NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040351

Metagenome / Metatranscriptome Family F040351

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040351
Family Type Metagenome / Metatranscriptome
Number of Sequences 162
Average Sequence Length 47 residues
Representative Sequence CEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVSIPMFDHPRLGKV
Number of Associated Samples 139
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.62 %
% of genes near scaffold ends (potentially truncated) 98.77 %
% of genes from short scaffolds (< 2000 bps) 88.89 %
Associated GOLD sequencing projects 128
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.765 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.580 % of family members)
Environment Ontology (ENVO) Unclassified
(26.543 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.741 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.73%    β-sheet: 5.41%    Coil/Unstructured: 64.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF02738MoCoBD_1 24.69
PF01315Ald_Xan_dh_C 24.07
PF00941FAD_binding_5 13.58
PF03450CO_deh_flav_C 6.79
PF13478XdhC_C 2.47
PF05685Uma2 1.85
PF00501AMP-binding 1.23
PF04607RelA_SpoT 1.23
PF00005ABC_tran 1.23
PF01799Fer2_2 1.23
PF01882DUF58 0.62
PF02604PhdYeFM_antitox 0.62
PF00497SBP_bac_3 0.62
PF06325PrmA 0.62
PF12399BCA_ABC_TP_C 0.62
PF01740STAS 0.62
PF00111Fer2 0.62
PF06348DUF1059 0.62
PF13607Succ_CoA_lig 0.62
PF07589PEP-CTERM 0.62
PF04116FA_hydroxylase 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 162 Family Scaffolds
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 1.85
COG1721Uncharacterized conserved protein, DUF58 family, contains vWF domainFunction unknown [S] 0.62
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.62
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 0.62
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.62
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.62
COG3897Protein N-terminal and lysine N-methylase, NNT1/EFM7 familyPosttranslational modification, protein turnover, chaperones [O] 0.62
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.77 %
UnclassifiedrootN/A1.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100211683All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria553Open in IMG/M
3300000955|JGI1027J12803_108169195All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria525Open in IMG/M
3300002560|JGI25383J37093_10008271All Organisms → cellular organisms → Bacteria3375Open in IMG/M
3300002908|JGI25382J43887_10476409All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300004114|Ga0062593_101102360All Organisms → cellular organisms → Bacteria → Proteobacteria824Open in IMG/M
3300005093|Ga0062594_102968019All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005166|Ga0066674_10274287All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300005172|Ga0066683_10251820All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1095Open in IMG/M
3300005183|Ga0068993_10397641All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria508Open in IMG/M
3300005341|Ga0070691_10509817All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300005347|Ga0070668_101037004All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005353|Ga0070669_101843985All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005355|Ga0070671_100941744All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005438|Ga0070701_10267226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1039Open in IMG/M
3300005447|Ga0066689_10358572All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria910Open in IMG/M
3300005450|Ga0066682_10441617All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria828Open in IMG/M
3300005467|Ga0070706_100996977All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005468|Ga0070707_100376826All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300005471|Ga0070698_100651440All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300005471|Ga0070698_101049308All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005518|Ga0070699_100294708All Organisms → cellular organisms → Bacteria1455Open in IMG/M
3300005536|Ga0070697_100013271All Organisms → cellular organisms → Bacteria6462Open in IMG/M
3300005540|Ga0066697_10180362All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1253Open in IMG/M
3300005547|Ga0070693_101583591All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005555|Ga0066692_10288508All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300005556|Ga0066707_10480706All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria806Open in IMG/M
3300005617|Ga0068859_101341535All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300005618|Ga0068864_101166829All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300005718|Ga0068866_10424745All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005719|Ga0068861_100348917All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300005764|Ga0066903_100088074All Organisms → cellular organisms → Bacteria → Proteobacteria4104Open in IMG/M
3300005764|Ga0066903_104162639All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300005876|Ga0075300_1046904All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300006031|Ga0066651_10018355All Organisms → cellular organisms → Bacteria2973Open in IMG/M
3300006034|Ga0066656_11033935All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006163|Ga0070715_11023005All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006354|Ga0075021_10161603All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300006755|Ga0079222_10014642All Organisms → cellular organisms → Bacteria2972Open in IMG/M
3300006844|Ga0075428_100255311All Organisms → cellular organisms → Bacteria1888Open in IMG/M
3300006845|Ga0075421_100919783All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria997Open in IMG/M
3300006847|Ga0075431_100165083All Organisms → cellular organisms → Bacteria2276Open in IMG/M
3300006852|Ga0075433_10997268All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300006903|Ga0075426_10075923All Organisms → cellular organisms → Bacteria2400Open in IMG/M
3300006969|Ga0075419_11096704All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria583Open in IMG/M
3300007258|Ga0099793_10000492All Organisms → cellular organisms → Bacteria10760Open in IMG/M
3300009012|Ga0066710_103078348All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria646Open in IMG/M
3300009012|Ga0066710_104293634All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria532Open in IMG/M
3300009090|Ga0099827_10537498All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300009090|Ga0099827_10705771All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300009092|Ga0105250_10563644All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria524Open in IMG/M
3300009100|Ga0075418_10419923All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300009100|Ga0075418_10928852All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300009148|Ga0105243_12483404All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300010043|Ga0126380_10672579All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria828Open in IMG/M
3300010046|Ga0126384_10062846All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2608Open in IMG/M
3300010046|Ga0126384_10075681All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2406Open in IMG/M
3300010046|Ga0126384_10179019All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1660Open in IMG/M
3300010046|Ga0126384_11442640All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300010046|Ga0126384_11709819All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria595Open in IMG/M
3300010093|Ga0127490_1027606All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300010111|Ga0127491_1032868All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300010134|Ga0127484_1133832All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300010141|Ga0127499_1083627All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300010301|Ga0134070_10244142All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria670Open in IMG/M
3300010303|Ga0134082_10219899All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300010322|Ga0134084_10437254All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria518Open in IMG/M
3300010360|Ga0126372_12255842All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria594Open in IMG/M
3300010361|Ga0126378_10476100All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300010362|Ga0126377_11884692All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria674Open in IMG/M
3300010376|Ga0126381_100906930All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1269Open in IMG/M
3300010376|Ga0126381_104518928All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria537Open in IMG/M
3300010391|Ga0136847_12339998All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300010399|Ga0134127_10478176All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1252Open in IMG/M
3300010905|Ga0138112_1106228All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300011270|Ga0137391_10174656All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300012199|Ga0137383_10129940All Organisms → cellular organisms → Bacteria1839Open in IMG/M
3300012211|Ga0137377_10071420All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria3252Open in IMG/M
3300012349|Ga0137387_11123758All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria559Open in IMG/M
3300012359|Ga0137385_10092162All Organisms → cellular organisms → Bacteria2687Open in IMG/M
3300012363|Ga0137390_11398999All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300012403|Ga0134049_1077805All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300012532|Ga0137373_10486998All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300012582|Ga0137358_10661889All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium699Open in IMG/M
3300012685|Ga0137397_10165295All Organisms → cellular organisms → Bacteria1642Open in IMG/M
3300012903|Ga0157289_10203343All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300012922|Ga0137394_10278924All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300012922|Ga0137394_10885319All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria746Open in IMG/M
3300012925|Ga0137419_11309921All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300012925|Ga0137419_11761202All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium529Open in IMG/M
3300012927|Ga0137416_10413056All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1146Open in IMG/M
3300012927|Ga0137416_11602563All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300012930|Ga0137407_10532841All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1099Open in IMG/M
3300012930|Ga0137407_12201743All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria527Open in IMG/M
3300012931|Ga0153915_10401783All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300014154|Ga0134075_10233082All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria795Open in IMG/M
3300014262|Ga0075301_1174156All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria514Open in IMG/M
3300014969|Ga0157376_12070501All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria607Open in IMG/M
3300015201|Ga0173478_10467366All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria623Open in IMG/M
3300015241|Ga0137418_11221575All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria528Open in IMG/M
3300015357|Ga0134072_10322440All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria583Open in IMG/M
3300015374|Ga0132255_100986103All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300015374|Ga0132255_105016221All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria560Open in IMG/M
3300015374|Ga0132255_105244191All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria549Open in IMG/M
3300016422|Ga0182039_12279507All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria500Open in IMG/M
3300017654|Ga0134069_1384209All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria507Open in IMG/M
3300017959|Ga0187779_10619447All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria726Open in IMG/M
3300018056|Ga0184623_10486894All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300018075|Ga0184632_10269204All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300018468|Ga0066662_10989444All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300018482|Ga0066669_11801820All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria566Open in IMG/M
3300022756|Ga0222622_10821833All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300025903|Ga0207680_11281047All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria521Open in IMG/M
3300025910|Ga0207684_10344067All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1284Open in IMG/M
3300025912|Ga0207707_10839479All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300025922|Ga0207646_10989032All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria744Open in IMG/M
3300025938|Ga0207704_11565070All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria566Open in IMG/M
3300025972|Ga0207668_10766743All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300026011|Ga0208532_1007691All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300026095|Ga0207676_11729436All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300026118|Ga0207675_100488218All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300026118|Ga0207675_102204008All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria566Open in IMG/M
3300026296|Ga0209235_1131970All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1030Open in IMG/M
3300026296|Ga0209235_1220769All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300026297|Ga0209237_1167556All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria805Open in IMG/M
3300026298|Ga0209236_1082454All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300026326|Ga0209801_1020099All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria3287Open in IMG/M
3300026329|Ga0209375_1117150All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300026355|Ga0257149_1008631All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300026496|Ga0257157_1017674All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300027651|Ga0209217_1176127All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300027787|Ga0209074_10505111All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300027846|Ga0209180_10241829All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1039Open in IMG/M
3300027874|Ga0209465_10241927All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria902Open in IMG/M
3300027894|Ga0209068_10123331All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300028381|Ga0268264_10027613All Organisms → cellular organisms → Bacteria4640Open in IMG/M
3300028381|Ga0268264_10825891Not Available927Open in IMG/M
3300028592|Ga0247822_11870805All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300028597|Ga0247820_10125350All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1582Open in IMG/M
3300028608|Ga0247819_10400492All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria792Open in IMG/M
3300028812|Ga0247825_10784522All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300031199|Ga0307495_10251485All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031564|Ga0318573_10544315All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria625Open in IMG/M
3300031680|Ga0318574_10013388All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria3810Open in IMG/M
3300031680|Ga0318574_10029568All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2757Open in IMG/M
3300031713|Ga0318496_10013078All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria3977Open in IMG/M
3300031720|Ga0307469_12221514All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031740|Ga0307468_100975379All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria743Open in IMG/M
3300031740|Ga0307468_102140619Not Available540Open in IMG/M
3300031754|Ga0307475_11034640All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300031819|Ga0318568_10709517All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria625Open in IMG/M
3300031820|Ga0307473_10368356All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300031944|Ga0310884_10768470All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria587Open in IMG/M
3300031959|Ga0318530_10334467All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300032001|Ga0306922_10418342All Organisms → cellular organisms → Bacteria1434Open in IMG/M
3300032075|Ga0310890_10328485All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300032089|Ga0318525_10014304All Organisms → cellular organisms → Bacteria3659Open in IMG/M
3300032174|Ga0307470_10407723All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria963Open in IMG/M
3300032180|Ga0307471_100516805All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300032180|Ga0307471_101605849All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria806Open in IMG/M
3300032180|Ga0307471_101839456All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300032205|Ga0307472_101762313All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria614Open in IMG/M
3300033550|Ga0247829_10677934All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria858Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.02%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.23%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.23%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.23%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.23%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.62%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.62%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.62%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.62%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.62%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.62%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.62%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005876Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010093Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010111Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010134Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010141Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010905Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026011Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10021168313300000364SoilDADRISCEAGLGGSTPEDEMRVFPEFLGKIRKRMAPWGVNIPFFDHPRLGRV*
JGI1027J12803_10816919523300000955SoilGTCQRVFPEFLRKIRKRMAPWGVNIPFFDHSRLGHV*
JGI25383J37093_1000827143300002560Grasslands SoilGSATPAEIDADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVNLPMFDHPRLGKV
JGI25382J43887_1047640923300002908Grasslands SoilAEIDADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0062593_10110236013300004114SoilADEIACAAGLGASTPEDEMRVFPQFLAKMRARMGPWGVTIPTFDHPKLGKV*
Ga0062594_10296801913300005093SoilAEIDADRISCEAGLGGSTPEDEMRVFPEFLGKIRKRMAPWGVNIPFFDHPRLGRV*
Ga0066674_1027428723300005166SoilGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV*
Ga0066683_1025182023300005172SoilGLGGNTPEDEMTVFPEFLKKIRRRMAPWGVSIPMFDHPRLGKV*
Ga0068993_1039764113300005183Natural And Restored WetlandsVSCEAGLGGSTPEDEMRVFPDFLRKIRARMAPWGVTIPLFDHPRLGRV*
Ga0070691_1050981713300005341Corn, Switchgrass And Miscanthus RhizosphereATPLEIDADRVACEAGLGGTTPEDEMRIVPQFIAKIRARMAPWGVTLPMFDHPKLGKV*
Ga0070668_10103700413300005347Switchgrass RhizosphereEIDADRISCEAGLGGSTPEDEMRVFPEFLGKIRKRMAPWGVNIPFFDHPRLGRV*
Ga0070669_10184398513300005353Switchgrass RhizosphereADRISCEAGLGGSTPEDEMAVFPEFLTKIRKRMAPYGVTLPLFDHPRLGKV*
Ga0070671_10094174413300005355Switchgrass RhizosphereTPAEIDADRISCEAGLGGNTPEDEMQIFPGFLAKIRKRMAPWGVKIPMFDHPRLGTV*
Ga0070701_1026722613300005438Corn, Switchgrass And Miscanthus RhizosphereGLGGSTPEDEMAVFPEFLTKIRKRMAPYGVTLPLFDHPRLGKV*
Ga0066689_1035857223300005447SoilGGSTPEDEMAIFPEFLKKIRKRMTPYGVQLKLFDHPRLGKV*
Ga0066682_1044161723300005450SoilGSTPEDEMRIFPEFLRKIRQRMAPWGVDIPLFDHPHLGRV*
Ga0070706_10099697723300005467Corn, Switchgrass And Miscanthus RhizosphereCEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVDLPLFDHPKLGKV*
Ga0070707_10037682613300005468Corn, Switchgrass And Miscanthus RhizosphereAEIDADRISCEAGLGGNTPEDEMEVFPEFLKKIRKRMAPWGVNLPMFDHPRLGTV*
Ga0070698_10065144023300005471Corn, Switchgrass And Miscanthus RhizosphereAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV*
Ga0070698_10104930813300005471Corn, Switchgrass And Miscanthus RhizosphereTTPEDEMRVVPQFIAKIRARMAPWGVELPMFDHPKLGRV*
Ga0070699_10029470813300005518Corn, Switchgrass And Miscanthus RhizosphereGGTTPEDEMQIVPQFVRKIRARMVPWGVKLPMFSHPKLGQI*
Ga0070697_10001327113300005536Corn, Switchgrass And Miscanthus RhizosphereEIDADRISCEAGLGGNTPEDEMTVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV*
Ga0066697_1018036213300005540SoilISCEAGLGGNTPEDEMMVFPEFLKKIRKRMAPWGVNLPMFDHPRLGKV*
Ga0070693_10158359123300005547Corn, Switchgrass And Miscanthus RhizosphereGLGGTTPEDEMRVVPQFIAKIRARMAPWGVALPMFDHPKLGRV*
Ga0066692_1028850813300005555SoilEIDADRISCEAGLGGNTPEDEMRVFPDFLKKIRTRMAPWGVSIPVFDHPRLGKV*
Ga0066707_1048070623300005556SoilDEMRIFPEFLRKIRQRMAPWGVDIPLFDHPHLGRV*
Ga0068859_10134153523300005617Switchgrass RhizosphereLGGTTPEDEMRVVPQFIAKIRARMAPWGVELPMFDHPKLGRV*
Ga0068864_10116682923300005618Switchgrass RhizosphereEDEMRVVPQFIAKIRARMAPWGVALPMFDHPKLGRV*
Ga0068866_1042474513300005718Miscanthus RhizosphereEIDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV*
Ga0068861_10034891713300005719Switchgrass RhizosphereADRISCEAGLGGNTPEDEMQVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV*
Ga0066903_10008807413300005764Tropical Forest SoilSATPAEIDADRISCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV*
Ga0066903_10416263913300005764Tropical Forest SoilSATPAEIDADRISCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPLFDHPRLGKV*
Ga0075300_104690413300005876Rice Paddy SoilCEAGLGGTTPEDEMRIVPGFIAKIRARMAPWGVKLPMFDHPKLGKV*
Ga0066651_1001835533300006031SoilAEIDADRISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV*
Ga0066656_1103393513300006034SoilISCEAGLGGSTPEDEMQVFPAFVQKIRARMQPWGVTIPMFAHPRLGKI*
Ga0070715_1102300513300006163Corn, Switchgrass And Miscanthus RhizosphereEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV*
Ga0075021_1016160313300006354WatershedsTTPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV*
Ga0079222_1001464213300006755Agricultural SoilTPLEIDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV*
Ga0075428_10025531133300006844Populus RhizosphereEAGLGGNTPEDEVAVFPEFLRKIRTRMAPWGVNLPMFDHPRLGKV*
Ga0075421_10091978323300006845Populus RhizosphereCEAGLGGSTPEDEMRVFPDFLAKIRKRMAPWGVTLPYFEHPRLGRM*
Ga0075431_10016508313300006847Populus RhizosphereEDEVAVFPEFLRKIRTRMAPWGVNLPMFDHPRLGKV*
Ga0075433_1099726823300006852Populus RhizosphereGSATPAEIDADRISCEAGLGGNTPEDEMRVFPDFLRKIRKRMAPWGVNIPMFEHPRLGKV
Ga0075426_1007592313300006903Populus RhizospherePLEIDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV*
Ga0075419_1109670423300006969Populus RhizosphereAGLGGSTPEDETRVFPTFLAKIRRRMSPWGVTLPMFDHPRLGKV*
Ga0099793_1000049213300007258Vadose Zone SoilEIDADRISCEAGLGGNTPEDEMAVFPEFLRKIRKRMAPWGVDIPMFDHPRMGKV*
Ga0066710_10307834823300009012Grasslands SoilGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV
Ga0066710_10429363423300009012Grasslands SoilMLRGVDPPRADRIACEAGLGGSTPEDETRVFPQFLAKIRARMAPWGVAIPTFEHPRLGKI
Ga0099827_1053749823300009090Vadose Zone SoilEIEADRIACEAGLGGSTPDDEMAVFPEFLAKIRARMAPWGVRMPDFEHPKLGRV*
Ga0099827_1070577123300009090Vadose Zone SoilACEAGLGGTTPEDEMQIVPQFVRKIRARMIPWGVKLPMFSHPKLGQI*
Ga0105250_1056364413300009092Switchgrass RhizosphereGLGGSTPEDEMQIFPAFLAKIRKRMAPYGVNIRLFDHPRLGKV*
Ga0075418_1041992353300009100Populus RhizosphereEDEMRVFPEFLGKIRKRMAPWGVSIPFFDHPRLGRV*
Ga0075418_1092885213300009100Populus RhizosphereEIDADRISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNIPMFDHPRLGKV*
Ga0105243_1248340423300009148Miscanthus RhizosphereLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV*
Ga0126380_1067257913300010043Tropical Forest SoilADRISCEAGLGGSTPEDEIRVFPQFLAKIRARMAPWGVNLPLYDHPRLGRI*
Ga0126384_1006284623300010046Tropical Forest SoilCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPLFDHPRLGKV*
Ga0126384_1007568123300010046Tropical Forest SoilDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV*
Ga0126384_1017901913300010046Tropical Forest SoilDEMRVFPEFLRKIRKRMAPWGVNIPLFVHPRLGKV*
Ga0126384_1144264023300010046Tropical Forest SoilAEIDADRISCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPMFQHPRLGQV*
Ga0126384_1170981923300010046Tropical Forest SoilGLGGSTPEDEMRVFPDFLKKIRKRMAPWGVAIPLFDHPRLGRV*
Ga0127490_102760613300010093Grasslands SoilSATPAEIDADRISCEAGLGGNTPEDEMTVFPEFLKKIRRRMAPWGVSIPMFDHPLLGKV*
Ga0127491_103286813300010111Grasslands SoilGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0127484_113383213300010134Grasslands SoilDADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0127499_108362723300010141Grasslands SoilEIDADRISCEAGLGGNTPADEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0134070_1024414213300010301Grasslands SoilDRISCEAGLGGNTPEDEMTVFPEFLKKIRRRMAPWGVSIPMFDHPRLGKV*
Ga0134082_1021989913300010303Grasslands SoilTPAEIDADRISCEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0134084_1043725423300010322Grasslands SoilDRTSCEAGLGGNTPEDEMSVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0126372_1225584213300010360Tropical Forest SoilDRISCEAGLGGNTPEDEMQVFPEFLRKIRTRMAPWGVSLPMFDHPRLGKV*
Ga0126378_1047610013300010361Tropical Forest SoilAEIDADRISCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPLFDHPRLGKV*
Ga0126377_1188469213300010362Tropical Forest SoilCEAGLGGNTPEDEMRVFPEFLRKIRNRMAPWGVTIPLFDHPRLGKV*
Ga0126381_10090693013300010376Tropical Forest SoilDEMRVFPEFLRKIRKRMAPWGVTIPLFDHPRLGRV*
Ga0126381_10451892823300010376Tropical Forest SoilCEAGLGGNTPDDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV*
Ga0136847_1233999823300010391Freshwater SedimentPAEVDADRISCEAGLGGSTPEDEMRVFPQFLAKIRARMAPWGVRIPMFDHPRLGKI*
Ga0134127_1047817613300010399Terrestrial SoilTPEDEMRVFPDFLKKIRKRMAPWGVGIPMFEHPRLGKV*
Ga0138112_110622813300010905Grasslands SoilGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0137391_1017465643300011270Vadose Zone SoilEDEMRIVPQFIKKIRARMEPWGVKLPLFDHPKLGKV*
Ga0137383_1012994013300012199Vadose Zone SoilEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0137377_1007142013300012211Vadose Zone SoilSCEAGLGGNTPEDEMRVFPDFLKKIRTRMAPWGVSIPMFDHPRLGKV*
Ga0137387_1112375823300012349Vadose Zone SoilDADRVACEAGLGGTTPEDEMRVVPEFIKKIRARMAPWGVELPMFDHPKLGRV*
Ga0137385_1009216243300012359Vadose Zone SoilAEIDADRISCEAGLGGNTTEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0137390_1139899923300012363Vadose Zone SoilGGTTPEDEMQIVPQFVRKIRARMIPWGVKLPMFSHPKLGQI*
Ga0134049_107780513300012403Grasslands SoilATPAETDADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0137373_1048699823300012532Vadose Zone SoilCEAGLGGTTPEDEMQIVPQFVRKIRARMIPWGVKLPMFSHPKLGQI*
Ga0137358_1066188913300012582Vadose Zone SoilCEAGLGGNTPEDEMAVFPEFLRKIRKRMAPWGVEIPMFDHPRMGKV*
Ga0137397_1016529533300012685Vadose Zone SoilTPEDEMTVFPEFLKKIRKRMAPWGVNLPMFDHPRLGKV*
Ga0157289_1020334313300012903SoilIDADRVACEAGLGGTTPEDEMRVVPQFIAKIRARMAPWGVALPMFDHPKLGRV*
Ga0137394_1027892413300012922Vadose Zone SoilSTPEDEMAIFPDFLKKIRKRMAPYGVKLPLFDHPRLGKV*
Ga0137394_1088531913300012922Vadose Zone SoilRISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV*
Ga0137419_1130992113300012925Vadose Zone SoilDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV*
Ga0137419_1176120213300012925Vadose Zone SoilEDEMAVFPEFLRKIRKRMAPWGVVIPMFDHPRMGKV*
Ga0137416_1041305613300012927Vadose Zone SoilLGGNTPEDEMAVFPEFLRKIRKRMAPWGVVIPMFDHPRMGKV*
Ga0137416_1160256313300012927Vadose Zone SoilSCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVNIPMFDHPRLGKV*
Ga0137407_1053284113300012930Vadose Zone SoilADRISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV*
Ga0137407_1220174313300012930Vadose Zone SoilDEMQVFPEFLRKIRKRMAPWGVKLPMFDHPRLGTV*
Ga0153915_1040178313300012931Freshwater WetlandsTPLEIDADRVACEAGLGGTTPEDEMRIVPQFIAKIRARMAPWGVKLPMFDHPKLGKV*
Ga0134075_1023308213300014154Grasslands SoilCEAGLGGNTPEDEMQVFPEFLRKIRKRMAPWGVKLPMFDHPRLGTV*
Ga0075301_117415613300014262Natural And Restored WetlandsSTPEDEMRVFPDFLRKIRRRMAPWGVTIPLFDHPRLGLV*
Ga0157376_1207050113300014969Miscanthus RhizosphereCEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0173478_1046736613300015201SoilIDADRVACEAGLGGTTPEDEMRVVPQFIAKIRARMAPWGVELPMFEHPKLGRV*
Ga0137418_1122157523300015241Vadose Zone SoilEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV*
Ga0134072_1032244023300015357Grasslands SoilCEAGLGGNTPEDEMMVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV*
Ga0132255_10098610313300015374Arabidopsis RhizosphereTHAEIDADRISCEAGLGGSTPEDEMRVFPEFLGKIRKRMAPWGVSIPFFDHPRLGRV*
Ga0132255_10501622123300015374Arabidopsis RhizosphereADRISCEAGLGGSTPEDEMRVFPEFLGKIRKRMAPWGVNIPFFDHPRLGRV*
Ga0132255_10524419113300015374Arabidopsis RhizosphereCSAGLGASTPEDEMKVFPQFLAKMRARMGPWGVTIPTFDHPKLGKV*
Ga0182039_1227950723300016422SoilDADRISCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV
Ga0134069_138420923300017654Grasslands SoilDADRVSCEAGLGGSTPDDEMRIFPEFLRKIRQRMAPWGVDIPLFDHPHLGRV
Ga0187779_1061944713300017959Tropical PeatlandSTPEDEMRVFPEFLRKIRRRMAPWGVTIPFFDHPRLGRI
Ga0184623_1048689413300018056Groundwater SedimentDRISCEAGLGGSTPEDEMRVFPQFLAKIRARMAPWGVRIPMFDHPRLGKI
Ga0184632_1026920423300018075Groundwater SedimentLEIDADRVSCEAGLGGSTPEDEMRVFPQFLAKLRARMAPWGVTLPLYDHPRLGKI
Ga0066662_1098944413300018468Grasslands SoilDADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVSIPMFDHPRLGKV
Ga0066669_1180182023300018482Grasslands SoilCEAGLGGNTPEDEIQVFPEFLKKIRRRMAPWGVDIPMFDHPRLGKV
Ga0222622_1082183323300022756Groundwater SedimentGLGGTTPEDEMRIVPQFIKKIRARMDPWGVKLPLFDHPKLGKV
Ga0207680_1128104723300025903Switchgrass RhizosphereCEAGLGGSTPEDEMAVFPEFLTKIRKRMAPYGVTLPLFDHPRLGKV
Ga0207684_1034406713300025910Corn, Switchgrass And Miscanthus RhizosphereTPEDEMRVFPDFLKKIRTRMAPWGVGIPMFDHPRLGKV
Ga0207707_1083947923300025912Corn RhizosphereEIDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV
Ga0207646_1098903223300025922Corn, Switchgrass And Miscanthus RhizospherePAEIDADRISCEAGLGGNTPEDEMEVFPEFLKKIRKRMAPWGVNLPMFDHPRLGTV
Ga0207704_1156507013300025938Miscanthus RhizosphereLGGNTPEDEMQVFPDFLRKIRKRMAPWGVSIPMFEHPRLGKV
Ga0207668_1076674313300025972Switchgrass RhizosphereAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV
Ga0208532_100769113300026011Rice Paddy SoilVACEAGLGGTTPEDEMRIVPQFIAKIRARMAPWGVTLPMFDHPKLGKV
Ga0207676_1172943623300026095Switchgrass RhizosphereTTPEDEMRVVPQFIAKIRARMAPWGVALPMFDHPKLGRV
Ga0207675_10048821833300026118Switchgrass RhizosphereGGTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV
Ga0207675_10220400813300026118Switchgrass RhizosphereAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVGIPMFEHPRLGKV
Ga0209235_113197013300026296Grasslands SoilDRISCEAGLGGNTPEDEMRVFPDFLKKIRTRMAPWGVGIPMFDHPRLGKV
Ga0209235_122076923300026296Grasslands SoilADRISCEAGLGGNTPEDEMTVFPEFLKKIRKRMAPWGVNLPMFDHPRLGKV
Ga0209237_116755623300026297Grasslands SoilCEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVSIPMFDHPRLGKV
Ga0209236_108245413300026298Grasslands SoilRISCEAGLGGNTPEDEMRVFPDFLKKIRTRMAPWGVGIPMFDHPRLGKV
Ga0209801_102009953300026326SoilRISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV
Ga0209375_111715023300026329SoilAEIDADRISCEAGLGGNTPEDEMTVFPEFLKKIRRRMAPWGVSIPMFDHPRLGKV
Ga0257149_100863133300026355SoilTPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV
Ga0257157_101767433300026496SoilDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV
Ga0209217_117612713300027651Forest SoilPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV
Ga0209074_1050511113300027787Agricultural SoilSATPAEIDADRISCEAGLGGNTPEDEMAVFPEFLKKIRKRMAPWGVNIPMFEHPRLGKV
Ga0209180_1024182913300027846Vadose Zone SoilGGSTPEDEMAIFPDFLKKIRKRMAPYGVKLPLFDHPRLGKV
Ga0209465_1024192723300027874Tropical Forest SoilDEMRVFPEFLKKIRKRMAPWGVDIPLFDHPRLGKV
Ga0209068_1012333133300027894WatershedsTTPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV
Ga0268264_1002761353300028381Switchgrass RhizosphereTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV
Ga0268264_1082589113300028381Switchgrass RhizospherePEDEMRVVPQFIAKIRARMAPWGVALPMFDHPKLGRV
Ga0247822_1187080513300028592SoilPLEIDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPMFDHPKLGKV
Ga0247820_1012535013300028597SoilRISCEAGLGGNTPEDEMQVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV
Ga0247819_1040049223300028608SoilISCEAGLGGNTPEDEMQVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV
Ga0247825_1078452223300028812SoilGTTPEDEMRIVPQFIKKIRARMAPWGVELPMFDHPKLGKV
Ga0307495_1025148523300031199SoilAEIDADRISCEAGLGGNTPEDEMQVFPDFLRKIRKRMAPWGVTIPMFDHPRLGQV
Ga0318573_1054431523300031564SoilSCEAGLGGNTPEDEMRVFPEFLKKIRERMAPWGVDIPMFDHPRLGKV
Ga0318574_1001338843300031680SoilISCEAGLGGNTPEDEMRVFPEFLKKIRERMAPWGVDIPMFDHPRLGKV
Ga0318574_1002956833300031680SoilSCEAGLGGNTPDDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV
Ga0318496_1001307853300031713SoilGGNTPEDEMRVFPEFLKKIRERMAPWGVDIPMFDHPRLGKV
Ga0307469_1222151423300031720Hardwood Forest SoilATPLEVDADRVACEAGLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPLFDHPKLGKV
Ga0307468_10097537923300031740Hardwood Forest SoilEAGLGGNTPEDEMQVFPEFLRKIRKRMAPWSVTIPMFDHPRLGKV
Ga0307468_10214061913300031740Hardwood Forest SoilCEAGLGGTTPEDEMRVVPQFIVKIRARMAPWGVELPMFDHPKLGRV
Ga0307475_1103464013300031754Hardwood Forest SoilLGGTTPEDEMRIVPQFIKKIRARMAPWGVNLPLFEHPKLGKV
Ga0318568_1070951713300031819SoilVSCEAGLGGNTPEDEMRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV
Ga0307473_1036835613300031820Hardwood Forest SoilAEIDADRISCEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVTIPMFDHPRLGKV
Ga0310884_1076847013300031944SoilGLGGNTPEDEIRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV
Ga0318530_1033446713300031959SoilAEIDADRISCEAGLGGNTPEDEMRVFPEFLRKIRQRMAPWGVNIPMFDHPRLGKV
Ga0306922_1041834223300032001SoilEIDADRISCEAGLGGNTPEDEMRVFPEFLKKIRERMAPWGVDIPMFDHPRLGKV
Ga0310890_1032848513300032075SoilGSATPAEIDADRISCEAGLGGNTPEDEIRVFPEFLRKIRKRMAPWGVNIPMFDHPRLGKV
Ga0318525_1001430433300032089SoilPASHEMRVFPEFLKKIRERMAPWGVDIPMFDHPRLGKV
Ga0307470_1040772313300032174Hardwood Forest SoilDRISCEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVNIPMFEHPRLGQV
Ga0307471_10051680523300032180Hardwood Forest SoilATPAEIDADRISCEAGLGGNTPEDEMRVFPEFLAKIRKRMAPWGVNLPMFEHPRLGTV
Ga0307471_10160584913300032180Hardwood Forest SoilSCEAGLGGNTPEDEMRVFPDFLKKIRKRMAPWGVSIPMFEHPRLGKV
Ga0307471_10183945623300032180Hardwood Forest SoilPEDEMEIVPQFVRKIRARMLPWGVKLPMFSHPKLGQI
Ga0307472_10176231333300032205Hardwood Forest SoilEDEMRVFPAFLAKTRKRMAPWGVTLPLFDHPRLGKV
Ga0247829_1067793423300033550SoilIACAAGLGASTPEDEMKVFPQFLAKMRAKMGPWGVTIPTFDHPKLGKV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.