|Ga0063114_1048945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata674Open in IMG/M
3300021886|Ga0063114_1049776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300021913|Ga0063104_1079064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300021923|Ga0063091_1159511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300021930|Ga0063145_1073545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300021941|Ga0063102_1102019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300021943|Ga0063094_1056072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300021943|Ga0063094_1119445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300028575|Ga0304731_10374928All Organisms → cellular organisms → Eukaryota → Sar506Open in IMG/M
3300028575|Ga0304731_10530596All Organisms → cellular organisms → Eukaryota → Sar627Open in IMG/M
3300028575|Ga0304731_10774343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata566Open in IMG/M
3300028575|Ga0304731_11020557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata636Open in IMG/M
3300028575|Ga0304731_11131131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata657Open in IMG/M
3300030653|Ga0307402_10499954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata705Open in IMG/M
3300030653|Ga0307402_10534876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata680Open in IMG/M
3300030653|Ga0307402_10631983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata623Open in IMG/M
3300030653|Ga0307402_10643808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata617Open in IMG/M
3300030653|Ga0307402_10776710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300030670|Ga0307401_10394254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata629Open in IMG/M
3300030670|Ga0307401_10514944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300030671|Ga0307403_10580275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata608Open in IMG/M
3300030671|Ga0307403_10600067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata597Open in IMG/M
3300030671|Ga0307403_10632437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata581Open in IMG/M
3300030671|Ga0307403_10676123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata561Open in IMG/M
3300030671|Ga0307403_10811288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300030699|Ga0307398_10473845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata689Open in IMG/M
3300030699|Ga0307398_10779601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300030699|Ga0307398_10829951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300030702|Ga0307399_10287992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata780Open in IMG/M
3300030702|Ga0307399_10443167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata633Open in IMG/M
3300030709|Ga0307400_10854937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300030709|Ga0307400_10871731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300030709|Ga0307400_10962165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300030729|Ga0308131_1099829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata598Open in IMG/M
3300030780|Ga0073988_12205285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata565Open in IMG/M
3300030786|Ga0073966_11811261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata680Open in IMG/M
3300030865|Ga0073972_11283728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300030871|Ga0151494_1398640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata578Open in IMG/M
3300030919|Ga0073970_10793194All Organisms → cellular organisms → Eukaryota → Sar512Open in IMG/M
3300030956|Ga0073944_11235309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata603Open in IMG/M
3300030961|Ga0151491_1083494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata673Open in IMG/M
3300031056|Ga0138346_10047997All Organisms → cellular organisms → Eukaryota → Sar532Open in IMG/M
3300031113|Ga0138347_10271446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300031113|Ga0138347_11261740All Organisms → cellular organisms → Eukaryota → Sar520Open in IMG/M
3300031113|Ga0138347_11316622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata600Open in IMG/M
3300031113|Ga0138347_11325614All Organisms → cellular organisms → Eukaryota → Sar669Open in IMG/M
3300031121|Ga0138345_10357616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300031126|Ga0073962_11013914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300031126|Ga0073962_11607812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300031445|Ga0073952_11564100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata689Open in IMG/M
3300031445|Ga0073952_11645540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata642Open in IMG/M
3300031445|Ga0073952_11912497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300031459|Ga0073950_10801478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300031522|Ga0307388_10657258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata698Open in IMG/M
3300031522|Ga0307388_10666152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata694Open in IMG/M
3300031522|Ga0307388_10935215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300031522|Ga0307388_11043654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300031550|Ga0307392_1034981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata627Open in IMG/M
3300031579|Ga0308134_1081192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300031579|Ga0308134_1144773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300031580|Ga0308132_1078059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata682Open in IMG/M
3300031580|Ga0308132_1118201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300031580|Ga0308132_1136042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300031709|Ga0307385_10290530All Organisms → cellular organisms → Eukaryota → Sar622Open in IMG/M
3300031709|Ga0307385_10334570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata577Open in IMG/M
3300031709|Ga0307385_10356676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata557Open in IMG/M
3300031710|Ga0307386_10493768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata639Open in IMG/M
3300031710|Ga0307386_10500629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata635Open in IMG/M
3300031710|Ga0307386_10624667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata572Open in IMG/M
3300031710|Ga0307386_10738477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300031717|Ga0307396_10265258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata819Open in IMG/M
3300031717|Ga0307396_10386648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata670Open in IMG/M
3300031717|Ga0307396_10400406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata658Open in IMG/M
3300031717|Ga0307396_10656911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300031725|Ga0307381_10380401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata518Open in IMG/M
3300031729|Ga0307391_10547755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata652Open in IMG/M
3300031729|Ga0307391_10789152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300031729|Ga0307391_10827783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300031729|Ga0307391_10828800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300031735|Ga0307394_10247672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata704Open in IMG/M
3300031737|Ga0307387_10959514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300031737|Ga0307387_10995513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300031737|Ga0307387_11102463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300031738|Ga0307384_10447074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata606Open in IMG/M
3300031738|Ga0307384_10546560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300031738|Ga0307384_10626590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300031739|Ga0307383_10370036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata701Open in IMG/M
3300031739|Ga0307383_10482245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata616Open in IMG/M
3300031739|Ga0307383_10692831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300031739|Ga0307383_10701685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300031742|Ga0307395_10336204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata654Open in IMG/M
3300031742|Ga0307395_10363576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata627Open in IMG/M
3300031742|Ga0307395_10479171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300031743|Ga0307382_10475962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300031743|Ga0307382_10572960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300031750|Ga0307389_10720652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata651Open in IMG/M
3300031750|Ga0307389_10750978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300031750|Ga0307389_10760368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata634Open in IMG/M
3300031750|Ga0307389_10892566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata586Open in IMG/M
3300031750|Ga0307389_10914146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata579Open in IMG/M
3300031750|Ga0307389_11030196All Organisms → cellular organisms → Eukaryota → Sar546Open in IMG/M
3300031750|Ga0307389_11121836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300031750|Ga0307389_11128285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata523Open in IMG/M
3300031750|Ga0307389_11134920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300031752|Ga0307404_10313702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata652Open in IMG/M
3300031752|Ga0307404_10350469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata615Open in IMG/M
3300031752|Ga0307404_10468400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300032491|Ga0314675_10538457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata575Open in IMG/M
3300032492|Ga0314679_10525421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300032517|Ga0314688_10593661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300032518|Ga0314689_10699471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300032519|Ga0314676_10657359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata614Open in IMG/M
3300032520|Ga0314667_10477467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata693Open in IMG/M
3300032521|Ga0314680_10679050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata650Open in IMG/M
3300032521|Ga0314680_10985406All Organisms → cellular organisms → Eukaryota → Sar528Open in IMG/M
3300032616|Ga0314671_10642721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300032617|Ga0314683_10529061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata732Open in IMG/M
3300032617|Ga0314683_10731086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300032651|Ga0314685_10714832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata539Open in IMG/M
3300032708|Ga0314669_10571227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata623Open in IMG/M
3300032708|Ga0314669_10722069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata546Open in IMG/M
3300032709|Ga0314672_1374658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300032723|Ga0314703_10452814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300032732|Ga0314711_10655608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300032733|Ga0314714_10817605All Organisms → cellular organisms → Eukaryota → Sar502Open in IMG/M
3300032734|Ga0314706_10572746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300032747|Ga0314712_10551214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300032752|Ga0314700_10680624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300032754|Ga0314692_10704476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300032754|Ga0314692_10739262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300032755|Ga0314709_10609693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata660Open in IMG/M
3300032755|Ga0314709_10889790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300033572|Ga0307390_10380136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata859Open in IMG/M
3300033572|Ga0307390_11057769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300033572|Ga0307390_11065189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine71.60%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater15.43%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.79%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine3.09%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.85%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.23%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018864Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789379-ERR1719364)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021879Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021886Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021923Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-8M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030729Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1108_32.2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030786Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030865Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030871Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030919Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030961Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031126Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031445Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031459Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031550Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103708_10018743013300009028Ocean WaterLSASVKFLSNVFLEEKHYSNISKHLATRWDKFQSLKAAMTLMEQHGVHLSPEDEARLSGLSEVQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRAALEQGRADLVEQAMDDADSTGISQYILKMSIVQAGSEVTNLKKQHGAWVKDAESKMSRLVRGQEDAMTAKARLAKAQGELAVFQTNQNEHIKKVLM
Ga0103708_10029984213300009028Ocean WaterHHEKLWSTLATKWDRYQSLHAAMKLMEQHGVQLTPEEEQRLASLGEVQMIDALVTKIPQQSKEQFQHFFLQLQLIVSTASRVRQGLEAGNAADVEAALDDADNTGIAQYILKMAIVQAGSEVLGLKQLHESWVKDSEGRISKMIRLHSASGTSVSVARNSKSSPPVHFGI
Ga0115102_1099282413300009606MarineMADTQVQPEVDATPLPENIQKGLSASVKHLVNNFLEEKHYSAISEALACRWDKFQSLTAAMKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKM
Ga0115100_1012325013300009608MarineRILVLPSTSMADTQVQPEVDATPLPENIQKGLSASVKHLVNNFLEEKHYSAISEALACRWDKFQSLTAAMKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKMAIVQAGSEVTNLKRQHVAFV
Ga0115100_1100504023300009608MarineMAEVTLMPEGEMTMTPEQTLPDSVQKGLSASVKYLASNFLKEKHYSKVSSSLANRWDKYQSLSAAMKLMEQHGVVLSPEETERLSSLGEAQMIESLVTKMPQQSKEQFQHFFLQLQLIVSTASRVRQASNKAVPRR*
Ga0115104_1029606013300009677MarineMADDAAAPAAPVVEPLPADIQKGLSASVKHLVANFLDEKHYSLISRSLASKWDKFQSLTAAMRLMEQHGVQLTPEEEQRLSSLGEAQMIEALVQKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEQGRDDLVEQAMNDAESTGIAQYILKMSIVQAGSEVTNLKAQHSAWVK
Ga0115105_1004061613300009679MarineMADAAEPQPLPENIQKGLSGSVKYLVNNFLDDKHYSKISSSLAGNWSKFQSLTAAMRLMEQHGVHLTPEEEERLSGMSEPQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVESAMDDAESTGITQYILKMCIVQAGSEVTNLKKQHAAWVKDAES*
Ga0138316_1150275813300010981MarineMAEPAPETEQPTKPLPESVQKGLSSSVKYLSGNFLREKHYSKISASLANRWDKFQSLTAAMKLMEQHGVHLSPEEEQRISSMSETQMIETLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVEQAMEDADSTGIAQYILKMAIVQAGSEVTNLKKQHAAWV
Ga0138326_1111658113300010985MarineDEVVAAPPQETLPESVQKGLNATVKYLTANFLNEKHFSKIGASLASRWDRFQSLSAAMKLMEQHGVKLTPEEEKELSGLGEAQMIEKLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEAGDAGTVSQAMDDADSTGIAQYILKMSIVQAGSEVMNLKNQHTAWVRDAEGKLSRLVRGQEEAMIAKQRLAKANAELADFNNANNERVKKVLMTLAGGAS
Ga0138324_1037379813300010987MarineVVGQGVVSRPQTIPKSHCATVKAMAAVEAPIEATQLPESVKKGLGSSVKYLVKNFLNDKHYSKIGGSLANRFNQFQSLTAAMKLMAQYGVEISPEEEQRLSSMPEPQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRADLVEGAMDDAESTGIAQYILKMSIVQAGSEVNNLKKQHAAWCKDAESKMSKLVRGAEDCQVAKERLAHAMGELAMFQSAQN
Ga0138324_1040181413300010987MarineSCSAGPAAELLLARPLPFFLAMADAADTQPEAATIQPLPENIQKGLAASVKYLVGNFLENKHYSKISGSLASKWDKFQSLTAAMRLMEQHGVQLSPEEEQRLSSLSEAQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRAALEQGRADLVEAAMDDADSTGISQYILKMAIVQAGSEVTNLKKQHAAWCKDAEGKMSRLVKGAEDAALAKERLQKAMG
Ga0138324_1066071813300010987MarineMADLQAPIPPTDVPESVRKGLGQSVKYLVTTFLKDKHYSKIGGSLANRWDKFQSLTAAMKLMEQHGVVLDPQEEQRLSGMSEAQMIEALVMKMPQQSKEQFQHFFLQLQLIVSTAQRVKQALTEGRPDLVEMALDDAESTGIAPYILKM
Ga0138258_138602613300012413Polar MarinePLKSFWLEHLAEVADEGANIGLPNVMAEDTVAVMEQQPLPENIQKGLSASVKYLVTNFLEEKHYTTISSSLATRWDKSQSLTAAMKLMEQHGVHLSEEEQGRLEWMNEMQMIESLVTKMPQQSKEQFQHFFLQLQLIVSTATRIRSGLEQGRADVVEQAMDDAESTGTAQYVLKMAIVQAGSEVNNLKKQHGA
Ga0138263_146605913300012415Polar MarineMSKASVKAPEPASAEAPEIPSVDSLATLPETVKKGLSASVKYLVGNLLKDEHYSKISQSLASRWDKCQSMNAAMKLMEQSGVHITPEEEQRLSALTEAQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRSDLVEQAMDDAESTGIVQYILKLTIVQAGSEVTNLKKTHAAFVKDAEGKLSRMVKASEDAQTAKERLQKAMAELAVFSATANENIKKV
Ga0138261_111708313300012418Polar MarineLKCSAGKGADFLSFISFLHLLSYRAMNAPAANMAVEAQPLPENMQKGLSASVKYLTKHFLEDKHYTTISGSLASKWDKFQSLTAAMRLMETHGVIISPEEEERLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRSALENGRADLVEQAMDDADSTGIAQYILKMAIVQAGSEVNNLKSQHAAFVKDAEGKMSRLVK
Ga0138260_1049369313300012419Polar MarineLFGTMADTMTPQPVPAFISQGLSASVKYMVANFLSDKQYTKISGALANKWERFQSLTAAVKLMEQHGVQVTPEEEERMSGLSEMQMIESLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTALETGRADLVERAMDDADSTGISQYILKMCIVQAGSEVTNLKRQHECWVKDAESKMSRLVRGAEDAIIAKERLAKAQGELATFQANQN
Ga0138268_123437013300012782Polar MarineQTAVQLKFRVEVLSGSPFALFGTMADTMTPQPVPEFISQGLSASVKYMVANFLSDKQYTKISGALANKWERFQSLTAAVKLMEQHGVQVTPEEEERMSGLSEMQMIESLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRADIVEQAMDDAESTGIAQYILKMSIVQAGSEVTNLKKQ
Ga0193048_107687213300018825MarineSKVSGSLANRWDKFQSLTAAMKLMEQHGVQLSPEEEQRLSGMSETQMIEALVMKMPQQSKEQFQHFFLQLQLIVSTATRVRRALEDGRADLVEQAMDDAESTGISQYILKMSIVQAGSEVTNLKTQHAAWVKDAESKMSRLVRGAEDAAMAKERLKKAHNELSSFQA
Ga0193253_110481013300018846MarineMASAPVPLNEPVVLPESVTQGLSSSVKYLVSNLLKDKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVILEKAEEERLAGLTEPQMIEALVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALESGRADQVEQAMDDADSTGISQYILKMSIVQAGSEVNNLKRQHAAWVKDAEGKLSRLVKGAEDAEVAKERLDKAHAELASFQTVQS
Ga0193421_110045413300018864MarineTTKPLPESVQKGLSSSVKYLSGNFLREKHYSKISASLANRWDKFQSLTAAMKLMEQHGVHLSPEEEQRISSMSETQMIETLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVEQAMEDADSTGIAQYILKMAIVQAGSEVTNLKKQHAAWVKDAESKMSRLVRGQEDAALAKSRLAKAHAE
Ga0192978_109559213300018871MarineKGLSASVKHLVNNFLEEKHYSAISEALACRWDKFQSLTAAMKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPSQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKMAIVQAGSEVTNLKRQHVAFVRDAEGKMSRLVKASEDAQVARERLIKA
Ga0193027_109140113300018879MarineMADDAAAPAAPVVEPLPADIQKGLSASVKHLVANFLDEKHYSLISRSLASKWDKFQSLTAAMRLMEQHGVQLTPEEEQRLSSLGEAQMIEALVQKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEQGRDDLVEQAMSDAESTGIAQYILKMSIVQAGSEVTNLKAQHSAWVKDAES
Ga0193033_1017662513300019003MarineMADDAAAPAAPVVEPLPADIQKGLSASVKHLVANFLDEKHYSLISRSLASKWDKFQSLTAAMRLMEQHGVQLTPEEEQRLSSLGEAQMIEALVQKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEQGRDDLVEQAMNDAESTGIAQYILKMSIVQAGSEVTNLKAQHSAWVKDA
Ga0206688_1032943013300021345SeawaterGDGAPLRASPCVLLVAMAAPPAAATETLAALPENVKQGLRASVSYLVSNLLTEKHYSKISTSLASRWDQFQSMSAAMKLMEQHGVVITPEEQARLSGLTEAQIIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALESGRSDLVEAAMDDAESTGISQYILKMSIVQAGSEVTNLKKQHAAFMKDAESKLS
Ga0206688_1035588613300021345SeawaterMADVAEQPAQLPESVQKGLSASVKYMVSNFLADKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVHLSPEEEQRLSQMNESQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALESGQSDLVEQAMDDADSTGIAQYILKMAIVQAGSEVNNLKRQHA
Ga0206689_1015122313300021359SeawaterGLSASVKYMVSNFLADKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVHLTPEEEQRISGLSEIQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRAALEQGRADLVEQAMDDADSTGIAQYILKMSIVQAGSEVTNLKKQHSAWCKDAESKMSKLVRGSEDCQ
Ga0063113_12480913300021879MarineCQATHPLLVRFFATMADAVAPVEQPPLPECVVKGLSASVKYMVNNFLCDKHYSKVSGSLANRWDKFQSLTAAMKLMEQHGVQLSPEEEQRLSGMSETQMIEALVMKMPQQSKEQFQHFFLQLQLIVSTATRVRRALEDGRADLVEQAMDDAESTGISQYILKMSIVQAGSEV
Ga0063114_104894513300021886MarineGKGVDVFLARSSCAILSAMADAAEPAPLPENIQKGLSASMKYLVSNFLDDKHYSKISGSLAGNWNKFQSLTAAMKLMEQHGVHLSPEEEQRLSGMSEPQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVEQAMDDADSTGIAQYILKMSIVQAGSEVTNLKKQHQAWVKDAEAKLSRMVKGAEEAVIAKERLAKAQGELAVFQTEQNE
Ga0063114_104977613300021886MarineSNVPWVKLEGGPSTPSLHESMSDAMGSMPENVKKGMVKYMVGEFLRDKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVHLSPEEEQRLSSMNESQMIETLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRADIVEQAMNDADSTGISQYILKMSIVQAGSEVTNLKRQ
Ga0063104_107906413300021913MarineLPETVQRGLSASVKYMVSNLLAEKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMSRLVKGAEDCQVAKERLAKA
Ga0063091_115951113300021923MarineSGSLANKWDKFQSLTAAMRLMEQHGVHLSSEEEARLSGMSEGQMIDALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVETAMDDAESTGIAQYILKMAIVQAGSEVNNLKKQHAAFVKDAESKMSRLVRGQEDAIVAKERLAKAHGELAVFQTSANEHIKKVLMAFAGGSTTAVLHASLSSWH
Ga0063145_107354513300021930MarineTFHRVILYTVLAMADAAEQQVQPLPETVQRGLSASVKYMVSNLLAEKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLK
Ga0063102_110201913300021941MarineVQRGLSASVKYMVSNLLAEKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMSRLVKGAEDCQV
Ga0063094_105607213300021943MarineGRDSRRRASRTILGKMAAEDAVVPAPLPENIQKGLSTSVRYLVSNFLSDKNYSKIAGSLANKWDKFQSLTAAMKLMEQHGVVLTPEEEERLSGMNEAQMIETLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRADIVEQAMDDAESTGIAQYILKMSIVQAGSEVTNLKKQHTAWVKDAESKMSKLSHG
Ga0063094_111944513300021943MarineLACKWDRFQSLTAAMKLMEQHGVHLGAEEQERLSAMDEPQMIEALVMKMPQQSKEQFQHFFLQLQLIVSTASRVRQALEQGRSDLVEQALDDAESTGISQYILKMSIVQAGSEVTNLKKQHAAWVKDAESKMSRLVHGMEDAITAKERLQKAQGEMAAFQSSQNDAIKK
Ga0304731_1037492813300028575MarineMADEVPAVPAQETLPESVQKGLHSSVKYLTSNFLSEKHYSKIGAALASRWDRFQSLSAAMKLMEQHGVKLSPEEEKELSGMGEAQMIEKLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEQGNAEAVSQAMDDADSTGI
Ga0304731_1053059613300028575MarineMAVLDEVQVEALPQQVQKGLSACVKHLVEQLLTDKHYSKTSVALASRWDKCQSLTAAMKLMEQHGVVVGAEEEQRLSGLSEAQMIESLVARMPQQSKEQFQHFFLQLQLIVSTATRIRQALEAGRADIVEQAMEDAESTGVAQYVLKMAVVQAGSEVNNLKKQHGAFVKDAQAKLSRLVKAQEDAVVAKERLV
Ga0304731_1077434313300028575MarineEETPVCRFLLVCSTLGAMAEPAPETEQPTKPLPESVQKGLSSSVKYLSGNFLREKHYSKISASLANRWDKFQSLTAAMKLMEQHGVHLSPEEEQRISSMSETQMIETLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVEQAMEDADSTGIAQYILKMAIVQAGSEVTNLKKQHAAWV
Ga0304731_1102055713300028575MarineAGPAAELLLARPLPFFLAMADAADTQPEAATIQPLPENIQKGLAASVKYLVGNFLENKHYSKISGSLASKWDKFQSLTAAMRLMEQHGVQLSPEEEQRLSSLSEAQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRAALEQGRADLVEAAMDDADSTGISQYILKMAIVQAGSEVTNLKKQHAAWCKDAEGKMSRLVKGAEDAALAK
Ga0304731_1113113113300028575MarineMADEVVAAPPQETLPESVQKGLNATVKYLTANFLNEKHFSKIGASLASRWDRFQSLSAAMKLMEQHGVKLTPEEEKELSGLGEAQMIEKLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEAGDAGAVSQAMDDADSTGIAQYILKMSIVQAGSEVMNLKNQHTAWVRDAEGKLSRLVRGQEEAMIAKQ
Ga0307402_1049995413300030653MarineMAEAAEVQVQPLPEKVQRGLSSAVKYMVSNLLAEKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMARLVKGAEDCQVAKERLAKAQGELA
Ga0307402_1053487613300030653MarineRFGSSQFGSRILQKLQTKVRTSAFPHARTYQNAMTDETVAVMEQQPLPENIQKGLSASVKYLVTNFLEEKHYTTISSSLATRWNTSQSLTAAMKLMEQHGVQVSPEEEERLSGMNEAQMIESLVTKMPQQSKEQFQHFFLQLQLIVSTATRIRSGLEQGRADVVEQAMDDAESTGIAQYVLKMAIVQAGSEVNNLKKQHGAFVKDAEAKLSRLVHGQEDMVVAKAR
Ga0307402_1063198313300030653MarineCFLVRGGKLDTQISRVTFPKTMSDAGGAPVVAAALPQSVHQGVVKYLVSNFLSDKHYSKIGGSLANKWDNFQSLTAAMKLMEQHGVVLTPEEQQRLSGLNEAQMIETLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRSDLVESAMDDADSTGIAQYILKMSIVQAGSEVTNLKKQHAAWVKDAESKMSRLVHGQEDAQT
Ga0307402_1064380813300030653MarineLKRCAGTEGADCSSAPFFAIMADETQAAPPKPEVQPLPENIQKGLSASVKYLTKQFLEDKHYSTISGSLANKWDKFQSLTAAMRLMEQHGVHLTPEEEARLSGLDEGQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVETAMDDAESTGIAQFILKMAIVQAGSEVNNLKKQHAAFVKDAESKMSRLVR
Ga0307402_1077671013300030653MarineADTFQSLTAAMRLMEQHGVHITPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEVGRKDLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLTKQHASWVKDAESKMSRLVRASDDAQVAKERMAKAQGELATFQANQNEGIKKVLMALAGGSTTALLHGCLSSW
Ga0307401_1039425413300030670MarineCSAGKGADFLSFISFLHLLSYRAMNAPAANMAVEAQPLPENMQKGLSASVKYLTKHFLEDKHYTTISGSLASKWDKFQSLTAAMRLMETHGVIISPEEEERLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRSALENGRADLVEQAMDDADSTGIAQYILKMAIVQAGSEVTNLKSQHAAFVKDAEGKMSRLVKAQE
Ga0307401_1051494413300030670MarineELASPLGAEAIPCTAYLAMADIAEQGAQVLPEGIQKGLSASVKYLVGNFLEGKHYTRISGSLATRWADTFQSLTAAMRLMEQHGVHITPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEVGRKDLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLT
Ga0307403_1058027513300030671MarineAAAEAQPLPEVVQRGLSASVKYMVSNLLAEKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMSRLVKGAEDCQVAKERLAKAQGELAVFTASA
Ga0307403_1060006713300030671MarineLTKQFLEDRHYSTISGSLANKWDKFQSLTAAMRLMEQHGVHLSPEEESRLSGLDEGQMIDALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVETAMDDAESTGIAQYILKMAIVQAGSEVNNLKKQHAAFVKDAESKMSRLVRGAEDAIVAKERLAKAHGELAVFQTSQNEHIKKVLMAFAGGCTTA
Ga0307403_1063243713300030671MarineMASAPVALDEPVVLPESVKQGLSASVKYLVSNLLVDKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVILEKAEEERLAGLTEAQMIEALVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALENGRADQVEQAMDDADSTGISQYILKMSIVQAGSEVTNLKR
Ga0307403_1067612313300030671MarineMADAAAAAEDVQAVVLPEYVNQGLSASVKYMVSNFLAEKHYTKISGSLANKWDKFQSLTAATKLMEQHGVVIDPAEEERLSGLTEAQMIESLVSRMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRSDLVEQAMDDADSTGIAQYILKMSIVQAGSE
Ga0307403_1081128813300030671MarineMADAAQAPEVPEVQPLPENIQKGLSASVKYLTKQFLEDKHYSTISGSLANKWDKFQSLTAAMRLMETHGVRLSPDEEERLSGLSEGQMIAALVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVETAMDDAESTGIAQYIL
Ga0307398_1047384513300030699MarineKLKCSAGKGADFLSFISFLHLLSYRAMNAPAANLAVEAQPLPENMQKGLSASVKYLTKHFLEDKHYTTISGSLASKWDKFQSLTAAMRLMETHGVIISPEEEERLSGLSEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRSALENGRADLVEQAMDDADSTGIAQYILKMSIVQAGSEVTNLKKQHAAFVKDAESKMSRLVKGQEDAMMAKERLIKAQGELA
Ga0307398_1077960113300030699MarineQVLELKCPADKGVNVSSGNSFAPLSSMADSIEVQPLPENVQKGLSASVKYMAGSFIADKHYAKISTSLATRWDKFQSLSAAMKLMEQHGVELTEEEQQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLKLQLIVSTATRIRTALEQGRADVVEQAMNDAESTGVAQYIIKMAIV
Ga0307398_1082995113300030699MarineSQPQQNMGLIEAEAPAQVVIPDGVRQGLSASVKYMVSQFLEDKHYTKVSGALADKWADKFQSLTAAMKLLEQHGVEISPEEEQRLSGLTEVQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALETGQSNVVEQAMDDAESTGIAQYILKMAIVQAGSEVNNL
Ga0307399_1028799213300030702MarineMASAPVALDEPVVLPESVKQGLSASVKYLVSNLLVDKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVILEKAEEERLAGLTEAQMIEALVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALENGRADQVEQAMDDADSTGISQYILKMSIVQAGSEVTNLKRQHAAWVKDAESKMSRLVKGAEDAVVARERLDKAHGELATFQNTQSSKFQSLLMALAGGNGTVLLHTA
Ga0307399_1044316713300030702MarinePFCWRVRHIDSIFFGASQPQEDMAEVAAPAQVVIPDGVRQGLSASVKYMVSQFLEDKHYTKVSGALADKWADKFQSLTAAMKLLEQHGVEISPEEEQRLSGLTEVQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALETGRSDLVEQAMDDAESTGISQYILKMAIVQAGSEVNNLKRQHASWVKDAESKMSRLVRGSEDAII
Ga0307400_1085493713300030709MarineMASAPVALDEPVVLPESVKQGLSASVKYLVSNLLVDKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVILEKAEEERLAGLTEAQMIEALVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALENGRADQVEQAMDDADSTGISQYILKMSIVQAGSEV
Ga0307400_1087173113300030709MarineQAAAEPQVQPLPENIQKGLSASVKYLTKQFLEDKHYSTISGSLANKWDKFQSLTAAMRLMEQHGVHLSPEEEERLSGMSEGQMIDALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVETAMDDAESTGIAQYILKMAIVQAGSEVNNLKKQHKAFVKDAESKMSRLVRGSEDM
Ga0307400_1096216513300030709MarineMADAAEQPIVEQPLPANIQQGLSASVKYLTKQFLEEKHYMTISGSLAQKWDKLQSLTAAMKLMEQHGVFIGPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVETAMDDADSTGITQYILKMAIVQAG
Ga0308131_109982913300030729MarineMQAAPLPENIQKGLSSSVKYLVSNFLDDKNYSKIAGSLANRWDKFQSLTAAMKLMEQHGVTLAPEEEERLSGMNEAQMIETLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRADLVEQAMDDAESTGISQYILKMSIVQAGSEVTNLKKQHSSWVKDAESKLSRLSHGM
Ga0073988_1220528513300030780MarinePGPHPRHTWVDPKTMADAVPTELPASVQKGLSASVKYLVSNFLAEKHYSKIGGSLANRWDKFQSLTAAMKLMEQHGVQLDPQEEQRLSGMSEAQMIETLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRSDLVEQAMEDAESTGISQYILKMSIVQAGSEVNNLKRQHAAWVKDAEAKMS
Ga0073966_1181126113300030786MarineMADVEAAPEVKPLPESVQRGLSASVKYMVNSLLNEKHYGKISSSLANRWDKFQSMTAAMKLMEQHGVHIGPEEEARLAGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRIRTALEQGRADLVEQAMDDADSTGIAQYILKMAIVQAGSEVNNLKKQHAAFVKDAESKLSRLVRGQEDMMLAKQRLAKATGELAVF
Ga0073972_1128372813300030865MarineMADVEAAPEVKPLPESVQRGLSASVKYMVNSLLNEKHYGKISSSLANRWDKFQSMTAAMKLMEQHGVHIGPEEEARLAGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRIRTALEQGRADLVEQAMDDADSTGIAQYILKMAIVQAGSEVNNLKKQHAAFVK
Ga0151494_139864013300030871MarineMAVLDEVQVEALPQQVQKGLSACVKHLVEQLLTDKHYSKTSVALASRWDKCQSLTAAMKLMEQHGVVISPEEEERLAGLSEAAMIEAMVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRPELVEQAMDDAESTGISQYILKMSIVQAGSEVNNLKKQHAAFVKDAEGKLS
Ga0073970_1079319413300030919MarineTAQVLSKSFQTLLGIRQCTAMEAKTLPENFQKGLLPSVKYLVSNLLEQRHYGKISSSLAHQWDKFQTCMAAMKLMEQHGVHIPPEEVERLEKLSEPQVIEALVAKMPQQSKEQFQHFFLQLQLIVSTATRVRSGLEQGRADVVEQAMDDAESTGVAQYILKMAVVQAGSE
Ga0073944_1123530913300030956MarinePLPENIQKGLSASMKYLVSNFLDDKHYSKISGSLAGNWNKFQSLTAAMKLMEQHGVHLSPEEEQRLSGMSEPQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVESALDDAESTGITQYILKMCIVQAGSEVTNLKKQHGAWVKDAESKMSRLVKGAEDAIVAKERLAKAQGELAVFQTEQNEHI
Ga0151491_108349413300030961MarineMADAADTQPSAIAQPLPENIQKGLSASVKYLVSNFLDAKHYSKISGSLALKWDKFQSLTAAMRLMEQHGVHLSPEEEQRLSSLSEAQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRAALEQGRADLVEQAMDDADSTGISQYILKMSIVQAGSEVTNLKKQHGAWVKDAESKMSRLVRGQEDATLAKQRLAKAQGELAVFQ
Ga0138346_1004799713300031056MarineAKISSSLSNRWDRFQSLSAAMKLMEQHGVKLSPEEEANLSSLSEAQMIEQLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGNSAEVAQAMDDADSTGIAQYMLKMAIVQAGSEVTNLKAQHSAWVRDAEAKLARLVRGAEELDMAKTKLAKAQQELAEFQTEANEKVKKVL
Ga0138347_1027144613300031113MarineMADDEQVAMEVDAAPSAPPLPASVQKGLGNSVRYLVGNFLTEKHYAKIGKSLSNRWDRFQSLSAAMKLMEQHGVKLSPEEEQSLSQMNEGQMIESLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRAALEQGRADIVEQAMNDAD
Ga0138347_1126174013300031113MarineLLAQSRSNLRRVFLVFIYPRSSAMSDAGAPEPSRAAAPAAPLPDSVQKGLVASVKYLEKAFFAEKHYAAVSTALASKWERFQSLTAAMKLMENYGVHLSEAEHQRLSQLSEVQMVEALVNKMPQQSNEQFQHFFLQLQLVVSTATRVRQALELGQADAVEQAMHDAESTGIAQ
Ga0138347_1131662213300031113MarineLVVPTMAESVAKPEAQPLPEALQKGLSASVRYVVSNFLEEEHYSKISVSLASKWDKFQSLTAAMKLMQQYGVHLEPEEEQRLSAMGEAQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRSDLVEQALDEADSTGIANYILKMALVQAGTEVTVLKNHFTACCKDWDLKMAKLIRGQEDAMQAKKRLA
Ga0138347_1132561413300031113MarineMAAEDAPKPLAENVQRGIAASTKYLASNFLKDKHYSIVSRALAAKHDKFQSMTAAMKLMEQHGVHIDESEQERLSSLSETQMIEQLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALESGREDLVEQAMNDADSTGVSQYILKMAIVQAGAEVTNLSAQHAAFVKDAEAKMSRLVKGAEDLVVAKGRLAKAQGDLAAF
Ga0138345_1035761613300031121MarineQHLICWLALGAVCSAMATTADAPLPDNIQKGLSASVKYLAGVFLDEKHLGNISASLATKWDKFQALTAAMRLMEQNGVHLGPEEEQRLSGMSEAQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRAALEKGCADLVEQAMDDAESTGICQYILKMSIVQAGAEVTNLKNQH
Ga0073962_1101391413300031126MarineVLTVFISPFFSVAMADVVADTTALPEKVKTGLASSVKYLVSNLLTDKHYTKVSTALASRWDKSQSMSAAMKLMEQHGVVISPEEEERLAGLSEAAMIEAMVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRPELVEQAMDDAESTGISQYILKMSIVQAGSEVNNLKKQHAAFVKDAEGKLSRLVKAQEDAVVAKE
Ga0073962_1160781213300031126MarineVDAAESQPVVQPLPENIQQGLSASVKYLVGNFLENRHYSKISASLASKWDKFQSLTAAMRLMEQHGVHLSPEEEQRLSSLSEAQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRDDLVETAMDDADSTGISQYILKMSIVQAGSE
Ga0073952_1156410013300031445MarineCSAGKGVDVSSGYSLRRPDTMADSTEPQQVQPLPENIQRGLSASVKYMVNNLLNEKHYGKISSSLANRWDKFQSMTAAMKLMEQHGVHIGPEEEARLAGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRIRTALEQGRADLVEQAMDDADSTGIAQYILKMAIVQAGSEVNNLRKQHAAFVKDAESKMSRLVRGQEDMMLAKQRLAKATGELAVFQTSQNE
Ga0073952_1164554013300031445MarineMADAAESQPVVQPLPENIQQGLSASVKYLVGNFLENRHYSKISASLASKWDKFQSLTAAMRLMEQHGVHLSPEEEQRLSSLSEAQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRSDLVEQAMDDAESTGIAQYILKMAIVQAGSEVTNLKKQHAAWCKDAESKMSRLVRGTEDAQIAKERLIKAQGEL
Ga0073952_1191249713300031445MarineSNISAALAMKWDKFQSLTAAMRLMEQHGVHLGPEEEERLSSLSEAQMIEALVSKMPQQSKEQFQHFFLQLQLIVSTATRVRAALEQGRADLVEQAMNDADSTGISQYILKMSIVQAGSEVTNLKKQHEAWVKDAESKMSRLVRGQEDMIVAKERLNKAMGELAAFQSSQNENIKKVLMTFAGGSATALLHGCLNSWHS
Ga0073950_1080147813300031459MarineCAASRTMGDVASPVDLPASVQKGLSASVKYLVSNFLAEKHYSKIGGSLANRWDKFQSLTAAMKLMEQHGVQLDPQEEQRLSGMSEAQMIETLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRSDLVEQAMNDAESTGIAQYILKMSIVQAGSEVNNLKRQ
Ga0307388_1065725813300031522MarineMSKASVKAPEPASAEAPEIPSVDSLATLPETVKKGLSASVKYLVSNLLKDEHYSKISASLASRWDKCQSMNAAMKLMEQSGVHITPEEEQRLSGLTEAQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRSDLVEQAMDDAESTGIVQYILKLTIVQAGSEVTNLKKTHAAFVKDAEGKLARMVKASEDAMVAKERLQKA
Ga0307388_1066615213300031522MarineMADAAEPQVQPLPDVVKRGLSASVKYMVSNLLAEKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLGGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMSRLVKGAEDCQVAKERLAKAQGELAVFTASANENIKK
Ga0307388_1093521513300031522MarineMTDAAVAPPAEEEVVVLPESVKQGLSASVKYMVSNFLADKHYSKISGSLANRWDKCQSLTAAMKLMETHGVHLDPSEEERLSGLNEAQMIETLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRKALEEGRADVVEQAMDDADSTGIAQYILKMSIVQAGSEVNNLKRQHA
Ga0307388_1104365413300031522MarineNLLTETHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEAAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMSRLVKGAEDCQVAKERLAKAQGELAVFTASANENIKKV
Ga0307392_103498113300031550MarineAGEPQVQPLPEKVQRGLSASVKYMVSNLLAEKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLGGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMARLVKGSEDCQIAKERLAKAQGELAVFSASANENIK
Ga0308134_108119213300031579MarineMADTAPATEEVQVVVLPESVKQGLSASVKYLVSNFLAEKHYSKISGSLAARWDKFQSLTAAMKLMEQHGVHLEPQEQERLSGLTEPQMIEALVAKMPQQSKEQFQHFFLQLQLIVSTATRVRKALEEGRADVVEKAMDDADSTGISQYILKMSIVQAGTEVTNLKSTHAAWVQDAEGKMSRLVKGSEDAVVAKERLMKAQGELAAFQTTQNENIKKVLMAFA
Ga0308134_114477313300031579MarineLPESVKQGLSASVKYLVSNFLADKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVHLDPAEQERLSNLTEAQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRKALEEGRADVVEQAMDDADSTGIAQYILKMSIVQAGTEVTNLKRTHAAWVKDAEGKMSRLVKGSEDAVVAKER
Ga0308132_107805913300031580MarineFCLGVQHIDSIFFGASKSQQESSGMAPAQEADIAAPVQVVIPDGVRQGLSASVKYMVSQFLEDKHYTKVSGALADKWADKFQSLTAAMKLLEQHGVEISPEEEQRLGGLTEVQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALESGQSDLVEQAMDDADSTGIAQYILKMAIVQAGSEVNNLKRQHAAWVKDAESKMSRLVRGSEDAVIAKERLAKAQG
Ga0308132_111820113300031580MarineSRARKPPGVEAIPCTACLAMAELAEQGAQVLPEGLQKGLSASVKFLVGNFLEGKHYTRISGSLATRWADTFQSLTAAMRLMEQHGVHITPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEVGRKDLVEQAMDDADSTGISQYILKMAIVQAGSEVNNV
Ga0308132_113604213300031580MarineQRCWFFATHIFLVSMAESMAALPENVKQGLSTSVKYLVSNFLSDKHYSKISASLATRWDKLQSMSAAMKLMEQHGVHIGAEEEQRLAGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRADLVEQAMDDAESTGIAQYILKMSIVQAGSEV
Ga0307385_1029053013300031709MarineSVGNGVDVSSDKSANHPTMADSAEPQQVQPLPENIQRGLSASVKYMVSNLLSEKHYSKVSSSLANRWTKFQSMTAAMKLMETHGVSIGPEEEERLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRGALELGGADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHSAFVKDAEGKLARLVKSAEDCHIA
Ga0307385_1033457013300031709MarineYSKISGSLANRWDKFQSLTAAMKLMEQHGVILEKAEEERLAGLTEAQMIEALVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALENGRADQVEQAMDDADSTGISQYILKMSIVQAGSEVTNLKRQHAAWVKDAESKMSRLVKGAEDAVVARERLEKAHAELASFQVQQSSKIQGVLMALAGGCGTALMHT
Ga0307385_1035667613300031709MarineKLKCSAGKGADFLSFISFLHLLSYRAMNAPAANLAVEVQPLPENMQKGLSASVKYLTKHFLEDKHYTTISGSLASKWDKFQSLTAAMRLMETHGVIISPEEEERLSGLSEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRSALENGRADLVEQAMDDADSTGIAQYILKMAIVQAGSE
Ga0307386_1049376813300031710MarineSSVALLLGVRHIDSIFFGASRPQEDMAEVAAPAQVVIPDGVRQGLSASVKYMVSQFLEDKHYTKVSCALADKWADKFQSLTAAMKLLEQHGVEISPEEEQRLSGLTEVQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALETGRSDLVEQAMDDAESTGISQYILKMAIVQAGSEVNNLKRQHASWVKDAESKMSRLVRGSEDAI
Ga0307386_1050062913300031710MarineMADSVEPQQVQPLPENIQRGLSASVKYMVSNLLSEKHYSKVSSSLANRWTKFQSMTAAMKLMETHGVSIGPEEEERLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRIRTALENGQADLVEQAMDDADSTGIAQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKLSRLVKGQENCM
Ga0307386_1062466713300031710MarineMADAGEPQVQPLPEKVQRGLSASVKYMVSNLLAEKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDA
Ga0307386_1073847713300031710MarineVANFLSDKQYTKISGALANKWERFQSLTAAVKLMEQHGVQVTPEEEERMSGLSEMQMIESLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTALETGRADLVERAMDDADSTGISQYILKMCIVQAGSEVTNLKRQHECWVKDAESKMSRLVRGAEDAIIAKERLAKAQGELATFQ
Ga0307396_1026525813300031717MarineMADAAEAQPLPETVQRGLSASVKYMVSNLLTETHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRGALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMARLVKGAEDCQIAKERLAKAMGELAVFSASKLLTMYFTDALSPLWTVSGSGGASAASAIVKTVGQNQPMKR
Ga0307396_1038664813300031717MarineSIFFGASQPQQNMGLIEAEAPAQVVIPDGVRQGLSASVKYMVSQFLEDKHYTKVSGALADKWADKFQSLTAAMKLLEQHGVEISPEEEQRLSGLTEVQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALETGRSDLVEQAMDDAESTGISQYILKMAIVQAGSEVNNLKRQHASWVKDAESKMSRLVRGSEDAIIARERLAKANAELATFQANQNE
Ga0307396_1040040613300031717MarineLASPLGAEAIPCTAYLAMADIAEQGAQVLPEGIQKGLSASVKYLVGNFLEGKHYTRISGSLATRWADTFQSLTAAMRLMEQHGVHITPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEVGRKDLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLTKQHASWVKDAESKMSRLVRASDDAQVAKERMAKAQGELA
Ga0307396_1065691113300031717MarineLKCSAGKGADFLSFISFLHLLSYRAMNAPAANMAVEAQPLPENMQKGLSASVKYLTKHFLEDKHYTTISGSLASKWDKFQSLTAAMRLMETHGVIISPEEEERLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRSALENGRADLVEQAMDDADST
Ga0307381_1038040113300031725MarineSISDVPQYRSHPVILCTILVSMAETFDGFSASVRLMVSSLLEDKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLGGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQ
Ga0307391_1054775513300031729MarineMASAPVALDEPVVLPESVKQGLSASVKYLVSNLLVDKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVILEKAEEERLAGLTEAQMIEALVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALENGRADQVEQAMDDADSTGISQYILKMSIVQAGSEVTNLKRQHAAWVKDAESKMSRLVKGAEDAVVA
Ga0307391_1078915213300031729MarineAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQCKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMSRLVKGAEDCQVAKERLAKAQGELAVFTASANENIKKVLMAFAGGSKTALLHSVLNTWAN
Ga0307391_1082778313300031729MarineRRATRTVLGKMAAEDAVMPAPLPENIQKGLSASVRYLVSNFLSDKNYSKIAGSLANKWDKFQSLTAAMKLMEQHGVVLTPEEEERLSGMNEAQMIETLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRADIVEQAMDDAESTGIAQYILKMSIVQAGSEVTNLKKQHSAW
Ga0307391_1082880013300031729MarineMADTQVEATPLPESIQKGLSASVKHLVNNFLEEKHYSAISEALACRWDKFQSLTAAMKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPSQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKMAIVQAGSEV
Ga0307394_1024767213300031735MarineMAEVAAPAQVVIPDGVRQGLSASVKYMVSQFLEDKHYTKVSGALADKWADKFQSLTAAMKLLEQHGVEISPEEEQRLSGLTEVQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALETGRSDLVEQAMDDAESTGISQYILKMAIVQAGSEVNNLKRQHASWVKDAESKMSRLVRGSEDAIIARERLAKANAELATFQANQNE
Ga0307387_1095951413300031737MarineCSAVKGRGRLFVDSFLASFFTTMAAADAQVPEVHPLPENIQKGLSASVKYLTKQFLEDKHYSTISGSLANKWDKFQSLTAAMRLMEQHGVHLSPEEEERLAGMSEGQMIDALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVETAMDDAESTGIAQYILKMAIVQAGSE
Ga0307387_1099551313300031737MarineLANKWDKFQSLSAAMKLMEQNGVVLDPAEEQKVAGMNEAQMIEYLVQKMPEQSKEQFQHFFLQLQLIVSTATRVRTALEQGRDDLVSQAMDDAESTGIAQYILKMTIVQAGSEVNNLKTQHSSWVKDAEMKLSKLVKGQEDAIMAKERLDKAMGDLAQFQTQQNENIKKVLMTFAGGS
Ga0307387_1110246313300031737MarineLTAAMKLLEQHGVEISPEEEQRLSGLTEVQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALETGQSNVVEQAMDDAESTGISQYILKMAIVQAGSEVNNLKRQHKAWVKDAESKMSRLVHGMEDAEVAKERLNKAHGELAIFQSSSNDSIKKILMVFAGGST
Ga0307384_1044707413300031738MarineMADAGEPQVQPLPEKVQRGLSASVKYMVSNLLAEKHYSKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLAGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMSRLVK
Ga0307384_1054656013300031738MarineLIGKGEGALLASPSVFLVTMAEAPEIPAVESMAALPETVKKGLSASVKYLVGNFIEDKHYSKISSSLASRWDKCQSMNAAMKLMEQSGVHITPEEEQRLSGLTEAQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRADLVEQAMDDAESTGIVQYILKLTIVQAGSEVTNL
Ga0307384_1062659013300031738MarineMADAAEAQPLPETVRRGLSASVKYMVSNLLADKHYCKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRGALEQGRADLVEQAMDDADSTGISQYILKMAI
Ga0307383_1037003613300031739MarineMADAGEPQVQPLPEKVQRGLSASVKYMVSNLLAEKHYSKIRSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLGGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMARLVKGAEDCQIAKERLAKAMGELAVFTASANENIKKV
Ga0307383_1048224513300031739MarineGYLAMADIAEQGAQVLPEGIQKGLSASVKYLVGNFLEGKHYTRISGSLATRWADTFQSLTAAMRLMEQHGVHITPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEVGRKDLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLTKQHASWVKDAESKMSRLVRASDDAQVAKERMAKAQGELA
Ga0307383_1069283113300031739MarineLRASPCVFLVAMAEAPAAAGTETLAAIPDNVKKGLRASVSFLVSNLLTEKHYSKISTSLASRWDQFQSMSAAMKLMEQHGVVITPEEQTRLSGLTEGQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEVGRSDLVTQAMEDAEQTGISQ
Ga0307383_1070168513300031739MarineQPIVEQPLPANIQQGLSASVKYLTKQFLEEKHYMTISGSLAQKWDKLQSLTAAMKLMEQHGVFIGPEEEDRLAGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVETAMDDADSTGITQYILKMAIVQAGSEVNNLKKQHSMWVKDAESKM
Ga0307395_1033620413300031742MarineFLQLGASTFHRVILRTVPREGYRIMSKQPVDAPTMAEAAEPQVQPLPEKVQRGLSAAVKYMVSNLLAEKHYCKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGISQYILKMAIVQAGSEVNNLKKQHAAFVKDAEGKMSRLVKGAQ
Ga0307395_1036357613300031742MarineMAEVAAPAQVVIPDGVRQGLSASVKYMVSQFLEDKHYTKVSGALADKWADKFQSLTAAMKLLEQHGVEISPEEEQRLSGLTEVQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALETGRSDLVEQAMDDAESTGISQYILKMAIVQAGSEVNNLKRQHASWVKDAESKMSRLVRGS
Ga0307395_1047917113300031742MarineMADSAETQMVQPLPEKVQKGLSASVKYMVSNLLNEKHYSKVSSSLATRWDSFQSMTAAMKLMEQHGVEITPEEQTRLSSLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVEQAMDDADSTGIAQYILKMAIVQAGS
Ga0307382_1047596213300031743MarineMASAPVALDEPVVLPESVKQGLSASVKYLVSNLLVDKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVILEKAEEERLAGLTEAQMIEALVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALENGRADQVEQAMDDADSTGISQYILKMSIVQAGSEVTNLKRQHAAWVKDAE
Ga0307382_1057296013300031743MarineRNLPGAEAIPCTGYLAMADIAEQGAQVLPEGIQKGLSASVKYLVGNFLEGKHYTRISGSLATRWADTFQSLTAAMRLMEQHGVHITPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEVGRKDLVEQAMDDADSTGISQYILKMAIVQAGSE
Ga0307389_1072065213300031750MarineMSKASVKAPEPASAEAPEIPSVDSLATLPETVKKGLSASVKYLVGNLLKDEHYSKISQSLASRWDKCQSMNAAMKLMEQSGVHITPEEEQRLSGLTEAQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRADLVEQAMDDAESTGIVQYILKLTIVQAGSEVTNLKKTHAAFVKDAEGKLSR
Ga0307389_1075097813300031750MarineSSSHAPVVSLLHSCAVSYAMSDKGEIPSVIDQPLPEQIQKGLSASVKYLVSNFLEDKHYSHISASLASKWDKFQSLTAAMRLMEQHGVVLSPEDEQRLSGMSEAQMIETLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEQGASENVEQAMNDADSTGIAQYILKMAIVQAGSEVTNLKKQHAAWVRDAEGKLSKLCRGAEDAATAKE
Ga0307389_1076036813300031750MarineQAQTLLDKGDGAPLRASPCVFLVAMAAPPPAAATETLAALPENVKQGLRASVSYLVSNLLQEKHYSKISTSLASRWDQFQSMSAAMKLMEQHGVVITPEEQQRLSGLTEGQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRSDLVEAAMEDAESTGISQYILKMSIVQAGSEVTNLKKQHAAFMKDAEGKLSRLVKAQ
Ga0307389_1089256613300031750MarineFGSSHFGSSAPSKVSVFRSYLSCTLSETMAETTAVAEQPLPESVKKGLSASVKYMVSNFLADKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVHLTPEEEERISGLSEIQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRAALEQGRADLVEQAMDDADSTGIAQYILKMSIVQAGSEVTNLKKQHSAW
Ga0307389_1091414613300031750MarineAQLLQSRGGLSRRFRASLASMADLAAPIPPTDVPESVRRGLGQSVKYLVTTFLKDKHYSKIGGSLANRWDKFQSLTAAMKLMEQHGVVLDPQEEQRLSGMNEAQMIEALVMKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEEGRDDVVEQAMDDAESTGIAQYILKMSIVQAGSEVNNLKAQHSAWVKDA
Ga0307389_1103019613300031750MarineASVTYLVTNFLEEKHYTTISSSLATRWNTSQSLTAAMKLMEQHGVQVSPEEEERLSGMNEAQMIESLVTKMPQQSKEQFQHFFLQLQLIVSTATRIRSGLEQGRADVVEQAMDDAESTGIAQYVLKMAIVQAGSEVNNLKKQHGAFVKDAEAKLSRLVHGQEDMVVAKARLQKAHGELAIFQ
Ga0307389_1112183613300031750MarineMADAAPAPDMPEVQPLPENIQKGLSASVKYLTKQFLEEKHYSTISGSLANRWDKFQSLTAAMRLMEQHGVHLSPEEEERLSAMSEPQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRIRSALEQGRADLVEQAMEDADSTGISQYILKT
Ga0307389_1112828513300031750MarineRVCHSLPSAVVGAMADTAADVLPASVSKGLSSMVPRFLVSQFLKDKHYSKVSGSLANKWDKFQSLSAAMKLMEQNGVVLDPAEEQKVAGMNEAQMIEYLVQKMPEQSKEQFQHFFLQLQLIVSTATRVRTALEQGRDDLVSQAMDDAESTGIAQYILKMTIVQAGSEVNNLKT
Ga0307389_1113492013300031750MarineSSVVQVQRGADCSSAPFFAIMADETQAAPPKPEVQPLPENIQKGLSASVKYLTKQFLEDRHYSTISGSLANKWDKFQSLTAAMRLMEQHGVHLSPEEESRLSGLDEGQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEQGRADLVETAMDDAESTGIAQFILKM
Ga0307404_1031370213300031752MarineLKPFWLKLECSAGKGVDVSSCNSFRHLDTMTDTVQALPENVQKGLTASVKYIVGNLLAEKHYSKISSSLATKWDKFQSLTAAKMLMQQHGVQITPEEEDRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRIRTALEQGRADLVEQAMEDADSTGISQYILKMAIVQAGSEVNNLKKQHGAFAKDAESKLSRLCKGAEDAAIAAERL
Ga0307404_1035046913300031752MarineMAEVAAPAQVVIPDGVRQGLSASVKYMVSQFLEDKHYTKVSGALADKWADKFQSLTAAMKLLEQHGVEISPEEEQRLSGLTEVQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALETGRSDLVEQAMDDAESTGISQYILKMAIVQAGSEVNNLKRQHASWVKDAESKMSRL
Ga0307404_1046840013300031752MarineTFLQLVASTFHRVILRTVPRQGYRIMSKQPVDAPTMAEAAEVQPLPEKVQRGLSAAVKYMVSNLLAEKHYCKISSSLATRWDRFQSMTAAMKLMEQHGVHITPEEEQRLSGLTEPQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRTRTALEQGRADLVEQAMDDADSTGIS
Ga0314675_1053845713300032491SeawaterSLANRWDKFQSLTAAMKLMEQHGVVLEKAEEERLAGLTEPQMIEALVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALESGRADQVEQAMDDADSTGISQYILKMSIVQAGSEVNNLKRQHAAWVKDAEGKLSRLVKGAEDAEVAKERLDKAHAELASFQTVQSSKIQGVLMALAGGCGTALMHTALCGW
Ga0314679_1052542113300032492SeawaterPVPQLPENVKKGLSASVKYLASNFLNDKHFSKISSALANKWDKFQSLTAAMRLMEQHGVTLDPAEQERLSSMGEAQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRADQVEKSMEDADSTGISQYILKMSIVQAGSEVNNLKKQHAAWVKDAESKLSRLVRGQ
Ga0314688_1059366113300032517SeawaterAISRILLLPSTSMADTQVQPEVDATPLPENIQKGLSASVKHLVNNFLEEKHYSAISEALACRWDKFQSLTAAMKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKMAIVQAGSEVTNLKRQHVAFVRDAEGKMSRLVKASED
Ga0314689_1069947113300032518SeawaterRRRASRTILGKMAAEDAVVPAPLPENIQKGLSTSVRYLVSNFLSDKNYSKIAGSLANKWDKFQSLTAAMKLMEQHGVVLTPEEEERLSGMNEAQMIETLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRADIVEQAMDDAESTGIAQYILKMSIVQAGSEVTNLKK
Ga0314676_1065735913300032519SeawaterMADTQVQPEVDATPLPENIQKGLSASVKHLVNNFLEEKHYSAISEALACRWDKFQSLTAAMKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKMAIVQAGSEVTNLKRQHVAFVRDAEGKMSRLVKASEDCQ
Ga0314667_1047746713300032520SeawaterMADAAETLPVAQPLPENIQQGLSASVKYLVGNFLEEKHYSKISANLASKWDKFQSLTAAMRLMEQHGVTLTPEEEERLSGMGEAQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEQGRHDLVETAMNDAESTGISQYILKMAIVQAGSEVTNLKKQHTAWVKDAESKMSKLSKGTEDALVAKERLAKAQGGLAVFQTEQSE
Ga0314680_1067905013300032521SeawaterDVLSFFSFMHLVSYRAMDAPAANAGVVEAKPLPENMQKGLSASVKYLTKHFLEDKHYTTISGSLATKWDKFQSLTAAMRLMETHGVIISPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRSALENGRADLVEQAMDDADSTGIAQYILKMAIVQAGSEVNNLKSQHAAFVKDAEGKMSRLVKAQEDAEIAKERLQKCM
Ga0314680_1098540613300032521SeawaterKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKMAIVQAGSEVTNLKRQHVAFVRDAEGKMSRLVKASEDCQVAHERLIKAQGELACFQTAANDNIKKVLMNIAGGGTMAHLHSCLSGW
Ga0314671_1064272113300032616SeawaterDKFQSLTAAMRLMEQHGVTLTPEEEERLSGMGEAQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEQGRHDLVETAMNDAESTGISQYILKMAIVQAGSEVTNLKKQHTAWVKDAESKMSKLSKGTEDALVAKERLAKAQGELAVFQTEQSEHIKKVLMAFAGGSATALLHGCFSSWHTFVK
Ga0314683_1052906113300032617SeawaterMADAAETLPVAQPLPENIQQGLSASVKYLVGNFLEEKHYSKISANLASKWDKFQSLTAAMRLMEQHGVTLTPEEEERLSGMGEAQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEQGRHDLVETAMNDAESTGISQYILKMAIVQAGSEVTNLKKQHTAWVKDAESKMSKLSKGTEDALVAK
Ga0314683_1073108613300032617SeawaterMADTQVQPEVDATPLPENIQKGLSASVKHLVNNFLEEKHYSAISEALACRWDKFQSLTAAMKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKMAIVQAGSEVTNLKRQHVAFVRDAEGKMS
Ga0314685_1071483213300032651SeawaterMADTQVQPEVDATPLPENIQKGLSASVKHLVNNFLEEKHYSAISEALACRWDKFQSLTAAMKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKMAIVQAGSEVTNL
Ga0314669_1057122713300032708SeawaterMAEQDITAPLPEKIQKGLSASVKYLVTTFLQDKHYALIGQSLASKWSDRFHSLTAAMKLMEQHGVQLEQSEQDKLLQMGEAQMIESLVLKMPQQSKEQIQHFFLQLQLIVSTATRVRSALELGKSELVEMAMDDSDSTGVAPYILKMAVVQAGSEVTNLKRQHTAFVRDAEAKLSRLVRGQED
Ga0314669_1072206913300032708SeawaterMATEDAVVPAPLPENIQKGLSASVRYLVSNFLSDKNYSKIAGSLANKWDKFQSLTAAMKLMEQHGVVLTPEEEERLSGMNEAQMIETLVMKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRADIVEQAMDDAESTGIAQYILKMSIVQAGSEVTNLKKQHTAWVK
Ga0314672_137465813300032709SeawaterFFSFLHLVSYRAMDAPAANAGVVEAKPLPENMQKGLSASVKYLTKHFLEDKHYTTISGSLASKWDKFQSLTAAMRLMETHGVIISPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRSALESGRADLVEQAMDDADSTGIAQYILKMAIVQAGSEVN
Ga0314703_1045281413300032723SeawaterHYSKISANLASKWDKFQSLTAAMRLMEQHGVTLTPEEEERLSGMGEAQMIETLVTKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEQGRHDLVETAMNDAESTGISQYILKMAIVQAGSEVTNLKKQHTAWVKDAESKMSKLSKGTEDALVAKERLAKAQGELAVFQTEQSE
Ga0314711_1065560813300032732SeawaterSMAEGMAALPENVKQGLSTSVKYLVSNFLTDKHYSKISASLATRWDKLQSMSAAMKLMEQHGVHIGEEEEQRLAGLTEAQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRADLVEQAMDDAESTGIAQYILKMSIVQAGSEVTNLKKQHAAFVKDAESKMSRL
Ga0314714_1081760513300032733SeawaterMKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKMAIVQAGSEVTNLKRQHVAFVRDAEGKMSRLVKASEDCQVAHERLVKAQGELACFQTAANDNIKKVLMNIAGGGTMA
Ga0314706_1057274613300032734SeawaterLLSYRAMDAPAANVGVEAKPLPENMQKGLSASVKYLTKHFLEDKHYTTISGSLASKWDKFQSLTAAMRLMETHGVIISPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRSALESGRADLVEQAMDDADSTGIAQYILKMAIVQAGSEVNNLKSQHSAFVKD
Ga0314712_1055121413300032747SeawaterMPEGEMTMTPEQTLPDSVQKGLSASVKYLASNFLKDKHYSKVSSSLANRWDKYQSLSAAMKLMEQHGVVLSPEETERLSSLGEAQMIESLVTKMPQQSKEQFQHFFLQLQLIVSTASRVRQALEQGRAEEVERAMDDADSTGISQYILKMAI
Ga0314700_1068062413300032752SeawaterAVSVATMADTAPATEDVAVVVLPESVKQGLSASVKYLVSNFLADKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVHLDPAEQERLSNLTEAQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRKALEEGRADVVEQAMDDADSTGIAQYILKMSIVQAGTEVTNLKRTHAAWVKD
Ga0314692_1070447613300032754SeawaterMADTQVQPEVDATPLPENIQKGLSASVKHLVNNFLEEKHYSAISEALACRWDKFQSLTAAMKLMEQHGVYLDPAEQERVSGLTEMQMIECLVAKMPQQSKEQFQHFFLQLQLIVSTATRVRTGLEQGRADAVTQAMDDADSTGIAQYILKMAIVQAGSE
Ga0314692_1073926213300032754SeawaterVQPLPESVQKGLSASVKYLAGQFLNDKHYSKISGSLASKWDKFQSLTAAMRLMEQHGVTLSPEEEQRLSSLSEPQMIEALVTKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEAGRADLVEQAMTDADSTGISQYILKMSIVQAGSEVTNLKKQHAAWVKDAESKMSRL
Ga0314709_1060969313300032755SeawaterMADVTELPKEPAPLPESVQRGLSASVRYLANNFLKEKHFSKVSASLANRWDKMQSIGAAVKLMEQHGVVLTPDEEQRISGMGEAQMIETLVQKMPQQSKEQFQHFFLQLQLIVSTATRVRQALEQGRADAVEQAMDDADSTGISQYILKMSIVQAGSEVTNLKKQHAAWVKDAESKLSRLVRGQEDLVLARKRLGKAQGELASF
Ga0314709_1088979013300032755SeawaterMPEGEMTMTPEQTLPDSVQKGLSASVKYLASNFLKDKHYSKVSSSLANRWDKYQSLSAAMKLMEQHGVVLSPEETERLSSLGEAQMIESLVTKMPQQSKEQFQHFFLQLQLIVSTASRVRQALEQGRAEEVERAMDDADSTGISQYILRM
Ga0307390_1038013623300033572MarineMASAPVALDEPVVLPESVKQGLSASVKYLVSNLLVDKHYSKISGSLANRWDKFQSLTAAMKLMEQHGVILEKAEEERLAGLTEAQMIEALVSKMPQQSKEQFQHFFLQLQLIVSTATRVRQALENGRADQVEQAMDDADSTGISQYILKMSIVQAGSEVTNLKRQHAAWVKDAESKMSRLVKGAEDAVVARERLEKAHAELASFQVQQSS
Ga0307390_1105776913300033572MarinePVVSLLHSCAVSYAMSDKGETPSVIDQPLPEQIQKGLSASVKYLVSNFLEDKHYSHISASLASKWDKFQSLTAAMRLMEQHGVVLSPEDEQRLSGMSEAQMIETLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRSALEQGASENVEQAMNDADSTGIAQYILKMAIVQAG
Ga0307390_1106518913300033572MarineALELASPLGAEAIPCTAYLAMADIAEQGAQVLPEGIQKGLSASVKYLVGNFLEGKHYTRISGSLATRWADTFQSLTAAMRLMEQHGVHITPEEEQRLSGLTEMQMIESLVSKMPQQSKEQFQHFFLQLQLIVSTATRVRTALEVGRKDLVEQAIDDADSTGISQYILKMA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.