Basic Information | |
---|---|
Family ID | F040612 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 161 |
Average Sequence Length | 39 residues |
Representative Sequence | MRTLGYITAVTMAAAAAALGLLAVMSLPDIRQYLKIRKM |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 161 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 91.19 % |
% of genes near scaffold ends (potentially truncated) | 12.42 % |
% of genes from short scaffolds (< 2000 bps) | 82.61 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (55.901 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.012 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.497 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.217 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 161 Family Scaffolds |
---|---|---|
PF05532 | CsbD | 10.56 |
PF01740 | STAS | 9.94 |
PF12697 | Abhydrolase_6 | 4.35 |
PF01145 | Band_7 | 3.11 |
PF12802 | MarR_2 | 2.48 |
PF02909 | TetR_C_1 | 1.86 |
PF13466 | STAS_2 | 1.86 |
PF01183 | Glyco_hydro_25 | 1.86 |
PF03631 | Virul_fac_BrkB | 1.86 |
PF00171 | Aldedh | 1.86 |
PF00571 | CBS | 1.24 |
PF00144 | Beta-lactamase | 1.24 |
PF03861 | ANTAR | 1.24 |
PF02687 | FtsX | 0.62 |
PF13378 | MR_MLE_C | 0.62 |
PF01458 | SUFBD | 0.62 |
PF03734 | YkuD | 0.62 |
PF00196 | GerE | 0.62 |
PF08281 | Sigma70_r4_2 | 0.62 |
PF00440 | TetR_N | 0.62 |
PF14659 | Phage_int_SAM_3 | 0.62 |
PF13305 | TetR_C_33 | 0.62 |
PF00011 | HSP20 | 0.62 |
PF00665 | rve | 0.62 |
PF03992 | ABM | 0.62 |
PF01027 | Bax1-I | 0.62 |
PF01904 | DUF72 | 0.62 |
PF02452 | PemK_toxin | 0.62 |
COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
---|---|---|---|
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 10.56 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.86 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.86 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.86 |
COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 1.86 |
COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 1.86 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.86 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.24 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.24 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.24 |
COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 1.24 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.62 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.62 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.62 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.62 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.62 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.90 % |
Unclassified | root | N/A | 44.10 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10006223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10251 | Open in IMG/M |
3300002677|Ga0005475J37263_109177 | Not Available | 506 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10333582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
3300004092|Ga0062389_101778119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
3300004099|Ga0058900_1335714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
3300004115|Ga0058890_170437 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300004152|Ga0062386_100037771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3610 | Open in IMG/M |
3300005434|Ga0070709_10040266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2872 | Open in IMG/M |
3300005434|Ga0070709_10230755 | Not Available | 1324 | Open in IMG/M |
3300005434|Ga0070709_10282668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1206 | Open in IMG/M |
3300005436|Ga0070713_100706525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 963 | Open in IMG/M |
3300005436|Ga0070713_101005531 | Not Available | 804 | Open in IMG/M |
3300005437|Ga0070710_10445688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 876 | Open in IMG/M |
3300005439|Ga0070711_100165665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1680 | Open in IMG/M |
3300005439|Ga0070711_100484351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1017 | Open in IMG/M |
3300005439|Ga0070711_101659837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
3300005467|Ga0070706_100774745 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300005471|Ga0070698_100184216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 2026 | Open in IMG/M |
3300005529|Ga0070741_10119815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2723 | Open in IMG/M |
3300005529|Ga0070741_10140443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2449 | Open in IMG/M |
3300005534|Ga0070735_10673479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 612 | Open in IMG/M |
3300005538|Ga0070731_10328464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1016 | Open in IMG/M |
3300005541|Ga0070733_11100065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces griseolus | 533 | Open in IMG/M |
3300005547|Ga0070693_101227343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
3300005561|Ga0066699_10655435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 752 | Open in IMG/M |
3300005591|Ga0070761_10092525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1735 | Open in IMG/M |
3300005591|Ga0070761_10279439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1002 | Open in IMG/M |
3300005602|Ga0070762_10028098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2987 | Open in IMG/M |
3300005602|Ga0070762_10072073 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
3300005610|Ga0070763_10006418 | All Organisms → cellular organisms → Bacteria | 4620 | Open in IMG/M |
3300005610|Ga0070763_10018138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 3059 | Open in IMG/M |
3300005610|Ga0070763_10547776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 666 | Open in IMG/M |
3300006032|Ga0066696_10220876 | Not Available | 1216 | Open in IMG/M |
3300006046|Ga0066652_101161415 | Not Available | 731 | Open in IMG/M |
3300006574|Ga0074056_11761312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces griseolus | 531 | Open in IMG/M |
3300006806|Ga0079220_11468999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300006871|Ga0075434_101410459 | Not Available | 706 | Open in IMG/M |
3300006893|Ga0073928_10022931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6317 | Open in IMG/M |
3300006893|Ga0073928_10111842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2268 | Open in IMG/M |
3300006893|Ga0073928_10155923 | Not Available | 1836 | Open in IMG/M |
3300006893|Ga0073928_10168112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1751 | Open in IMG/M |
3300006893|Ga0073928_10511506 | Not Available | 859 | Open in IMG/M |
3300006954|Ga0079219_11406454 | Not Available | 624 | Open in IMG/M |
3300006954|Ga0079219_11769542 | Not Available | 576 | Open in IMG/M |
3300010303|Ga0134082_10174142 | Not Available | 875 | Open in IMG/M |
3300010371|Ga0134125_10530842 | Not Available | 1302 | Open in IMG/M |
3300010371|Ga0134125_10601995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1215 | Open in IMG/M |
3300010373|Ga0134128_10925312 | Not Available | 965 | Open in IMG/M |
3300010396|Ga0134126_11225357 | Not Available | 833 | Open in IMG/M |
3300010400|Ga0134122_12323602 | Not Available | 582 | Open in IMG/M |
3300010866|Ga0126344_1385459 | Not Available | 730 | Open in IMG/M |
3300011107|Ga0151490_1162743 | Not Available | 765 | Open in IMG/M |
3300011120|Ga0150983_10422294 | Not Available | 1101 | Open in IMG/M |
3300011120|Ga0150983_10916384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea diastatica | 509 | Open in IMG/M |
3300011120|Ga0150983_11184274 | Not Available | 709 | Open in IMG/M |
3300011120|Ga0150983_11736647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1399 | Open in IMG/M |
3300011120|Ga0150983_11922627 | Not Available | 532 | Open in IMG/M |
3300011120|Ga0150983_12941865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 2129 | Open in IMG/M |
3300011120|Ga0150983_15560680 | Not Available | 591 | Open in IMG/M |
3300011120|Ga0150983_15760538 | Not Available | 914 | Open in IMG/M |
3300011120|Ga0150983_16596571 | Not Available | 606 | Open in IMG/M |
3300012211|Ga0137377_10002339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14071 | Open in IMG/M |
3300012285|Ga0137370_10751812 | Not Available | 605 | Open in IMG/M |
3300012957|Ga0164303_10843412 | Not Available | 635 | Open in IMG/M |
3300012984|Ga0164309_10596917 | Not Available | 861 | Open in IMG/M |
3300012987|Ga0164307_11464369 | Not Available | 577 | Open in IMG/M |
3300012988|Ga0164306_11814085 | Not Available | 530 | Open in IMG/M |
3300012989|Ga0164305_11078718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. HDW14 | 688 | Open in IMG/M |
3300015374|Ga0132255_105643588 | Not Available | 529 | Open in IMG/M |
3300018431|Ga0066655_10730313 | Not Available | 671 | Open in IMG/M |
3300018468|Ga0066662_10790402 | Not Available | 919 | Open in IMG/M |
3300019159|Ga0184574_106387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 888 | Open in IMG/M |
3300019182|Ga0184598_119875 | Not Available | 732 | Open in IMG/M |
3300019192|Ga0184603_131407 | Not Available | 502 | Open in IMG/M |
3300019192|Ga0184603_142475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
3300020581|Ga0210399_10110923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2249 | Open in IMG/M |
3300020581|Ga0210399_10291277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1363 | Open in IMG/M |
3300020582|Ga0210395_10003493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12035 | Open in IMG/M |
3300020582|Ga0210395_10082865 | All Organisms → cellular organisms → Bacteria | 2364 | Open in IMG/M |
3300020582|Ga0210395_10384102 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300020582|Ga0210395_10515872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea rubra | 899 | Open in IMG/M |
3300021171|Ga0210405_10365501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1138 | Open in IMG/M |
3300021171|Ga0210405_10602202 | Not Available | 856 | Open in IMG/M |
3300021171|Ga0210405_10781718 | Not Available | 733 | Open in IMG/M |
3300021181|Ga0210388_10170600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1897 | Open in IMG/M |
3300021181|Ga0210388_10469776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
3300021401|Ga0210393_10236454 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300021401|Ga0210393_10242615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 1461 | Open in IMG/M |
3300021401|Ga0210393_11441386 | Not Available | 549 | Open in IMG/M |
3300021402|Ga0210385_10070329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2383 | Open in IMG/M |
3300021402|Ga0210385_10132300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1770 | Open in IMG/M |
3300021402|Ga0210385_10244729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1316 | Open in IMG/M |
3300021402|Ga0210385_10247330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
3300021403|Ga0210397_10166295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1554 | Open in IMG/M |
3300021403|Ga0210397_10326397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
3300021433|Ga0210391_10520721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 934 | Open in IMG/M |
3300021474|Ga0210390_10202606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1678 | Open in IMG/M |
3300021474|Ga0210390_10512028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
3300021474|Ga0210390_10570682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 950 | Open in IMG/M |
3300021474|Ga0210390_10686295 | Not Available | 854 | Open in IMG/M |
3300021474|Ga0210390_11064023 | Not Available | 658 | Open in IMG/M |
3300021478|Ga0210402_10106692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2521 | Open in IMG/M |
3300021559|Ga0210409_11247633 | Not Available | 619 | Open in IMG/M |
3300022557|Ga0212123_10052399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3718 | Open in IMG/M |
3300022557|Ga0212123_10770261 | Not Available | 583 | Open in IMG/M |
3300023019|Ga0224560_112955 | Not Available | 522 | Open in IMG/M |
3300023541|Ga0247544_101730 | Not Available | 584 | Open in IMG/M |
3300023660|Ga0247550_102108 | Not Available | 668 | Open in IMG/M |
3300025898|Ga0207692_10198728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1178 | Open in IMG/M |
3300025898|Ga0207692_11156000 | Not Available | 513 | Open in IMG/M |
3300025906|Ga0207699_10090443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1920 | Open in IMG/M |
3300025910|Ga0207684_10398790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1183 | Open in IMG/M |
3300025912|Ga0207707_10848001 | Not Available | 758 | Open in IMG/M |
3300025915|Ga0207693_11135858 | Not Available | 592 | Open in IMG/M |
3300025916|Ga0207663_10150900 | Not Available | 1630 | Open in IMG/M |
3300025928|Ga0207700_10447814 | Not Available | 1138 | Open in IMG/M |
3300025928|Ga0207700_11109489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
3300025929|Ga0207664_11938357 | Not Available | 512 | Open in IMG/M |
3300027619|Ga0209330_1007759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2398 | Open in IMG/M |
3300027648|Ga0209420_1014716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2651 | Open in IMG/M |
3300027725|Ga0209178_1432450 | Not Available | 504 | Open in IMG/M |
3300027853|Ga0209274_10023937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2796 | Open in IMG/M |
3300027855|Ga0209693_10000774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13166 | Open in IMG/M |
3300027855|Ga0209693_10099255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1441 | Open in IMG/M |
3300027884|Ga0209275_10221754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1029 | Open in IMG/M |
3300027889|Ga0209380_10324083 | Not Available | 905 | Open in IMG/M |
3300027894|Ga0209068_10585833 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300027908|Ga0209006_10214562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1667 | Open in IMG/M |
3300027986|Ga0209168_10451799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
3300028884|Ga0307308_10610622 | Not Available | 523 | Open in IMG/M |
3300029999|Ga0311339_10159265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2634 | Open in IMG/M |
3300030760|Ga0265762_1036918 | Not Available | 945 | Open in IMG/M |
3300030762|Ga0265775_112759 | Not Available | 546 | Open in IMG/M |
3300030803|Ga0074037_1469032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
3300030805|Ga0265756_103463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
3300030877|Ga0265777_103744 | Not Available | 946 | Open in IMG/M |
3300030877|Ga0265777_108201 | Not Available | 739 | Open in IMG/M |
3300030884|Ga0265758_101274 | Not Available | 980 | Open in IMG/M |
3300031236|Ga0302324_100773037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori | 1342 | Open in IMG/M |
3300031236|Ga0302324_103391682 | Not Available | 519 | Open in IMG/M |
3300031708|Ga0310686_115348980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
3300031718|Ga0307474_10061250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2785 | Open in IMG/M |
3300031720|Ga0307469_11038340 | Not Available | 767 | Open in IMG/M |
3300031808|Ga0316037_101817 | Not Available | 1165 | Open in IMG/M |
3300031874|Ga0316047_102334 | Not Available | 909 | Open in IMG/M |
3300032120|Ga0316053_107060 | Not Available | 741 | Open in IMG/M |
3300032205|Ga0307472_100817198 | Not Available | 853 | Open in IMG/M |
3300032515|Ga0348332_10088428 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300032515|Ga0348332_10126298 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300032515|Ga0348332_11038220 | Not Available | 840 | Open in IMG/M |
3300032515|Ga0348332_12098356 | Not Available | 603 | Open in IMG/M |
3300032515|Ga0348332_14579602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
3300032739|Ga0315741_10200071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1323 | Open in IMG/M |
3300032739|Ga0315741_12034036 | Not Available | 502 | Open in IMG/M |
3300032892|Ga0335081_11562994 | Not Available | 727 | Open in IMG/M |
3300032896|Ga0335075_10388624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1492 | Open in IMG/M |
3300032896|Ga0335075_11466996 | Not Available | 570 | Open in IMG/M |
3300032898|Ga0335072_10007504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 15867 | Open in IMG/M |
3300033551|Ga0247830_11697829 | Not Available | 506 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.29% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.42% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.56% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.45% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 5.59% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.11% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 3.11% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.86% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.86% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.24% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.24% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.24% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.62% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.62% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.62% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002677 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF124 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004115 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF216 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019159 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
3300023541 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030803 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030805 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030884 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031808 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031874 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032739 | Forest Soil Metatranscriptomics Site 2 LB Combined Assembly | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_100062232 | 3300001593 | Forest Soil | MRALGYISAITMATTAAALGLLAVRSLPDIRQYLKIRKM* |
Ga0005475J37263_1091772 | 3300002677 | Forest Soil | MRALGYITAVTIAAASAALALLVVMSVPDVRRYLKIRKM* |
JGIcombinedJ51221_103335821 | 3300003505 | Forest Soil | MRTLGYITAVTMAATAAALGLLAVKSVPDLRQYLKIRKM* |
Ga0062389_1017781191 | 3300004092 | Bog Forest Soil | MRILGYITAITMAAAASALGLLAVRSAPDVRQYLKIRKM* |
Ga0058900_13357142 | 3300004099 | Forest Soil | MRTLGYITAVTMATAATALGLLAAMSVPDMRRYMKIRKM* |
Ga0058890_1704372 | 3300004115 | Forest Soil | MRTLGYITAGTMAAAAAALGLLAAMSLPDMRKYLKIRKM* |
Ga0062386_1000377711 | 3300004152 | Bog Forest Soil | MRTMGYVTTVTMAAAAAALGLVAVKSLPDARRYLTMRKM* |
Ga0070709_100402662 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITAVTMAAAAAALGLLAVRSLPDMRQYLKIRKM* |
Ga0070709_102307553 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITAVTMAATAAALGLLAVMSLPDIRQYRKIRKM* |
Ga0070709_102826682 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITAVTMAAAAAALGLLAVMSLPDIRQYLKIRKM* |
Ga0070713_1007065252 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITAVTTAAAAAALGLLAAKSVPDIRRYLKIRKM* |
Ga0070713_1010055312 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITALTMAATAAALGLLAVMSLPDIRQYLKIRKM* |
Ga0070710_104456882 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITAVTMAAAAVALGLLAVMSLPDIRQYLKIRKM* |
Ga0070711_1001656653 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGNITAVTMAVAVAALGLLAVRSVPDVRRYLKIRKM* |
Ga0070711_1004843512 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITAVTMAATAAALGLLVVMSLPDIRQYLKIRKM* |
Ga0070711_1016598372 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITAVTMAVAAVALGLLAVTSLPDIRQYLKIRKM* |
Ga0070706_1007747453 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRALGYTTAVTTAAASAALALLVVMSVPDARRYLKIRKM* |
Ga0070698_1001842162 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRALGYTPAVTTAAASAALALLVVMSVPDARRYLKIRKM* |
Ga0070741_101198152 | 3300005529 | Surface Soil | MRVLGYITAVIAAATAAALGLLAVKSLPDVRQYLKIRKM* |
Ga0070741_101404432 | 3300005529 | Surface Soil | MRTLGHITAVTMAAAAAALGLLAVASLPDMRQYLKIRKM* |
Ga0070735_106734792 | 3300005534 | Surface Soil | MRTLGYITAVTMTASAAALGLLAVMSLPDIRRYLKIRRM* |
Ga0070731_103284642 | 3300005538 | Surface Soil | MRALGYLAAITMAAAAAALGVLAVKSVPDVRRYIAIRQM* |
Ga0070733_111000651 | 3300005541 | Surface Soil | MRTLGYITAVTMAAAVAALGLLAAKSAPDIRRYLKIKKM* |
Ga0070693_1012273431 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITAVTMAAAAVALGLLAVTSLPDIRQYLKIRKM* |
Ga0066699_106554353 | 3300005561 | Soil | MRALGYITAVTIAAAGAALALLVVMSLPDVRRYLKIKKM* |
Ga0070761_100925252 | 3300005591 | Soil | MRRLGYVTTIIMAAAAAALGLLAVKSLPDARRYLTVRKM* |
Ga0070761_102794393 | 3300005591 | Soil | MRTLGYITAITMAAAAASLGLLAVMSLPDLRKYLKIRKM* |
Ga0070762_100280988 | 3300005602 | Soil | MRTLGYISAVTMAAAAATLGLLAVMSLPDMRRYLKIRKM* |
Ga0070762_100720733 | 3300005602 | Soil | MRTVGYITAVTMAVTAAAIGLLAVMSLPDMRRYMKIRKM* |
Ga0070763_100064182 | 3300005610 | Soil | MRTLGYISAITMAASAAALGLLAVMSLPDIRQYLKIRKM* |
Ga0070763_100181384 | 3300005610 | Soil | MRTPGYITAVTMAAAAAALGLLTVTSLPDIRRYLKIKKM* |
Ga0070763_105477762 | 3300005610 | Soil | MRTLGYITVVTMAAAAAAFGLLAVMSLPDLRRYLKIRKM* |
Ga0066696_102208762 | 3300006032 | Soil | MRALGYITGVTIAAASAALALLVVLSLPDVRRYIKIRKM* |
Ga0066652_1011614151 | 3300006046 | Soil | MRALGYITGITIAAASAALALLVVLSLPDVRRYIKIRKM* |
Ga0074056_117613121 | 3300006574 | Soil | MRTLGYTTAVTTAAAAAALGLLAVMSLPDIRQYLKIRKM* |
Ga0079220_114689991 | 3300006806 | Agricultural Soil | LGYITAVTMAAAAAALGLLAAMSVPDIRRYLKIRKM* |
Ga0075434_1014104591 | 3300006871 | Populus Rhizosphere | MRTLGYITAVTITAAAAALGLLAVMSLPDIRQYLKIRKM* |
Ga0073928_100229316 | 3300006893 | Iron-Sulfur Acid Spring | MRTLGYITAVTLTAAVAALGVLAVMAVPDARRYLKIKKM* |
Ga0073928_101118425 | 3300006893 | Iron-Sulfur Acid Spring | MRTLGYITTIILAAAAAALGLAAVKSLPDVRRYLTVKKM* |
Ga0073928_101559234 | 3300006893 | Iron-Sulfur Acid Spring | MRTLGYITTITLVAAAAALGLVAVKSLPDVRRYLTVRKM* |
Ga0073928_101681121 | 3300006893 | Iron-Sulfur Acid Spring | MRTLGYISAVVLTAASAGLGVLVVMSLPDARRYLKIRKM* |
Ga0073928_105115062 | 3300006893 | Iron-Sulfur Acid Spring | MRILGYVTAVTMAAASAALGLLAVMSLPDVRRYLKIRNM* |
Ga0073928_106164951 | 3300006893 | Iron-Sulfur Acid Spring | MRTFGYISAVVLTAASAGLGVLVVMGIPDLRRYLKFRKM* |
Ga0079219_114064541 | 3300006954 | Agricultural Soil | MRTLGYITAVTMAAAAAALGLLAAMSVPDMRRYLKIKKM* |
Ga0079219_117695421 | 3300006954 | Agricultural Soil | MRTLGYITAITMAATAAALGLLAVMSLPDIRQYLKIRKM* |
Ga0134082_101741421 | 3300010303 | Grasslands Soil | MRALGYITGVTIAAASAALALLVVLSPPDVRRYIKIRKM* |
Ga0134125_105308422 | 3300010371 | Terrestrial Soil | MRTLGYITAVTMAATAAALGLLAVMSLPDIRQYLKIRKM* |
Ga0134125_106019951 | 3300010371 | Terrestrial Soil | RRHAMRTLGYITAVTMAAAAAALGLLAVRSLPDMRQYLKIRKM* |
Ga0134128_109253121 | 3300010373 | Terrestrial Soil | MRTLGYITAVTMAAAAAALGLLAVMSLPDVRQYLKIRKM* |
Ga0134126_112253571 | 3300010396 | Terrestrial Soil | NRRHTMRTLGYITAVTMAATAAALGLLAVMSLPDIRQYLKIRKM* |
Ga0134122_123236021 | 3300010400 | Terrestrial Soil | MRTLGYITAVTMAAAAAALGLLAVMSLPDIRQYRKIRKM* |
Ga0126344_13854591 | 3300010866 | Boreal Forest Soil | MRTLGYIAAVTMATAATALGLLAAMSVPDMRRYMKIRKM* |
Ga0151490_11627431 | 3300011107 | Soil | MRTLGYTTAVTMAAAAAALGLLAVMSLPDIRQYLKIRKM* |
Ga0150983_104222942 | 3300011120 | Forest Soil | MRTLGYITAVTMAAAAAGLGLLAVMSLPDIRQYLKIRKM* |
Ga0150983_109163842 | 3300011120 | Forest Soil | MRTLGYITAVTTAAAVAALGLLTVLSLPDIRRYLRIKKM* |
Ga0150983_111842741 | 3300011120 | Forest Soil | MRTLGYITAVTMTAAAAALGLLAARSVPDIRRFLKIKKM* |
Ga0150983_117366471 | 3300011120 | Forest Soil | MRTLGYITTITMAAAAAALGLAAVKSLPDMRRYLTMRKI* |
Ga0150983_119226271 | 3300011120 | Forest Soil | MRTLGYITAITMAVAAASLGLLAVMSLPDLRKYLKIRKM* |
Ga0150983_129418652 | 3300011120 | Forest Soil | MMRTLGYVTTIILAAAAAALGLLAVKSLPDVRRYLKWRKM* |
Ga0150983_155606801 | 3300011120 | Forest Soil | MRALGYITAVTIAAAGAALALLVVMSVPDVRRYLKIRKM* |
Ga0150983_157605383 | 3300011120 | Forest Soil | MRTLGYITAVTLTAAATTLGVLAVMSVPDMRRYLKIKKM* |
Ga0150983_165965712 | 3300011120 | Forest Soil | MRTLGYISAATLAAGSVAVGLIAIMSWPDMQRYLKIRKM* |
Ga0137377_100023392 | 3300012211 | Vadose Zone Soil | MRALGYITAITIAAASAALALLVVMSVPDVRRYL* |
Ga0137370_107518121 | 3300012285 | Vadose Zone Soil | MRALGYITVVTIAAASAALALLVVLSVPDVRRYMKIRKM* |
Ga0164303_108434122 | 3300012957 | Soil | MRTLGYITAVTTAAAAAALGLLAAMSVPDMRRYLKIRKM* |
Ga0164309_105969172 | 3300012984 | Soil | MRALGYITAVTTAAAAAALGLLAAMSVPDMRRYLKIRKM* |
Ga0164307_114643692 | 3300012987 | Soil | MRTLGYITAVTMAATVAALGLLAVMSLPDIRQYLKIRKM* |
Ga0164306_118140851 | 3300012988 | Soil | MRTLGYITAVTMAATVAALGLLAVMSLPDIRQFLKIRKM* |
Ga0164305_110787181 | 3300012989 | Soil | MRTLGYITAVTMAATAAALGLLAVMSLPDIRQFLKIRKM* |
Ga0132255_1056435881 | 3300015374 | Arabidopsis Rhizosphere | MRTLGYITAVTMAATATALGLLAVMSLPDIRQYLKIRKM* |
Ga0066655_107303133 | 3300018431 | Grasslands Soil | MRALGYITGVTIAAASAALALLVVLSLPDVRRYIKIRKM |
Ga0066662_107904022 | 3300018468 | Grasslands Soil | MRALGYITAVTIAAASAALALLVVLSLPDVRRYIKIRKM |
Ga0184574_1063871 | 3300019159 | Soil | MRTLGHITAITMAAAAAALGLLAVKSLPDIRQYLKIRKM |
Ga0184598_1198753 | 3300019182 | Soil | MRTLGYITAVTMAAATAALGLLAVMSLPDIRQYLKIRKM |
Ga0184603_1314071 | 3300019192 | Soil | MRTLGYITAITMTAAAAGLGFLAVMSLPDIRQYLKIRKM |
Ga0184603_1424751 | 3300019192 | Soil | MMRTIGYVTTVTMAATAAALGLVAVKSLPDVRRYLTMRKI |
Ga0210399_101109233 | 3300020581 | Soil | MRTLGYTTAVTMAAAAAALGLLAVMSLPDLRRYLKIRKM |
Ga0210399_102912772 | 3300020581 | Soil | MRTLGYITAVTMAAAAAGLGLLAVMSLPDIRQYLKIRKM |
Ga0210395_100034933 | 3300020582 | Soil | MRRLGYVTTIIMAAAAAALGLLAVKSLPDARRYLTVRKM |
Ga0210395_100828653 | 3300020582 | Soil | MRTLGYISAITMAAAAAALGLLAVMALPDMRRYLKIRKM |
Ga0210395_103841021 | 3300020582 | Soil | MRTLGYITAVTMTAAAAALGLLAARSVPDIRRFLKIKKM |
Ga0210395_105158721 | 3300020582 | Soil | MRTLGYITAVTLTAAVAALGVLAVMAVPDARRYLKIKKM |
Ga0210405_103655013 | 3300021171 | Soil | MRTLGYITAVTMATAATALGLLAAMSVPDMRRYMK |
Ga0210405_106022022 | 3300021171 | Soil | MRTLGYITAVTLTAAAATLGVLVVMSVPDARRYLKIKKM |
Ga0210405_107817183 | 3300021171 | Soil | MRALGYITAVTIAAASAALALLVVMSVPDVQRYLKIRKM |
Ga0210388_101706002 | 3300021181 | Soil | MRALGYITAVAVAIAAAALGLLVIMSLPDIRQYLKIRKM |
Ga0210388_104697763 | 3300021181 | Soil | MRTLGYITAVTMAATAAALGLLAVKSVPDLRQYLKIRKM |
Ga0210393_102364543 | 3300021401 | Soil | MRTLGYITAVTMAAAATALGLLAAMSVPDMRRYMKIRKM |
Ga0210393_102426153 | 3300021401 | Soil | MRTLGYITAVTMATAATALGLLAAMSVPDMRRYMKIRKM |
Ga0210393_114413862 | 3300021401 | Soil | MRTLGYITAVTLTAAATTLGVLAVMSVPDMRRYLKIKKM |
Ga0210385_100703292 | 3300021402 | Soil | MRTLGYLTAVTMAAAAAALGLLAVMSLPDMRKYLKIRKM |
Ga0210385_101323001 | 3300021402 | Soil | MRTLGYATAVTMAAGAALGLLAVMSLPDIRHYLRIRKM |
Ga0210385_102447292 | 3300021402 | Soil | MRTLGYITAVTMTATAAALGLLAVTSLPDIRRYLKIRKM |
Ga0210385_102473302 | 3300021402 | Soil | MMRRLGYVTTIIMAAAAAALGLLAVKSLPDARRYLTVRKM |
Ga0210397_101662953 | 3300021403 | Soil | MRTLGYITAVTMAAAATALGLLAAMAVPDMRRYMKIRKM |
Ga0210397_103263972 | 3300021403 | Soil | MRGLGYITAVAITTAAAALGLLVIMSLPDIRQYLKIRKM |
Ga0210391_105207212 | 3300021433 | Soil | MRTLGYISATTMAAAAAAFGLLAVMSLPDIRRYLKIRKM |
Ga0210390_102026063 | 3300021474 | Soil | MRTLGYITAVTMAATAATLGLLAVKAVPDMRRYMKIRKM |
Ga0210390_105120281 | 3300021474 | Soil | KDRRHAMRTLGYITAVTMAATAAALGLLAVKSVPDLRQYLKIRKM |
Ga0210390_105706822 | 3300021474 | Soil | MRTLGYITAVTMAATATALGLLVVMSVPDMRRYLKIRKM |
Ga0210390_106862951 | 3300021474 | Soil | MRTLGYITAVTMAAAAAALGLLAVMSLPDMRKYLKIRKM |
Ga0210390_110640232 | 3300021474 | Soil | MRTLGYITAVTLTAAAATLGVLAVMAVPDMRRYLKIK |
Ga0210402_101066924 | 3300021478 | Soil | MRALGYITAVTTAAAAAALGLLAAMSVPDMRRYLKIRKM |
Ga0210409_112476331 | 3300021559 | Soil | MRTLGYITAATMATAATALGLLALMSLPDLRRYLKIRKM |
Ga0212123_100523995 | 3300022557 | Iron-Sulfur Acid Spring | MRTLGYITTIILAAAAAALGLAAVKSLPDVRRYLTVKKM |
Ga0212123_107702611 | 3300022557 | Iron-Sulfur Acid Spring | GYVTAVTMAAASAALGLLAVMSLPDVRRYLKIRNM |
Ga0212123_108964501 | 3300022557 | Iron-Sulfur Acid Spring | MRTFGYISAVVLTAASAGLGVLVVMGIPDLRRYLKIRKM |
Ga0224560_1129552 | 3300023019 | Soil | NRRHAMRTLGHITAITMAAAAAALGLLAVKSLPDIRQYLKIRKM |
Ga0247544_1017301 | 3300023541 | Soil | PAMRTLGYITAVTLTAATATLGVLAVMSVPDVRRYLKIKKM |
Ga0247550_1021081 | 3300023660 | Soil | MRTLGYITTITMAAAAAALGLVAVKSLPDVRRYLTMRK |
Ga0207692_101987282 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYISAVTMAATGAAFGVLAVKSVPDARRYLAMRKM |
Ga0207692_111560001 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGNITAVTMAVAAAALGLLAVRSVPDVRRYLKIRKM |
Ga0207699_100904431 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITAVTMAATAAALGLLAVMSLPDIRQYLKIR |
Ga0207684_103987902 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRALGYTTAVTTAAASAALALLVVMSVPDARRYLKIRKM |
Ga0207707_108480012 | 3300025912 | Corn Rhizosphere | MRTLGYITAVTMAAAAVALGLLAVTSLPDIRQYRKIRKM |
Ga0207693_111358581 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RTLGYITAVTMAATAAALGLLAVMSLPDIRQYRKIRKM |
Ga0207663_101509002 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGNITAVTMAVAVAALGLLAVRSVPDVRRYLKIRKM |
Ga0207700_104478141 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLGYITAVTTAAAAAALGLLAAKSVPDIRRYLKIRKM |
Ga0207700_111094891 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DRRHAMRTLGYITAVTMAAAAVALGLLAVTSLPDIRQYLKIRKM |
Ga0207664_119383572 | 3300025929 | Agricultural Soil | MRTLGYITALTMAATAAALGLLAVMSLPDIRQYLKIRKM |
Ga0209330_10077593 | 3300027619 | Forest Soil | MRTLGYITAVTITAAAAALGLLAVTSLPDIRRFLKIKKM |
Ga0209420_10147163 | 3300027648 | Forest Soil | MRTLGYITAITMAAAAAGLGLLAVMSLPDIRQYLKIRKM |
Ga0209178_14324501 | 3300027725 | Agricultural Soil | MRTLGYITAVTMAATAAALGLLAAMSVPDMRRYLKIRKM |
Ga0209274_100239371 | 3300027853 | Soil | MRTLGYITAITMAAAAASLGLLAVMSLPDLRKYLKIRKM |
Ga0209693_100007749 | 3300027855 | Soil | MRTLGYISAVTMAAAAATLGLLAVMSLPDMRRYLKIRKM |
Ga0209693_100992552 | 3300027855 | Soil | MRTPGYITAVTMAAAAAALGLLTVTSLPDIRRYLKIKKM |
Ga0209275_102217542 | 3300027884 | Soil | MRTVGYITAVTMAVTAAAIGLLAVMSLPDMRRYMKIRKM |
Ga0209380_103240831 | 3300027889 | Soil | MRTVGYITAVTMAVTAAAIGLLAVKSLPDLQRYMKI |
Ga0209068_105858332 | 3300027894 | Watersheds | MRTLGYITTVTTAAAAAALGLLAAKSVPDIRRYLKIRKM |
Ga0209006_102145622 | 3300027908 | Forest Soil | MRRLGHVAAITVAVAAVALGLLAVRSLPEIRRYLAIRKM |
Ga0209168_104517991 | 3300027986 | Surface Soil | MRTLGYITAVTMTASAAALGLLAVMSLPDIRRYLKIRRM |
Ga0307308_106106221 | 3300028884 | Soil | MRTLGYITAVTTAAAALGLLAAMSMPDVRRYLKIRKM |
Ga0311339_101592653 | 3300029999 | Palsa | MRILGYITAITMAAAASALGLLAVRSAPDVRQYLKIRKM |
Ga0265762_10369182 | 3300030760 | Soil | MRTLGSITVITMAAAAAGLGLLAVMSLPDIRQYLKIRKM |
Ga0265775_1127591 | 3300030762 | Soil | MRTLGYITAVTLATASAALGLLVVMSLPDVRRYLKIRRM |
Ga0074037_14690322 | 3300030803 | Soil | MRTLGTITAVTMAAAAAALGLLAVMAVPDARRYLKIRRM |
Ga0265756_1034632 | 3300030805 | Soil | MRTLGYITAVTMATAATALGLLAAMSVPDLRRYMKIRKM |
Ga0265777_1037442 | 3300030877 | Soil | MRTLGYITAITMAAAAGLGLLAVMSLPDIRQYLKIRKM |
Ga0265777_1082012 | 3300030877 | Soil | MRTLGQITAVTLAVASAGLGLAMVMAWPDMQRYLKIRNM |
Ga0265758_1012741 | 3300030884 | Soil | MRTLGYITAITMAVTAATLGLLTAMSLPDIRRYLKIRKM |
Ga0302324_1007730373 | 3300031236 | Palsa | MMRTLGYITAVTMAAAGAAVGLLTVMSIPDVRRYLKIRNM |
Ga0302324_1033916822 | 3300031236 | Palsa | MRTFGYISAITMAAAASALGLLAVKSAPDVRRYLKIRKM |
Ga0310686_1153489802 | 3300031708 | Soil | MRILGYITAITMAAAAAALGLLAVRSAPDVRQYLKIMKM |
Ga0307474_100612503 | 3300031718 | Hardwood Forest Soil | MRTLGYITAVTMAAAVAALGLLAVMSLPDIRKYLKIKKM |
Ga0307469_110383401 | 3300031720 | Hardwood Forest Soil | MRTLGYITAVTMAAAAAALGLLAVMSLPDIRQYLKIRK |
Ga0316037_1018172 | 3300031808 | Soil | MRTLGQMTAVALAVTSAALGLLVVMSLPDLRRYLKIRKM |
Ga0316047_1023342 | 3300031874 | Soil | MRTLGQMTAVALAVTSAALGLLVVMSLPDLRRYLKIWKM |
Ga0316053_1070601 | 3300032120 | Soil | MRTLGYITAVTMTAAAAALGLLVARSVPDIRRYLKIKKM |
Ga0307472_1008171982 | 3300032205 | Hardwood Forest Soil | MRTLGYITAATMAAAAAALGLLAAMSVPDIRRYLKIRKM |
Ga0348332_100884282 | 3300032515 | Plant Litter | MRTLGYITAVTMAAAVAALGLLAVMSVPDIRQYLKIRKM |
Ga0348332_101262981 | 3300032515 | Plant Litter | MRTLGYITAVTMTAAAAALGLLVARSVPDIRRILKIKKM |
Ga0348332_110382202 | 3300032515 | Plant Litter | MRTLGYITAVTMAAAAAALGVLAVMSVPDMQRYLKIKKM |
Ga0348332_120983561 | 3300032515 | Plant Litter | MRALGYITAVTMAAAAATLGLLAAMSVPDMRRYLKIRRM |
Ga0348332_145796023 | 3300032515 | Plant Litter | MRTLGYITAVTLTAATATLGVLAVMSVPDVRRYLKIKKM |
Ga0315741_102000711 | 3300032739 | Forest Soil | MRTLGQITAVALAGAGAGLGLLMVMSWPDVQRYLKIRNM |
Ga0315741_120340362 | 3300032739 | Forest Soil | GEDRRDEMRTLGQITAVALAATSAALGLLMVMSWPDVRRYLKIRKM |
Ga0335081_115629941 | 3300032892 | Soil | MRTLGYITAVTMAAAAAPLGVLTVMSLPDARRYLKIRKM |
Ga0335075_103886242 | 3300032896 | Soil | MRALGLTIGVIIAVASMALGLLVITSLPDVRRYLKIRKM |
Ga0335075_114669961 | 3300032896 | Soil | MRTLGYTTAVTMTAVTAVLGLLAVMSLPDIRRYLKIKKM |
Ga0335072_1000750415 | 3300032898 | Soil | MRTLGYLTAVTMAAAAAALGLLTMMSLPDIRRYLKIRKM |
Ga0247830_116978292 | 3300033551 | Soil | RHTMRTLGYITAVTIAAAAAVLGLLAVMSLPDIRQYLKIRKM |
⦗Top⦘ |