NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F040638

Metatranscriptome Family F040638

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040638
Family Type Metatranscriptome
Number of Sequences 161
Average Sequence Length 168 residues
Representative Sequence VGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLIAWRLRDKMRPHIGESVYVVNCNKFPDSPNFPMMFGSVEIFSSAAMIAYADGSWKCGQQLPWDAWGEDYYMTHCLDMLGVGRISDFTVVGDNVCTGADCGDGDKGSYHPFKSPEDWEACWTAAM
Number of Associated Samples 98
Number of Associated Scaffolds 161

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.64 %
% of genes near scaffold ends (potentially truncated) 95.65 %
% of genes from short scaffolds (< 2000 bps) 96.89 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.78

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.894 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(44.721 % of family members)
Environment Ontology (ENVO) Unclassified
(96.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(52.174 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.95%    β-sheet: 12.31%    Coil/Unstructured: 49.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.78
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
c.68.1.4: Galactosyltransferase LgtCd1g9ra_1g9r0.62599
c.68.1.13: Cytidylytransferased2yc3a12yc30.62499
c.68.1.0: automated matchesd2yqca_2yqc0.62317
c.68.1.0: automated matchesd2v0ha12v0h0.62258
c.68.1.13: Cytidylytransferased1inja_1inj0.61807


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 161 Family Scaffolds
PF02064MAS20 0.62



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.89 %
UnclassifiedrootN/A3.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006415|Ga0099654_10031517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata773Open in IMG/M
3300008832|Ga0103951_10325289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata800Open in IMG/M
3300008832|Ga0103951_10611269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata594Open in IMG/M
3300008930|Ga0103733_1036612All Organisms → cellular organisms → Eukaryota → Sar774Open in IMG/M
3300008936|Ga0103739_1046378All Organisms → cellular organisms → Eukaryota → Sar607Open in IMG/M
3300008998|Ga0103502_10244461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata659Open in IMG/M
3300008998|Ga0103502_10368747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300009023|Ga0103928_10184145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata728Open in IMG/M
3300009023|Ga0103928_10271689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata624Open in IMG/M
3300009028|Ga0103708_100023859All Organisms → cellular organisms → Eukaryota → Opisthokonta1174Open in IMG/M
3300009028|Ga0103708_100146563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata640Open in IMG/M
3300012727|Ga0157531_1013954All Organisms → cellular organisms → Eukaryota → Sar529Open in IMG/M
3300017299|Ga0186338_1025268All Organisms → cellular organisms → Eukaryota → Sar743Open in IMG/M
3300017335|Ga0186050_1012251All Organisms → cellular organisms → Eukaryota → Sar1139Open in IMG/M
3300017335|Ga0186050_1031747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata754Open in IMG/M
3300017335|Ga0186050_1036388All Organisms → cellular organisms → Eukaryota → Sar684Open in IMG/M
3300018684|Ga0192983_1043188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata625Open in IMG/M
3300018684|Ga0192983_1045976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata604Open in IMG/M
3300018696|Ga0193110_1012183All Organisms → cellular organisms → Eukaryota → Sar855Open in IMG/M
3300018739|Ga0192974_1076214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata539Open in IMG/M
3300018764|Ga0192924_1044751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300018769|Ga0193478_1053529All Organisms → cellular organisms → Eukaryota → Sar651Open in IMG/M
3300018784|Ga0193298_1099288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300018807|Ga0193441_1079313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300018824|Ga0188874_1028008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata604Open in IMG/M
3300018848|Ga0192970_1072486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata635Open in IMG/M
3300018854|Ga0193214_1077143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata620Open in IMG/M
3300018854|Ga0193214_1095018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300018863|Ga0192835_1114868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300018873|Ga0193553_1078425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata878Open in IMG/M
3300018873|Ga0193553_1085500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata829Open in IMG/M
3300018903|Ga0193244_1062656All Organisms → cellular organisms → Eukaryota → Sar687Open in IMG/M
3300018903|Ga0193244_1064874All Organisms → cellular organisms → Eukaryota → Sar675Open in IMG/M
3300018904|Ga0192874_10062422All Organisms → cellular organisms → Eukaryota → Sar693Open in IMG/M
3300018924|Ga0193096_10226504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300018926|Ga0192989_10117228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata663Open in IMG/M
3300018930|Ga0192955_10108233All Organisms → cellular organisms → Eukaryota → Sar698Open in IMG/M
3300018930|Ga0192955_10120683All Organisms → cellular organisms → Eukaryota → Sar664Open in IMG/M
3300018942|Ga0193426_10127187All Organisms → cellular organisms → Eukaryota → Sar572Open in IMG/M
3300018957|Ga0193528_10254138All Organisms → cellular organisms → Eukaryota → Sar608Open in IMG/M
3300018957|Ga0193528_10318944All Organisms → cellular organisms → Eukaryota → Sar510Open in IMG/M
3300018970|Ga0193417_10136487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata804Open in IMG/M
3300018976|Ga0193254_10063707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata857Open in IMG/M
3300018976|Ga0193254_10117546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata614Open in IMG/M
3300018978|Ga0193487_10216957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata622Open in IMG/M
3300018980|Ga0192961_10182483All Organisms → cellular organisms → Eukaryota → Sar634Open in IMG/M
3300018980|Ga0192961_10245430All Organisms → cellular organisms → Eukaryota → Sar527Open in IMG/M
3300018980|Ga0192961_10256847All Organisms → cellular organisms → Eukaryota → Sar512Open in IMG/M
3300018981|Ga0192968_10137403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300018992|Ga0193518_10268674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata626Open in IMG/M
3300018997|Ga0193257_10119412All Organisms → cellular organisms → Eukaryota → Sar825Open in IMG/M
3300018998|Ga0193444_10095664All Organisms → cellular organisms → Eukaryota → Sar781Open in IMG/M
3300019000|Ga0192953_10109736All Organisms → cellular organisms → Eukaryota → Sar672Open in IMG/M
3300019008|Ga0193361_10148589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata896Open in IMG/M
3300019011|Ga0192926_10240219All Organisms → cellular organisms → Eukaryota → Sar774Open in IMG/M
3300019011|Ga0192926_10419665All Organisms → cellular organisms → Eukaryota → Sar563Open in IMG/M
3300019012|Ga0193043_10301518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata580Open in IMG/M
3300019013|Ga0193557_10156183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata788Open in IMG/M
3300019013|Ga0193557_10226063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata604Open in IMG/M
3300019013|Ga0193557_10283488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300019017|Ga0193569_10366109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300019021|Ga0192982_10182994All Organisms → cellular organisms → Eukaryota → Sar743Open in IMG/M
3300019022|Ga0192951_10405340All Organisms → cellular organisms → Eukaryota → Sar516Open in IMG/M
3300019023|Ga0193561_10259857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata645Open in IMG/M
3300019029|Ga0193175_10159151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata745Open in IMG/M
3300019035|Ga0192875_10078190All Organisms → cellular organisms → Eukaryota → Sar914Open in IMG/M
3300019035|Ga0192875_10170736All Organisms → cellular organisms → Eukaryota → Sar541Open in IMG/M
3300019040|Ga0192857_10213243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata627Open in IMG/M
3300019040|Ga0192857_10314764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300019049|Ga0193082_10356126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Endodiniaceae → Brandtodinium → Brandtodinium nutricula780Open in IMG/M
3300019053|Ga0193356_10161848All Organisms → cellular organisms → Eukaryota → Sar782Open in IMG/M
3300019053|Ga0193356_10265761All Organisms → cellular organisms → Eukaryota → Sar605Open in IMG/M
3300019053|Ga0193356_10301038All Organisms → cellular organisms → Eukaryota → Sar564Open in IMG/M
3300019099|Ga0193102_1030305All Organisms → cellular organisms → Eukaryota → Sar518Open in IMG/M
3300019112|Ga0193106_1009127All Organisms → cellular organisms → Eukaryota → Sar873Open in IMG/M
3300019120|Ga0193256_1047355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata733Open in IMG/M
3300019120|Ga0193256_1080896All Organisms → cellular organisms → Eukaryota → Sar533Open in IMG/M
3300019139|Ga0193047_1064658All Organisms → cellular organisms → Eukaryota → Sar727Open in IMG/M
3300019139|Ga0193047_1077564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata671Open in IMG/M
3300019139|Ga0193047_1077669All Organisms → cellular organisms → Eukaryota → Sar671Open in IMG/M
3300019139|Ga0193047_1109408All Organisms → cellular organisms → Eukaryota → Sar569Open in IMG/M
3300019139|Ga0193047_1131107All Organisms → cellular organisms → Eukaryota → Sar516Open in IMG/M
3300019153|Ga0192975_10204299All Organisms → cellular organisms → Eukaryota → Sar695Open in IMG/M
3300019153|Ga0192975_10288075All Organisms → cellular organisms → Eukaryota → Sar548Open in IMG/M
3300021932|Ga0063872_1106998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300030653|Ga0307402_10369661All Organisms → cellular organisms → Eukaryota → Sar825Open in IMG/M
3300030653|Ga0307402_10704050All Organisms → cellular organisms → Eukaryota → Sar588Open in IMG/M
3300030670|Ga0307401_10384874All Organisms → cellular organisms → Eukaryota → Sar637Open in IMG/M
3300030671|Ga0307403_10504278All Organisms → cellular organisms → Eukaryota → Sar654Open in IMG/M
3300030671|Ga0307403_10567487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata615Open in IMG/M
3300030699|Ga0307398_10619310All Organisms → cellular organisms → Eukaryota → Sar599Open in IMG/M
3300030699|Ga0307398_10786926All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300030709|Ga0307400_10964471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300030749|Ga0073969_11299204All Organisms → cellular organisms → Eukaryota → Sar505Open in IMG/M
3300030750|Ga0073967_11722275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Endodiniaceae → Brandtodinium → Brandtodinium nutricula562Open in IMG/M
3300030750|Ga0073967_11990564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata658Open in IMG/M
3300030750|Ga0073967_12046001All Organisms → cellular organisms → Eukaryota → Sar712Open in IMG/M
3300030787|Ga0073965_11782781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300030919|Ga0073970_11353618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata598Open in IMG/M
3300031063|Ga0073961_11750999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300031522|Ga0307388_10486178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata811Open in IMG/M
3300031522|Ga0307388_10669318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata692Open in IMG/M
3300031522|Ga0307388_10757270All Organisms → cellular organisms → Eukaryota → Sar650Open in IMG/M
3300031522|Ga0307388_10787158All Organisms → cellular organisms → Eukaryota → Sar638Open in IMG/M
3300031522|Ga0307388_10904497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300031522|Ga0307388_10982484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300031522|Ga0307388_11058930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300031522|Ga0307388_11106041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300031522|Ga0307388_11115364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300031522|Ga0307388_11214688All Organisms → cellular organisms → Eukaryota → Sar513Open in IMG/M
3300031710|Ga0307386_10628994All Organisms → cellular organisms → Eukaryota → Sar570Open in IMG/M
3300031734|Ga0307397_10598438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300031737|Ga0307387_10798657All Organisms → cellular organisms → Eukaryota → Sar596Open in IMG/M
3300031737|Ga0307387_10842022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata581Open in IMG/M
3300031737|Ga0307387_10979880All Organisms → cellular organisms → Eukaryota → Sar538Open in IMG/M
3300031737|Ga0307387_11117970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300031739|Ga0307383_10659208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300031742|Ga0307395_10305640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata686Open in IMG/M
3300031742|Ga0307395_10392628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata603Open in IMG/M
3300031743|Ga0307382_10550032All Organisms → cellular organisms → Eukaryota → Sar531Open in IMG/M
3300031750|Ga0307389_10747864All Organisms → cellular organisms → Eukaryota → Sar639Open in IMG/M
3300031750|Ga0307389_10832800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata606Open in IMG/M
3300031750|Ga0307389_10889220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata587Open in IMG/M
3300031752|Ga0307404_10338463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata627Open in IMG/M
3300032463|Ga0314684_10428672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata777Open in IMG/M
3300032463|Ga0314684_10631939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata621Open in IMG/M
3300032519|Ga0314676_10593725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata654Open in IMG/M
3300032520|Ga0314667_10732469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300032521|Ga0314680_10495930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata768Open in IMG/M
3300032521|Ga0314680_11009741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300032521|Ga0314680_11036172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300032522|Ga0314677_10289413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata863Open in IMG/M
3300032616|Ga0314671_10665889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300032651|Ga0314685_10642370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata575Open in IMG/M
3300032707|Ga0314687_10612871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata606Open in IMG/M
3300032707|Ga0314687_10623049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300032708|Ga0314669_10313666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata845Open in IMG/M
3300032708|Ga0314669_10400164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Endodiniaceae → Brandtodinium → Brandtodinium nutricula751Open in IMG/M
3300032713|Ga0314690_10328218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata759Open in IMG/M
3300032713|Ga0314690_10584061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300032713|Ga0314690_10657461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300032729|Ga0314697_10482599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300032730|Ga0314699_10464172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300032742|Ga0314710_10413245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata561Open in IMG/M
3300032743|Ga0314707_10431712All Organisms → cellular organisms → Eukaryota → Sar687Open in IMG/M
3300032743|Ga0314707_10682699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300032744|Ga0314705_10460459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata684Open in IMG/M
3300032748|Ga0314713_10373796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata606Open in IMG/M
3300032750|Ga0314708_10434966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300032751|Ga0314694_10518580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300032752|Ga0314700_10513026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata637Open in IMG/M
3300032752|Ga0314700_10637834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata563Open in IMG/M
3300033572|Ga0307390_10573651All Organisms → cellular organisms → Eukaryota → Sar702Open in IMG/M
3300033572|Ga0307390_10596346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata689Open in IMG/M
3300033572|Ga0307390_10921159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300033572|Ga0307390_10993532All Organisms → cellular organisms → Eukaryota → Sar532Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine44.72%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.57%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater18.63%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.48%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water1.24%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.24%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.24%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.62%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300012727Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017299Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 405 ?mol photons light - Strombidinopsis acuminata SPMC142 (MMETSP0126)Host-AssociatedOpen in IMG/M
3300017335Metatranscriptome of marine eukaryotic communities from York River, Chesapeake Bay in f/2 medium with natural seawater and antibiotics, no silicate, 22 C, 21 psu salinity and 269 ?mol photons light - Kryptoperidinium foliaceum CCAP 1116/3 (MMETSP0119_2)Host-AssociatedOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018696Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000864 (ERX1782143-ERR1711870)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018784Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789528-ERR1719403)EnvironmentalOpen in IMG/M
3300018807Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002356 (ERX1789611-ERR1719493)EnvironmentalOpen in IMG/M
3300018824Metatranscriptome of marine microbial communities from Baltic Sea - GS850_ls4EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018863Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000581 (ERX1789689-ERR1719283)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018904Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789433-ERR1719416)EnvironmentalOpen in IMG/M
3300018924Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000046 (ERX1789468-ERR1719259)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018970Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789437-ERR1719295)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018992Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_146 - TARA_N000003240 (ERX1789485-ERR1719233)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019008Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019013Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003089EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019023Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_145 - TARA_N000003231EnvironmentalOpen in IMG/M
3300019029Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000313 (ERX1789463-ERR1719383)EnvironmentalOpen in IMG/M
3300019035Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789492-ERR1719296)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030749Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030750Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030787Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030919Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031063Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0099654_1003151713300006415LakePAIDVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNYDFTLKVDPDAVLIPWRMREHLKPHIGENAYVVNCNKFPGSPNFPMMFGAVEIFTHQAMTAYAYGSWRCGQQLPWNLWGEDYYMTHCLDFLGVGRIADFGVLGDNVCTGANCKDSYTASFHPFKDAESWFSCWSDATGF*
Ga0103951_1032528913300008832MarineHGVAVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLIAWRLRDKMAPHIGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDMLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAAR*
Ga0103951_1061126913300008832MarineWDKIIAAGRFRYYDWTVKVDPDAVLLAWRLREHLEPHVGETVYVVNCNKFPSSPNFPMMYGALEIFSHSAMDQYAAQSWKCGQELDWKAWGEDYYMTHCMDYIGVGRIGDFGVLGDNVCTGANCADGWTAAYHPFKEAGTWLDCWGEATAKGH*
Ga0103733_103661213300008930Ice Edge, Mcmurdo Sound, AntarcticaNAKLFINCWNVIVQAGIWNNHAWTVKVDPDAVVLPGRLRDHLRPYVLENVYVVNCNKVPDSPNFPMMFGSVEIFSSAAMIAYADGSWQCGQQLPWDQWGEDYYMTHCLDMLGVGRLNDFSVVGDNVCTGADCGDGDKGSYHPFKTAADWTACWNQAAR*
Ga0103739_104637813300008936Ice Edge, Mcmurdo Sound, AntarcticaWDAVIAAKRFRDYDWTIKADPDAVLIPWRLRGKLGPHVGENVYVVNCNKFPSSPNFPMMYGSVEIFSSAAMIAYADGSWRCGQDLPWDLWGEDYYMTHCLDYLGVGRLSDFTVVGDEVCTGAMNCEAGDLGSFHPFKTVDDWEKCWNRAVPS*
Ga0103502_1024446113300008998MarineVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLIAWRLRDKMRPHIGESVYVVNCNKFPDSPNFPMMFGSVEIFSSAAMIAYADGSWKCGQQLPWDAWGEDYYMTHCLDMLGVGRISDFTVVGDNVCTGADCGDGDKGSYHPFKSPEDWEACWTAAM*
Ga0103502_1036874713300008998MarineVAGKRFRDYDWTIKADPDAVLIPWRLRDHMRPYVGENVYVVNCNKFPSSPNFPMMYGAVEIFSSAAMIAYAAGSWKCGQDLPWGGWGEDYYMTHCLDYLGVGRISDFTVVGDNVCTGANCQDGGVASFHPFKTPGDWKKCWQQAVPAE*
Ga0103928_1018414513300009023Coastal WaterAKLFMALWDKVIAGGRFRNYDWTIKVDPDAVLVAWRIRDHMRPHVGTKVYVVNCNKFPSSPNFPMMYGALEVFSKGAMEAYAQGSWKCGTQLPWKLWGEDYYMTHCMDFLKVGRIGDFTVLGDNMCIGANCADKNTASFHPFKSKETWHVCWDTANGHPPPSQDVRDPHGLQHLWHKKLPRLPKEVR*
Ga0103928_1027168913300009023Coastal WaterSVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVIVPWRIRDHMRPHVGEKVYVVNCNKFPGSPNFPMMYGAVEVFSQAAMVQYALNSWKCGKQLPWGSWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGQATAPPPKPGAATYV
Ga0103708_10002385923300009028Ocean WaterVKSDFHILKRKSTGTWVNTGMFTQVWKAITAEGSWAKHNWVIKVDADAVMLPWRVRDHMLPHIGKKVYVVNCNKYPDSPNFPMMYGSMEIFSHPAMLAYAESSWKCGKELPWAAWGEDYFMTKCMDYVGVDRIADFGVIADNVCTGANCADSYSGAFHPFKTVETWKECWATATETNQ*
Ga0103708_10014656313300009028Ocean WaterENVAVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVVIAWRLRDKMAPHVGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDMLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAAR*
Ga0157531_101395413300012727FreshwaterVISLGMTPSGDEVMTEEFQGAPVGISQDGTAGNTLLFMKVWDKIIADGNWLNFDWTLKVDPDAVVVPVRLRSHLLPHNGISAYVVNCNKFPGSPNFPMMYGALEVFSLNAMLAYSQGSGNCGSHFWPQWQAWGEDYFMTHCMDYLGVGRIGDFGILGDNMCTGANCADGWTAAYH
Ga0186338_102526813300017299Host-AssociatedDKIIKKQRFRNYDWTLKVDPDAVLHPVRMRAHMKGHNGENVYVVNCNKVPGSPNFPMMFGAVEVFSNSAMDAYAAGSGKCGKDFWPSWQQWGEDYFMTHCLDHLGVGRISDFNSLGDNMCLGAHCEDGAVAAFHPFKTVGDWMGCWNIGKR
Ga0186050_101225113300017335Host-AssociatedSVIIPVIQVGISQDGTAGNAKLFMAMWDKVIAGGRFRYYDWTIKVDPDAVILPWRLRGHLAARVGETVYVANCDKYPFSPNFPMMYGAVEIFSQAAMATYATASWRCGKELPWHQWGEDYFMTHCMDYIGVDRISDFGVLGDNVCIGANCEDPGVASFHPFKTEDKWHACWNAANDLPADSEKEAFDTDVS
Ga0186050_103174713300017335Host-AssociatedKLIAHNRFLSFDFTLKVDPDAVLIPWRIRDHMRPHVGSNSYVVNCNKFPNSPNFPMMFGAVEIFSSQAMDAYARGSWKCGAQLPWKSWGEDYYMTHCLDFLGVGRIADFGVLGDNVCTGANCADQYKGSFHPFKSIDSWMQCWGQATAA
Ga0186050_103638813300017335Host-AssociatedFASTETILGRTKDLHLVEAILIPNIKVGVSQDGTAGNAQLFMAVWDKIIAQRKFTFYDWTIKVDPDAAIIPWRMRDHLRWHVGKNAYVVNCNKFPGSPNFPMMYGAVEVFSMQAMYAYARGSGRCGSQLPWHAWGEDYYMTHCLDFLGVGRIADFGTLGDQLCTGANCQDGGVAAFHPFKSADAWEGCWRQAVPESR
Ga0192983_104318813300018684MarineWTIKVDPDAVLIPWRIRDHMQQHNGQNLYVVNCNKVPGSPNFPMMFGAVEIFSQKAMISYALSSWKCGKQLPWKLWGEDYYMTHCMDFIGVGRIGDFGVLGDNMCSGANCKDSFVASFHPFKDTNSWMQCWGQATMPAPAPAPTIVIRK
Ga0192983_104597613300018684MarineKVIAGGRYRNYDWTIKVDPDAVLVSWRMRDHLKPHVGENVYVVNCNKFPGSPNFPMMYGAVEVFSSAAMLHYAEASWKCGTQLPWKAWGEDYYMTHCMDFVGVGRISDFGILGDNMCTGANCADVGVSSFHPFKTEASWMECWTKATAPPAAAPALPR
Ga0193110_101218313300018696MarineIAVGVSQDGTAGNAKLFMAVWDKVIAGNRFRYHDFTIKVDPDAVIIPWRMRTHVMPHLGKNAYVVNCNKVPGSPNFPMMFGSVEVFTHQAMIAYAMGSWKCGSQLPWGSWGEDYYMTHCLDFLGVGRVNDFGVVGDAVCTGANCADTFVAAFHPFKNNAAWFKCWDTAMR
Ga0192974_107621413300018739MarineAEADTLGTSKDGIVVDAILIPKIRVGKSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDADAVMLPWRVRDHMAPHVGEKVYVVNCNKYPNSPNFPMMYGSMEIFSQPAMAAYAESSWKCGKELPWAKWGEDYFMTKCMDYVGVNRIADFGVIGDNVCTGANCADTYTGAFHPFKS
Ga0192924_104475113300018764MarineRFRYYDWTVKVDPDAVLLAWGLREHMKPHTGEKVYVVNCNKFPSSPNFPMMYGALEIFSHAAMDEYALNSWRCGQELDWKAWGEDYFMTHCMDYIGVGRIGDFGVLGDNVCTGANCQDGWTAAYHPFKTVGTWQECWGVATAPSPEE
Ga0193478_105352913300018769MarineDGTAGNAKLFMAVWDKIIAGGRFRYFDWTVKVDPDAVLLAWRLREHMKPHTGEKVYVVNCNKFPDSPNFPMMYGALEIFSHPAMDEYAMNSWRCGQQLDWKAWGEDYFMTHCMDFIGVGRIGDFGVLGDNVCTGANCADGWTAAYHPFKTEDTWQECWGAATR
Ga0193298_109928813300018784MarineAVWDKVIAGNRFRNYDFTIKADPDAVLIAWKIRDHMSSHVGQKAYVVNCNKVPGSPNFPMMFGAVEVFSRPAMDAYAAGSWKCGQQLPWGSWGEDYYMTHCMDFLGVGRIADFGVLGDNVCTGANCMDQGVASFHPFKTVDSWEACWWKATKR
Ga0193441_107931313300018807MarineKSVLIPKITVGVSQDGTAGNAKLFMAVWDKVIAGNRFRNYDFTIKVDPDAVLVPWKIRNHMASHVGQNAYVVNCNKVPGSPNFPMMFGAVEVFSQPAMDAYAAGSWKCGQQLPWGSWGEDYYMTHCMDFLGVGRIADFGVLGDNVCTGANCQDQGVASFHPFKTIDSWMQCWGQATR
Ga0188874_102800813300018824Freshwater LakePKIEVGVSQDGTAGNAKLFMAVWDKIIASNKFRNFDWTIKVDPDAVIIPWRVRQHMKPHNGVNAYVVNCNKFPGSPNFPMMYGAVEIFSNKAMDAYAAGSWKCGQQLPWHSWGEDYYMTHCLDFLGVGRISDFGVLGDNLCTGANCADTFVGSFHPFKDIGAWMQCWGKATATGK
Ga0192970_107248613300018848MarineLVKTKTIPKIEVGVSQDGTAGNAKLFMAFWDKIVSEKRYRDFDWTIKADPDAVVIAWRLRDKLRVHVGENVYVVNCNKFPNSPNFPMMFGSVEIFSSAAMISYAAGSTRCGTELPWKAWGEDYFMTHCLDLLGVGRLNDFTVVGDNVCTGANCADGAMGSYHPFKTPEDWKACWAAAVPG
Ga0193214_107714313300018854MarineGKSKDGILVKSVVIPNIAVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLIAWRLRDKMKPHIGENVYVVNCNKFPDSPNFPMMFGSVEIFSSAAMIAYADGSWKCGQQLPWDAWGEDYYMTHCLDMLGVGRISDFTVVGDNVCTGADCGDGDKGSYHPFKSPGDWEACWTAAM
Ga0193214_109501813300018854MarinePKIEVGVSQDGTAGNAKLFMAMWDKIIAGKRFRDYDWTIKADPDAVLIPWRIREHMAPHVGENVYVVNCNKFPDSPNFPMMFGSVEIFSSAAMIAYAAGSWKCGQDLPWDAWGEDYYMTHCLDYLGVGRISDFTVVGDNVCTGANCAGGDASFHPFKTTGDWKKCWDQAMSR
Ga0192835_111486813300018863MarineLGYHDQDDILVKSIKIPTITVGVSQDGTAGNAKLFMAVWDKVIAGNRFRNYDFTIKADPDAVLIAPKIRDHMSSHVGQKAYVVNCNKVPGSPNFPMMFGAVEVFSRPAMDAYAAGSWKCGQQLPWGSWGEDYYMTHCMDFLGVGRIADFGVLGDNVCTGANCMDQGVAS
Ga0193553_107842513300018873MarineQDGTAGNAKLFMAMWDVIIAGKRFRDYDWTIKADPDAVLIPWRIRDHMAEHVGKNVYVVNCNKFPDSPNFPMMFGSVEIFSSAAMIAYAAGSWKCGQQLPWESWGEDYYMTHCLDFLGVGRLNEFSVVGDNVCTGANCEDGSIASFHPFKTPGDWKVCWDKALR
Ga0193553_108550013300018873MarineVIIAGKRFRDYDWTIKADPDAVLIPWRIRDHMAEHVGKNVYVVNCNKFPDSPNFPMMFGSVEIFSSAAMIAYAAGSWKCGQQLPWESWGEDYYMTHCLDFLGVGRLNEFSVVGDNVCTGANCEDGSIASFHPFKTPGDWKVCWDKALR
Ga0193244_106265613300018903MarineGGRFRNYDWTIKVDADAVMLPWRVRDHMRPHVGEKVYVVNCNKYPDSPNFPMMYGSMEIFSQPAMAAYAESSWKCGKELPWAKWGEDYFMTKCMDYVGVNRIADFGVIGDNVCTGANCADSYTGAFHPFKSIETWRECWTTATANEK
Ga0193244_106487413300018903MarineKTLTIEKIDVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLIPWRLRSKMASHVGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIVYADGSWKCGQQLPWDAWGEDYYLTHCLDMLGVGRISDFTVVGDNVCTGADCGDGDKGSYHPFKTPEDWEACWTQAVPPA
Ga0192874_1006242213300018904MarineILTDKIEVGVSQDGTAGNAKLFMAMWDKVLAGKRFKYYDWTIKVDPDAVLLAWRVRSHLTQHNAKKAYVVNCNKFPDSPNFPMMYGAVEAFSHLAMLAYAKDSWKCGQELDWKGWGEDYYMTHCLDYIGVGRVEDFGLLGDNMCTGSDCSNFQEASFHPFKTITAWNKCWTAATVMGM
Ga0193096_1022650413300018924MarineKAVLIPMIAVGVSQDGTAGNAKLFMAVWDKVIAGNRFRNFDFTIKADPDAVLIPWRIRQHMSAHVGENAYVVNCNKFPNSPNFPMMFGAVEIFTSLAMDAYAAGSWKCGQQLPWASWGEDYYMTHCLDFLGVGRIADFGVLGDNVCTGANCLDQYTGSFHPFKSVGTWMQCWGQATVPPAKSAAPR
Ga0192989_1011722813300018926MarineFAAEPDTLGTSKDGIVVKAVQIPKIDVGVSQDGTAGNAKLFMAVWDKIIAGGRFRYYDWTVKVDPDAVLLAWRLRDHMRPFTGQKVYVVNCNKFPDSPNFPMMYGALEIFSHSAMDEYAAQSWRCGTELDWKAWGEDYFMTHCMDHIGVGRIGDFGVLGDNVCTGANCGDGWTAAYHPFKTIGTWVDCWGSATAAQ
Ga0192955_1010823313300018930MarineKLFMAFWDKIIAGKRFRDYDWTIKADPDAVVIAWRLRDKMAPHVGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWQCGQQLPWDAWGEDYYLTHCLDLLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAAR
Ga0192955_1012068313300018930MarineMGGGVEVKAILTEKIDVGVSQDGTAGNAKLFMAMWDKVIAGKRYSYYDWTIKVDPDAVLLAWRVRDHLREHTGSHAYVVNCNKFPDSPNFPMMYGAVEAFSHKAMTAYAADSVKCGQDLPWKEWGEDYYMTHCLDYIGVGRVQDFSLLGDNVCLGASCKDHSMASYHPFKSIADWNTCWTEATAQ
Ga0193426_1012718713300018942MarineAVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLIPWRLRDKMAPHLGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDMLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAGR
Ga0193528_1025413813300018957MarineGTAGNAKLFMAVWDKIIAGGRFRYFDWTVKVDPDAVLLAWRLREHMKPHTGEKVYVVNCNKFPDSPNFPMMYGALEIFSHAAMDEYAMNSWRCGQELDWKAWGEDYFMTHCMDYIGVGRIGDFGVLGDNVCTGANCADGWTAAYHPFKTEDTWQECWGAATR
Ga0193528_1031894413300018957MarineAGKRFRDYDWTIKADPDAVVIPWRLRSKMASHIGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDMLGVGRIEDFSVTGDNVCTGADCGDGDKGSYHPFKTPEDWEACWIQAVPPA
Ga0193417_1013648713300018970MarineDTLGVSADGITVESLIIPKINVGLSQDGTAGNAKLFMAVWDKVIAGGRHQFYDWTVKADPDAVVLPWRLRSHMEAHVGEHVYVVNCNKVPNSPNFPMMFGAVEVFSQSAMMAYAANSWKCGKQLPWKMWGEDYYMTHCMDYVGVGRIADFGVVGDNMCTGAHCEDQSIASFHPFKTVSSWNECWDTANGHPPAPPTKEMTFKQQK
Ga0193254_1006370713300018976MarineGGRYSNFDFTIKVDPDAVIIPWRVRDHMRPHVGEKVYVVNCNKFPNSPNFPMMYGAVEVFSQSAMVQYALNSWKCGKQLPWGSWGEDYYMTHCMDFIGVGRIGDFGLLGDNMCTGANCADGGIASFHPFKSQGLWMQCWGQATAPPPEPAAYV
Ga0193254_1011754613300018976MarineLGTTKDGIEVKPIQIPKITVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLIPWRVRDHLAQHVGEKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYALNSWKCGKQLPWASWGEDYYMTHCMDFVGVGRIGDFGILGDQLCTGANCADGGIASFHPFKNIGVWMQCWGQATAPPAKPGAPPPR
Ga0193487_1021695713300018978MarineLGTSKDGVEVKAVLIPKIEVGVSQDGTAGNAKLFMAVWDKIIAEGRFRYYDWTVKVDPDAVLLAWRLREHLEPHVGEKVYVVNCNKFPSSPNFPMMYGALEIFSHSAMDEYAAQSWRCGQELDWKAWGEDYYMTHCMDYIGVGRIGDFGVLGDNVCTGANCADGWTAAYHPFKDSGTWLDCWGQATAK
Ga0192961_1018248313300018980MarineIKVDPDAVLLAWRLRDHMKPYTGQKVYVVNCNKFPSSPNFPMMYGALEIFSHAAMDTYAYNSWKCGQELDWKAWGEDYFMTHCMDFIGVGRIGDFGVLGDNVCTGANCGDGWTAAYHPFKDIGVWKECWGMATVK
Ga0192961_1024543013300018980MarineGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLIPWRLRDKMAPHIGENVYVVDCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWQCGQQLPWDAWGEDYYLTHCLDLLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAGR
Ga0192961_1025684713300018980MarineGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLIPWRLRDKMAPHIGENVYVVDCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWQCGQQLPWDAWGEDYYLTHCLDLLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNSAGR
Ga0192968_1013740313300018981MarineCDGYNVYAARASTLGTSRDGIEVKAVLIPDIKVGKSQDGTAGNAKLFMALWDAVIAGGRFTNYDWTIKVDADAVMLPWRVRDHMRPHVGEKVYVVNCNKYPDSPNFPMMYGSMEIFSQPAMRAYAKDSWKCGKELPWAQWGEDYFMTKCMDYVGVDRIADFGVIGDNVCTGANCADSYTGAFHPFKTVDTWQECWETANAADPANAANH
Ga0193518_1026867413300018992MarineGIFACDGYDIFANTDVTLGKSKDDIVVKSIKIPTIAVGRSQDGTAGNAKLFMAVWDKVIAGNRFRNYDFTIKADPDAVLIAWKIRDHMSSHVGQKAYVVNCNKVPGSPNFPMMFGAVEVFSRPAMDAYAAGSWKCGQQLPWGSWGEDYYMTHCMDFLGVGRIADFGVLGDNVCTGANCMDQGVASFHPFKTVDSWKACWWKATKR
Ga0193257_1011941213300018997MarineSKDGVLVKTLTIDKIDVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVVIPWRLRDKMAPHIGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIMYADGSWKCGQQLPWDAWGEDYYLTHCLDFLGVGRISDFTVVGDNVCTGADCGDGDKGSYHPFKSPEDWEACWNQAVPPA
Ga0193444_1009566413300018998MarineFWDKIIAGKRFRDYDWTIKADPDAVVIAWRLRDKMAPHIGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDMLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAAR
Ga0192953_1010973613300019000MarineFDVFAAEDANLGTTEDGIEVKAILTENIDVGVSQDGTAGNAKLFMAMWDKVIAGKRYSYYDWTIKVDPDAVLLAWRVREHLQEHTGSDAYVVNCNKFPDSPNFPMMYGAVEAFSHKAMTAYAAKSIKCGQELPWKEWGEDYYMTHCLDYIGVGRVEDLSLLGDNMCIGANCKDGSMASYHPFKSITEWNSCWTDANA
Ga0193361_1014858923300019008MarineGNRFRNYDFTIKADPDAVLIAWKIRNHMISHVDQNAYVVNCNKVPGSPNFPMMFGAVEVFSRPAMAAYAAGSWKCGQQLPWGSWGEDYYMTHCMDFLGVGRIADFGVLGDNVCTGANCMDQGVASFHPFKSVDAWQQCWGQATAPR
Ga0192926_1024021913300019011MarineQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVVIAWRLRDKMAPHIGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDMLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAAR
Ga0192926_1041966513300019011MarineQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVVIAWRLRDKMAPHIGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDMLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNSAAR
Ga0193043_1030151813300019012MarineIIVAGKRFRDYDWTIKADPDAVLVPWRLRDHMRPHVGENVYVVNCNKFPSSPNFPMMFGSVEIFSSAAMIAYADGSWKCGQDLPWAGWGEDYYMTHCLDYLGVGRISDFTVVGDNVCTGANCLDGGVASFHPMKTVEDWKKCWQQAVPA
Ga0193557_1015618313300019013MarineDIFANTDVTLGKSKDDIVVESIKIPTIAVGRSQDGTAGNAKLFMAVWDKVIAGNRFRNYDFTIKADPDAVLIAWKIRNHMSAHVGQNAYVVNCNKVPGSPNFPMMFGAVEVFSRPAMAAYAAGSWKCGQQLPWGAWGEDYYMTHCMDFLGVGRIADFGVLGDNVCTGANCMDQGVASFHPFKSVDAWQQCWGQATAPR
Ga0193557_1022606313300019013MarineRSQDGTAGNAKLFMAVWDKVIAGNRFRNYDFTIKADPDAVLIAWKIRDHMSSHVGQKAYVVNCNKVPGSPNFPMMFGAVEVFSRPAMDAYAAGSWKCGQQLPWGSWGEDYYMTHCMDFLGVGRIADFGVLGDNVCTGANCMDQGVASFHPFKTVDSWKACWWKATKR
Ga0193557_1028348813300019013MarineRSQDGTAGNAKLFMAVWDKVIAGNRFRNYDFTIKADPDAVLIAWKIRDHMSSHVGQKAYVVNCNKVPGSPNFPMMFGAVEVFSRPAMDAYAAGSWKCGQQLPWGSWGEDYYMTHCMDFLGVGRIADFGVLGDNVCTGANCMDQGVASFHPFKTVDSWKACFWKATKR
Ga0193569_1036610913300019017MarineTAGNAKLFMAVWDKVIAGGRFRNYDFTIKVDPDAVLIPWRIRDHMKAHVGSNAYVVNCNKFPNSPNFPMMFGAVEIFSNKAMIAYAEGSWKCGTQLPWGSWGEDYYMTHCLDFLGVGRIADFGVLGDNVCTGANCKDSYTGSFHPFKDIGAWFQCWTAATVPPVIAPPPAAPGTA
Ga0192982_1018299423300019021MarineGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVVIAWRLRDKMRPHIGENVYVVNCNKIPGSPNFPMMFGSVEIFSSAAMIAYSDGSWKCGQQLPWKGWGEDYYMTHCLDFLGVGRVNDFTVVGDNVCSGSDCGDGDKGSYHPFKTVDAWKKCWDAAAR
Ga0192951_1040534013300019022MarineDGTAGNAKLFMALWDAVIAGGRFTNYDWTIKVDADAVMLPWRVRDHMRPHVGEKVYVVNCNKYPDSPNFPMMYGSMEIFSQPAMRAYAKDSWKCGKELPWAQWGEDYFMTKCMDYVGVDRIADFGVIGDNVCTGANCADSYTGAFHPFKTVDTWQECWETANAADPANAAN
Ga0193561_1025985713300019023MarineVKSVKIPTISVGVSQDGTAGNAKLFMAVWDKVIAGNRFRNYDFTIKADPDAVLIAWKIRDHMSSHVGQKAYVVNCNKVPGSPNFPMMFGAVEVFSRPAMDAYAAGSWKCGQQLPWGSWGEDYYMTHCMDFLGVGRIADFGVLGDNVCTGANCMDQGVASFHPFKTVDSWKACWWKATKR
Ga0193175_1015915113300019029MarineVESLIIPKINVGLSQDGTAGNAKLFMAVWDKVIAGGRHQFYDWTVKADPDAVVLPWRLRSHMEAHVGEHVYVVNCNKVPNSPNFPMMFGAVEVFSQSAMMAYAANSWKCGKQLPWKMWGEDYYMTHCMDYVGVGRIADFGVVGDNMCTGAHCEDQSIASFHPFKTVSSWNECWDTANGHPPAPPTKEMTFKQQK
Ga0192875_1007819023300019035MarineGVSQDGTAGNAKLFMAMWDKIIAGKRFRDYDWTIKADPDAVVIPWRVRDHMRPVVGQSVYVVNCNAFPGSPNFPMMYGSVEIFSSLAMIAYAAGSWKCGQELPWGSWGEDYYMTHCLDYLGVGRINDFGVVGDNVCTGASCKDGQGAFHPYKTTDDWKKCWHDAVPE
Ga0192875_1017073613300019035MarineAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVMLPWRVREHMLPHVGKKVYVVNCNKFPDSPNFPMMYGSLEIFSGPAMAAYAENSWHCGKELPWAAWGEDYFMTKCMDYVGVKRVSDFGVIGDDVCTGANCADSYTGAFHPFKDVASWHKCWDTATGTDIP
Ga0192945_1025212513300019036MarineYDWTIKVDADAVMLPWRVRDHMRPHVGENVYVVNCNKYPDSPNFPMMYGSMEIFSQPAMKAYAKNSWKCGKELPWKAWGEDYFMTKCMDYVGVNRIADFGVIGDNVCTGANCADTYTGAFHPFKSVETWRECWETATATNQ
Ga0192857_1021324313300019040MarineIAGGRFRYYDWTVKVDPDAVLLAWRLREHMKPHTGEKVYVVNCNKFPSSPNFPMMYGALEIFSHAAMDEYAWNSWRCGQELDWKAWGEDYFMTHCMDYIGVGRIGDFGVLGDNVCTGANCQDGWTAAYHPFKTIGTWQECWGVATAPSPEE
Ga0192857_1031476413300019040MarineGTNALVKTRLIEKIEVGVSQDGTAGNAKLFMAFWDAIIAGKRFRDYDFTIKVDPDAVIIPWRIRDHMRSHVGENVYVVNCNKYPSSPNFPMMYGSIEIFTSAAMIAYASGSWRCGTELDWGGWGEDYYMTHCLDYLGVGRISDFTVVGDNVCTGANCADGAYASFHPFKSPDEWAGCW
Ga0193082_1035612613300019049MarineDGILVKAVLIPKIAVGVSQDGTAGNAKLFMAVWDKVIAGNRFRYYDFTIKVDPDAVIVPWRIRTHMMPHIGANAYVVNCNKFPGSPNFPMMFGSIEIFTHQAMIAYAMGSWKCGSKLPWGSWGEDYYMTHCLDFLGVGRINDFGVVGDQVCTGANCADTFVAAFHPFKNNAAWFKCWDTAVR
Ga0193356_1016184813300019053MarineHGEKIDVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVVIPWRLRSKMASHIGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDMLGVGRIEDFSVTGDNVCTGADCGDGDKGSYHPFKTPEDWEACWIQAVPPA
Ga0193356_1026576113300019053MarineWDKIIAGGRFRYYDWTVKVDPDAVLLAWRLREHMKPHTGEKVYVVNCNKFPDSPNFPMMYGALEIFSHAAMDTYAMNSWRCGQELDWKAWGEDYFMTHCMDYIGVGRIGDFGVLGDNVCTGANCADGWTAAYHPFKTEDTWQECWGVATR
Ga0193356_1030103813300019053MarineTLGTSRDGIEVKAVLIPDIKVGKSQDGTAGNAKLFMAVWDAVIAGGRFTNYDWTIKVDADAVMLPWRVRDHMRPHVGEKVYVVNCNKYPDSPNFPMMYGSMEIFSQPAMRAYAKDSWKCGKELPWAQWGEDYFMTKCMDYVGVDRIADFGVIGDNVCTGANCADSYTGAFHPFKTVDTWGECWETANA
Ga0193102_103030513300019099MarineKVIAGGRFRNYDWTIKVDADAVMLPWRVRDHMRSHVGEKVYVVNCNKYPDSPNFPMMYGSMEIFSQPAMLAYAKNSWKCGKELPWRDWGEDFYMTKCMDYVGVSRISDFGVIGDNVCTGANCADTYTGAFHPFKSVETWRECWETATKDGK
Ga0193106_100912713300019112MarineDIKVGKSQDGTAGNAKLFMAVWDAVIAGGRFTNYDWTIKVDADAVMLPWRVRDHMRPHVGEKVYIVNCNKYPDSPNFPMMYGSMEIFSQPAMRAYAKDSWRCGKELPWAQWGEDYFMTKCMDYVGVDRIADFGVIGDNVCTGANCADSYTGAFHPFKTVDTWRECWETANAADPANAANH
Ga0193256_104735513300019120MarineDKVIAGGRFRNYDWTIKVDADAVMLPWRVRDHMREHTGKKVYVVNCNKYPDSPNFPMMYGSMEIFSHPAMLAYAEQSWKCGKELPWAPWGEDYFMTKCMDYVGVGRISDFGVIGDNVCTGANCGDTYTGAFHPFKSIGSWSKCWTQATATGL
Ga0193256_108089613300019120MarineWDKIIAGGRFRYYDWTVKVDPDAVLLAWRLRDHMRPFTGQKVYVVNCNKFPDSPNFPMMYGALEIFSHSAMDEYAAQSWRCGTELDWKAWGEDYFMTHCMDHIGVGRIGDFGVLGDNVCTGANCGDGWTAAYHPFKTIGTWVDCWGSATAAQ
Ga0193047_106465813300019139MarineAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLIAWRLRDKMAPHIGENVYVVNCNKYPSSPNFPMMFGSVEILSSGAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDLLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAAR
Ga0193047_107756413300019139MarineSQDGTAGNAKLFMAVWDKILAGGRFHNYDWTIKVDPDAVLVPWRIRDHMRGHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYALNSWKCGKQLPWGSWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKNVGVWMECWKKTVR
Ga0193047_107766913300019139MarineAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLIAWRLRDKMAPHIGENVYVVNCNKYPSSPNFPMMFGSVEILSSAAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDLLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAAR
Ga0193047_110940813300019139MarineGNAKLFMAMWDKIIAGKRFRDYDWTIKADPDAVLIPWRLRDHMRPVVGQSVYVVNCNAFPGSPNFPMMYGSVEIFSSLAMIAYADGSWRCGQELPWGSWGEDYYMTHCLDYLGVGRINDFGVVGDNVCTGASCSDGQGSFHPYKTTEDWKKCWQQAVPDK
Ga0193047_113110713300019139MarineKRFRDHDWTIKADPDAVLIPWRLRDHMRPHVGENVYVVNCNAFPGSPNFPMMYGSVEIFSSAAMIAYASGSWKCGQELPWGSWGEDYYMTHCLDFLAVGRLNDFGAVGDNVCTGASCADGQGAFHPYKTVDAWKKCWQMAGGQ
Ga0192975_1020429913300019153MarineSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDADAVMLPWRVREHMRPHVGKKVYVVNCNKYPNSPNFPMMYGSMEIFSGPAMAVYAAKSVLCGKELPWALWGEDYFMTKCMDYIGVNRIADFGVIADNVCTGANCADTYTGAFHPFKSKEAWKQCWLTATQQKDQSMMAFKK
Ga0192975_1028807513300019153MarineWDKINAGGRFRYYDWTVKVDPDAVLLAWRLRDHMRPVTGQKVYVVNCNKFPDSPNFPMMYGALEIFSHSAMDTYAEQSWRCGTELGWKAWGEDYYMTHCMDHIGVGRIGDFGVLGDNVCTGATCGDGWTAAYHPFKTIGTWSECWGTATAQPAQ
Ga0063872_110699813300021932MarineVGTSKDGILVKTMVIPKISVGVSQDGTAGNAKLFMAMWDKVIAGKRFRDYDWTIKADPDAVLIPWRLRDHMYPHIGKNIYVVNCNAFPGSPNFPMMYGSVEIFSSAAMIAYAAGSWKCGQQLPWKQWGEDYYMTHCLDFLGVSRINDFSVVGDNVCTGSTCADGQASFH
Ga0307402_1036966113300030653MarineKSQDGTAGNAKLFMAVWDKVIAAGRFRNFDWTIKVDADAVMLPWRVRDHMRPHTGERVYVVNCNKYPDSPNFPMMYGSMEIFSGPAMDSYAKSSWKCGKDLPWAAWGEDYFMTKCMDYVGVNRIADFGVIGDNVCTGANCGDTYTGAFHPFKTVKKWRECWEEATSTGL
Ga0307402_1070405013300030653MarineAGNAKLFMAVWDKVISGGRFRYYDWTLKVDPDAVLLAWRVRDHLSWATGQSIYVVNCNKFPSSPNFPMMYGALEVFSNPAMITYAYNSWKCGQDLPWGSWGEDYFMTHCMDYIGVGRISDFGILGDNMCVGANCGDGWTAAYHPFKTIEDWQVRWGWGFSLLYATRAAEHDLRAVQRHRGLQMIMMTRILIRSRR
Ga0307401_1038487413300030670MarinePNTVGTSKDGILVEAILIPKIKVGKSQDGTAGNAKLFMAVWDKVIAAGRFRNFDWTIKVDADAVMLPWRVRDHMRPHTGERVYVVNCNKYPDSPNFPMMYGSMEIFSGPAMDSYAKSSWKCGKDLPWAAWGEDYFMTKCMDYVGVNRIADFGVIGDNVCTGANCGDTYTGAFHPFKTVKKWRECWEEATSTGL
Ga0307403_1050427813300030671MarineLIPKIKVGKSQDGTAGNAKLFMAVWDKVIAAGRFRNFDWTIKVDADAVMLPWRVRDHMRPHTGERVYVVNCNKYPDSPNFPMMYGSMEIFSGPAMDSYAKSSWKCGKDLPWAAWGEDYFMTKCMDYVGVNRIADFGVIGDNVCTGANCGDTYTGAFHPFKTVKKWRECWEEATSTGL
Ga0307403_1056748713300030671MarineAEEANLGVSKDDIEVKAILIPKISVGVSQDNTAGNAKLFMAVWDKVIAGGRYRNYDWTIKVDPDAVLVAWRVRDHLKPHVGENVYVVNCNKFPGSPNFPMMYGAVEVFSSAAMLHYAETSWKCGTQLPWKSWGEDYYMTHCMDFVGVGRISDFGILGDNMCTGANCADVGVSSFHPFKTEASWMECWTKATAPPAAAPALPR
Ga0307398_1061931013300030699MarineMAVKIFRNYDFTIKADPDAVLLAWRLRDKMRPHIGENIYVVNCNKFPSSPNFPMMFGSVEIFSMQAMYAYAGGSWRCGQDLPWGGWGEDYFMTHCFDYLGVGRINDFTVVGDNVCTGANCGDGSQGSYHPFKTVEDWKGCWNLAGR
Ga0307398_1078692613300030699MarineKLFMAVWDKIIAGGRFRYYDWTVKVDPDAVLLAWRLRDHMKPYTGQKIYVVNCNKFPSSPNFPMMYGALEIFSHAAMDTYAYNSWKCGQELDWKAWGEDYFMTHCMDFIGVGRIGDFGVLGDNVCTGANCGDGWTAAYHPFKDIGVWKECWGMATAE
Ga0307400_1096447113300030709MarineAGGRFRNYDWTIKVDPDAVLVAWRIRDHMQQHNGMNVYVVNCNKFPSSPNFPMMYGAVEIFSQKAMTSYAMSSWKCGKQLPWKGWGEDYYMTHCLDFIGVGRIGDFGVLGDNMCTGANCKDSYTASFHPFKDTNSWMQCWGQATMPAPAPTIVVRK
Ga0073969_1129920413300030749MarineMAMWDKVLKYKRYEYYDWTIKVDPDAVLLAWRMRNHLAPHTGGNAYVVNCNKFPGSPNFPMMYGAVEVFSHEAMKAYAKDSWKCGQDLPWGGWGEDYYMTHCLDYIGVGRIEDFKSLGDNMCVGADCSDIGTASFHPFKSPSDWNKCWARATLSGA
Ga0073967_1172227513300030750MarineDKVIAGNRFRYYDFTIKADPDAVLIAWRVRTHMLPHVGKNAYVVNCNKFPGSPNFPMMYGAVEIFTNAAMISYAMGSWKCGTKLPWGGWGEDYYMTHCLDFLGVGRVADFGVVGDNVCTGANCLDKYVGSFHPFKDEGAWFKCWNQATGL
Ga0073967_1199056413300030750MarineDTLGVSQDGVEVKAVLIPKITVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNFDWTIKVDPDAVIVPWRIRDHMRPHVGQKVYVVNCNKFPGSPNFPMMYGALEVFSQSAMVQYAQDSWRCGKQLPWGSWGEDYYMTHCMDFIGVGRIGDFGVLGDNMCTGANCADGGIASFHPFKNEGAWMQCWDQARGGAPKPGMPVVV
Ga0073967_1204600113300030750MarineFMAMWDKIIAGKRFRDYDWTIKADPDAVVIPWRVRDHMRPVVGQSVYVVNCNAFPGSPNFPMMYGSVEIFSSLAMIAYADGSWKCGQELPWGSWGEDYYMTHCLDYLGVGRINDFGVVGDNVCTGASCKDGQGAFHPYKTTEDWKKCWHDAVPE
Ga0073965_1178278113300030787MarineVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNFDWTIKVDPDAVIVPWRIRDHMRPHVGQKVYVVNCNKFPGSPNFPMMYGALEVFSQSAMVQYAQDSWRCGKQLPWGSWGEDYYMTHCMDFIGVGRIGDFGVLGDNMCTGANCADGGIASFHPFKNEGAWMQCWDQARGGAPKPGMPVVV
Ga0073970_1135361813300030919MarineGTAGNAKLFMAMWDKVIAGKRFRDFDWTIKADPDAVLIAWRLRDHMRAHVGENVYVVNCNAFPGSPNFPMMYGSVEIFSSAAMIAYAAGSWKCGQQLPWKQWGEDYYMTHCLDFLGVSRINDFGVVGDNVCTGSTCADGQASFHPYKTEKAWKECWEQAVPPGTYNP
Ga0073961_1175099913300031063MarineSKDGILVKSLVIPTISVGVSQDGTAGNAKLFMAMWDKVIAGKRFRDFDWTIKADPDAVLIAWRLRDHMRAHVGENVYVVNCNAFPGSPNFPMMYGSVEIFSSAAMIAYAAGSWKCGQQLPWKQWGEDYYMTHCLDFLGVGRINDFGVVGDNVCTGGSCSDQYFSAFHPFKDAASWQECWDEAHGKAPPPTE
Ga0307388_1048617813300031522MarineSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLVPWRIRDHMQQHNGQNLYVVNCNKVPGSPNFPMMFGAVEIFSQKAMISYALSSWKCGKQLPWKLWGEDYYMTHCMDFIGVGRIGDFGVLGDNMCSGANCKDSFVASFHPFKDTNSWMQCWGQATMPAPAPAPTIVIRK
Ga0307388_1066931813300031522MarineQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLISWRIRDHMEQHNGQNLYVVNCNKVPGSPNFPMMFGAVEIFSQQAMISYALSSWKCGKQLPWHLWGEDYYMTHCMDFIGVGRIGDFGVLGDNMCSGANCKDSYTASFHPFKDTESWMQCWGQATIPAPAPAPTIVIRK
Ga0307388_1075727023300031522MarineVLIPDIKVGKSQDGTAGNAKLFMAVWDKVIASGRFENYDWTIKVDADAVMLPWRVRDHMRPHVGEKVYVVNCNKYPDSPNFPMMYGSMEIFSQPAMVAYAANSGKCGTELDWKPWGEDYYMTKCMDYVGVGRIADFGVIGDNVCTGANCGDTYTGAFHPFKTVETWQECWTMATSSGQ
Ga0307388_1078715823300031522MarineLFMAVWDKVIAGGRFRNYDWTIKVDADAVMLPWRVRDHMRPHVGEKVYVVNCNKYADSPNFPMMYGSMEIFSQPAMAAYAESSWKCGKELPWAKWGEDYFMTKCMDYVGVDRIADFGVIGDNVCTGANCADSYTGAFHPFKSIETWKECWTTATANERK
Ga0307388_1090449713300031522MarineIFACDGYDIFAAEPSTLGVSSDGILVKAVIIPKVKVGRSQDGTAANAKLFMAVWDKIIAAGRFRNYDWTIKVDADAVMLPWRVRDHMLPHVGEKVYVVNCNKYPDSPNFPMMYGSMEIFSQPAMDAYAKSSWKCGKELPWAEWGEDYFMTKCMDYVGVNRIADFGVIGDNVCTGANCADSYTGAFHPFKSIETWKEC
Ga0307388_1098248413300031522MarineTIEKVEVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVVIAWRLRDKMAPHVGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWQCGQQLPWDAWGEDYYLTHCLDLLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAGR
Ga0307388_1105893013300031522MarineTIEKVEVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVVIAWRLREKMAPHIGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWTCGQQLPWDAWGEDYYLTHCLDMLGVGRISDFTVVGDNVCTGANCGDGDKGSYHPFKTPADWEACWIQAVPPR
Ga0307388_1110604113300031522MarineGNAKLFINCWNVIVQDGRWNNHAWTVKADPDAVLLPDRLRVHLSDHVLENVYVVNCNKFPSSPNFPMMFGSVEIFSSAAMIAYADGSWKCGQELPWDSWGEDYYMTHCLDYLGVGRISEFTIVGDNVCTGANCLDAYVASFHPFKTPEDWQKCWEQAVPPGT
Ga0307388_1111536413300031522MarineIPKIDVGVSQDGTAGNAKLFMALWDEIIAVKRFRNYDFTIKADPDAVLLAWRLRDKMRPHIGENIYVVNCNKFPSSPNFPMMFGSVEIFSMQAMYAYAGGSWRCGQDLPWGGWGEDYFMTHCFDYLGVGRINDFTVVGDNVCTGANCGDGSQGSYHPFKTVEDWKGCWNLAGR
Ga0307388_1121468813300031522MarineQIEVGVSQDGTAGNAKLFMAFWDRIISDKRFRDYDWTIKADPDAVVVAWRLRDKMAPHIGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYAAGSTRCGTELPWESWGEDYYLTHCLDYLGVGRIEDFTVVGDNVCTGADCGDGQMGSYHPFKTPEDWEACWNQV
Ga0307386_1062899413300031710MarineIIAGKRFRDYDWTIKADPDAVLIAWRLRDKMAPHIGENVYVVNCNKYPSSPNFPMMFGSVEILSSAAMIAYADGSWQCGQQLPWDAWGEDYYLTHCLDLLGVGRISDFTVVGDNVCTGADCADGSSGSYHPFKTPEDWEGCWNAAGR
Ga0307397_1059843813300031734MarineFRNYDWTIKVDPDAVLVAWRIRDHMQQHNGQNVYVVNCNKFPNSPNFPMMYGAVEIFSQKAMTSYAMSSWKCGKQLPWKGWGEDYYMTHCLDFIGVGRIGDFGVLGDNMCTGANCKDSYTASFHPFKDTNSWMQCWGQATMPAPTAVVLK
Ga0307387_1079865713300031737MarineSQDGTAGNAKLFMALWDKIIAVKRFRNYDFTIKADPDAVLIPWRLRDKMRPHIGENIYVVNCNKFPSSPNFPMMFGSVEIFSMQAMYAYAGGSWKCGQELPWGGWGEDYYMTHCFDYLGVGRINDFTVVGDNVCTGANCGDGGQGSYHPFKTVEDWKGCWNLAQR
Ga0307387_1084202213300031737MarineEVGVAQDGTAGNAKLFMAVWDKIIAAGRFRYYDWTVKVDPDAVLLAWRLREHLEPHVGEKVYVVNCNKFPSSPNFPMMYGALEIFSHSAMDQYAAQSWKCGQELNWKAWGEDYYMTHCMDYIGVGRIGDFGVLGDNVCTGANCADGWTAAYHPFKDEGTWLDCWGEDTAKGH
Ga0307387_1092452913300031737MarineKIIEARRFRNYDWTLKVDPDAVMLPWRVRKHMAQHVGKTAYVVNCNKVPESPNFPMMFGSVEMFSQPAMVAYAKKSERCSKELQWELWGEDFFMTKCMDHIGVDRVEDFDSIGDDVCLGASCGDLAKAAFHPFKNVESWNECWSIATSLQ
Ga0307387_1097988013300031737MarineSKDGILVKTLTIPKIAVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVVIAWRLRDKMRPHIGENVYVVNCNKIPGSPNFPMMFGSVEIFSSAAMIAYSDGSWKCGQQLPWKGWGEDYYMTHCLDFLGVGRVNDFSVVGDNVCSGADCGDGDKGSYHPFKTVGDWKKCW
Ga0307387_1111797013300031737MarineDWTIKVDPDAVLIPWRVRDHLKPHVGEKVYVVNCNKFPGSPNFPMMYGAVEVFSQAAMVEYALNSWKCGSQLPWKSWGEDYFMTHCMDFVGVGRISDFGILGDGMCTGANCADGGIASFHPFKSVGVWMQCWGHATMPATPPPS
Ga0307383_1065920813300031739MarineGILVKTVTIEKIEVGVSQDGTAGNAKLFMAFWDKIIAGKRFRDYDWTIKADPDAVLLPWRLRSKMAAHLGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWKCGQQLPWDAWGEDYYLTHCLDLLGVGRLNDFTVVGDNVCTGANCGDGDKGSYHPFKTPEDWEACWI
Ga0307395_1030564013300031742MarineSQDGTAGNAKLFMAVWDKIIAGGRFRYYDWTVKVDPDAVLLAWRLRDHMKPYTGQKVYVVNCNKFPSSPNFPMMYGALEIFSHAAMDTYAYNSWKCGQELDWKAWGEDYFMTHCMDFIGVGRIGDFGVLGDNVCTGANCGDGWTAAYHPFKDIGVWKECWGMATAE
Ga0307395_1039262813300031742MarineAVWDKVIAGGRYRNYDWTIKVDPDAVLVSWRIRDHLKPHVGENVYVVNCNKFPGSPNFPMMYGAVEVFSSAAMLHYAETSWKCGTQLPWKSWGEDYYMTHCMDFVGVGRISDFGILGDNMCTGANCADVGVSSFHPFKTEASWMECWTKATAPPAAAPALPR
Ga0307382_1055003213300031743MarineHAWVIKVDPDAVIIPDRVRDHLRDHILENVYVVNCNKFPSSPNFPMMFGSVEIFSMQAMYAYAGGSWRCGQDLPWGGWGEDYFMTHCFDYLGVGRINDFTVVGDNVCTGANCGDGSQGSYHPFKTVEDWKGCWKMALR
Ga0307389_1074786413300031750MarineAKLFMAFWDKVIAGKRFRDYDWTIKADPDAVVIAWRLREKMAPHIGENVYVVNCNKFPSSPNFPMMFGSVEILSSAAMIAYADGSWTCGQQLPWDAWGEDYYLTHCLDLLGVGRISDFTVVGDEVCTGADCADGSSGSYHPFKTPDDWEGCWNAAGR
Ga0307389_1083280013300031750MarineNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLISWRIRDHMEQHNGQNLYVVNCNKVPGSPNFPMMFGAVEIFSQQAMISYALSSWKCGKQLPWHLWGEDYYMTHCMDFIGVGRIGDFGVLGDNMCSGANCKDSYTASFHPFKDTESWMQCWGQATIPAPAPAPTIVIRK
Ga0307389_1088922013300031750MarineIPKISVGVSQDGTAGNAKLFMAVWDKVIAGGRFRAYDWTIKVDPDAVLVSWRIRAHVKPHTGQRLYVVNRNKVPGSPNFPMMFGAVEVFSQKAMIQYALSSWKCGQQLPWKPWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCKDSYTASFHPFKDTESWMQCWGQATMPAPAPKVVVRK
Ga0307389_1100294613300031750MarineAGIFNCDGYEVFAAEPCSLGTSQDGIEVQAVLIPKIKVGKSQDGTAGNAKLFMAVWDKVIASGRFHYYDWTAKVDPDAVLIAWRLREHMLPHTGKNVYVVNCNKYPDSPNFPMMYGSLELFSHAAMESYSRSSGDCGKNLPWHKWGEDYYMTHCLDYIGVGRVGDYTVIADQVCLGAGACEDLK
Ga0307404_1033846313300031752MarineGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLVPWRIRDHMQQHNGQNVYVVNCNKFPGSPNFPMMYGAVEVFSSAAMLHYAETSWKCGTQLPWKSWGEDYYMTHCMDFVGVGRISDFGILGDNMCTGANCADVGVSSFHPFKTEASWMECWTKATAPPAAAPALPR
Ga0314684_1042867213300032463SeawaterGYTLLSNGVISLGKVLNGTEEVFTVKIETPPVGVSQDGTASNTLLFMKAWDEIIRQQRFRDYDWTLKVDPDAVLIADRMRDHMRPHNGENVYVVNCNKVPGSPNFPMMFGAVEVFSNKAMDAYAAGSGKCGKDFWPAWEAWGEDYYMTHCLDHLGVGRIADFGVLGDNMCTGANCQDGYVAAFHPFKQWPQWSECWNTANGR
Ga0314684_1063193913300032463SeawaterVGLSQDGTAGNAKLFMAMWDKVISGGRHRDYDWTIKVDPDAVIIPWRVRNHMRQHTGENVYVVNCNKFPDSPNFPMMYGAVEIFSNKAMIAYAWGSWRCGRELDWKPWGEDYYMTHCLDFLGVGRVGDFGVLGDNLCTGANCADTYTASFHPFKELGTWMQCWGKATAPPS
Ga0314676_1059372513300032519SeawaterDKVIAGGRFRNYDWTIKVDPDAVLVPWRIRDHMRSHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGKATAPPPEPVAAPAR
Ga0314667_1073246913300032520SeawaterPILIPKITVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVVIPWRLRDHLKPHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYALNSWKCGKQLPWASWGEDYYMTHCMDFVGVGRIGDFGILGDQLCTGANCADGGIASFHPFKNIGVWMQCWGKATAPPPK
Ga0314680_1049593013300032521SeawaterDKVIAGNRFRDYDFTLKVDPDAVLVPWRTRQHMSAHVGSNAYVVNCNKFPGSPNFPMMYGAVEIFSNLAMSAYAAGSWKCGQKLPWGSWGEDYYMTHCLDFLGVGRISDFGVLGDALCTGANCMDGYTAAFHPFKQIGTWMQCWGQATAPPKAPAAPAAR
Ga0314680_1100974113300032521SeawaterVIAGGRFRNYDWTIKVDPDAVIIPWRIRTHMKPHIGKNAYVVNCNKFPGSPNFPMMFGAVEIFSHQAMIAYAMGSWKCGQQLPWKAWGEDYYMTHCLDFLGVGRIADFGVLGDNVCTGANCKDTYTGSFHPFTDTGTWFKCWTDATGGR
Ga0314680_1103617213300032521SeawaterKDGVEVKAVQIPKISVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVILPWRVRDHMRPQVGQKVYVVNCNKFPNSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFK
Ga0314677_1028941313300032522SeawaterSKDGIQVKAILIPKIAVGVSQDGTAGNAKLFMAVWDKIIAGGRFRNYDWTIKVDPDAVLVPWKIRDHLRGHLGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYALNSWKCGKQLPWGSWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKNVGVWMKCWGQAIGKPAAVPPPPPR
Ga0314677_1073246813300032522SeawaterIKVDPDAVIIPWRIRTHMKPHIGKNAYVVNCNKFPGSPNFPMMFGAVEIFSHQAMIAYAMGSWKCGQQLPWKAWGEDYYMTHCLDFLGVGRIADFGVLGDNVCTGANCKDTYTGSFHPFKDKGTWFKCWTDATGGR
Ga0314671_1066588913300032616SeawaterQCDGYDVFAAENSTLGTSKDGILVKAVLIPKIAVGVSQDGTAGNAKLFMAVWDKVIAGNRFRYYDFTIKVDPDAVIIPWRIRSHMLPHIGKNVYVVNCNKVPGSPNFPMMFGSIEVFTHAAMMAYAVGSWKCGTQLPWGSWGEDYYMTHCLDFLGVGRINDFGIVGDAVCTGANCADGFIASFHPF
Ga0314685_1064237013300032651SeawaterSKDGVDVKAVQIPKISVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVILPWRIRDHMRSHEGQKVYVVNCNKFPNSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGKATAPPPKPGA
Ga0314687_1061287113300032707SeawaterSVGVSQDGTAGNAKLFMALWDKVIAGGRFRNYDWTIKVDPDAVIIPWRIRTHMKPHIGKNAYVVNCNKFPGSPNFPMMFGAVEIFSHQAMIAYAMGSWKCGQQLPWKAWGEDYYMTHCLDFLGVGRIADFGVLGDNVCTGANCKDTYTGSFHPFKDKGTWFKCWTDATGGR
Ga0314687_1062304913300032707SeawaterYDWTIKVDPDAVLVPWRIRDHMRSHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGKATAPPPEPVAAPAR
Ga0314669_1031366613300032708SeawaterRWASRRTALRATRSSSWQWDKVIAGNRFRDYDFTLKVDPDAVLVPWRIRQHMSAHVGSNAYVVNCNKFPGSPNFPMMYGAVEIFSNLAMSAYATGSWKCGQKLPWGSWGEDYYMTHCLDFLGVGRISDFGVLGDALCTGANCMDGYTAAFHPFKQIGTWMQCWGQATAPPKAPAAPAAR
Ga0314669_1040016413300032708SeawaterLVKAVLIPKIAVGVSQDGTAGNAKLFMAVWDKVIAGNRFRYYDFTIKVDPDAVIIPWRIRSHMLPHIGKNVYVVNCNKVPGSPNFPMMFGSIEVFTHAAMMAYAVGSWKCGTQLPWGSWGEDYYMTHCLDFLGVGRINDFGIVGDAVCTGANCADGFIASFHPFKTMDSWFKCWDTAVR
Ga0314681_1065281513300032711SeawaterDPDAVLVPWRIRDHMRSHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGKATAPPPEPVAAPAR
Ga0314690_1032821813300032713SeawaterFMAVWDKIIAGGRFRNYDWTIKVDPDAVLVPWKIRDHLRGHLGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYALNSWKCGKQLPWGSWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKNVGVWMKCWGQAIGKPAAVPPPPPR
Ga0314690_1058406113300032713SeawaterYDFTLKVDPDAVLVPWRIRQHMSAHVGSNAYVVNCNKFPGSPNFPMMYGAVEIFSNLAMSAYAAGSWKCGQKLPWGSWGEDYYMTHCLDFLGVGRISDFGVLGDALCTGANCEDGYTGAFHPFKDIGTWMQCWGKATAPPGAPGAPAAR
Ga0314690_1065746113300032713SeawaterRNYDWTIKVDPDAVILPWRIRDHMRSHEGQKVYVVNCNKFPNSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGQATTPPKPAAYV
Ga0314697_1048259913300032729SeawaterDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLVPWRIRDHMRPHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGKATAPPPKPAAAPAR
Ga0314699_1046417213300032730SeawaterKVIAGNRFRDYDFTLKVDPDAVLVPWRTRQHMSAHVGSNAYVVNCNKFPGSPNFPMMYGAVEIFSNLAMSAYAAGSWKCGQKLPWGSWGEDYYMTHCLDFLGVGRISDFGVLGDALCTGANCMDWYTAAFHPFKQIGTWMQCWGQATAPPKAPAAPAAR
Ga0314710_1041324513300032742SeawaterYDFTLKVDPDAVLVPWRIRQHMSAHVGSNAYVVNCNKFPGSPNFPMMYGAVEIFSNLAMSAYAAGSWKCGKQLPWASWGEDYYMTHCLDFLGVGRISDFGVLGDALCTGANCMDGYTAAFHPFKQIGTWMQCWGQATAPPKAPAAPAAR
Ga0314707_1043171213300032743SeawaterQDGTASNTLLFMKAWDEIIRQQRFRDYDWTLKVDPDAVLIADRMRDHMRPHNGENVYVVNCNKVPGSPNFPMMFGAVEVFSNKAMDAYAAGSGKCGKDFWPAWEAWGEDYYMTHCLDHLGVGRIADFGVLGDNMCTGANCQDGYVAAFHPFKQWPQWSECWNTANGR
Ga0314707_1068269913300032743SeawaterKTDKKDEVVTIESTKGIEVGVSQDGTAGNAKLFMKAWDTIIANGRFRDFDWTIKVDPDAVLIAWRVRDHMRAHVGESVYVVNCNKFPSSPNFPMMFGAVEVFSAAAMNAYAAGSWKCGQQLPWGSWGEDYYMTHCMDFLGVGRIGDFAILGDNMCTGANCADTFVASFHPFKDIG
Ga0314705_1046045913300032744SeawaterDTLGTSEDGIEVKAIQIPKISVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLVPWRIRDHMRSHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGKATAPPPKPGAAAPAR
Ga0314713_1037379613300032748SeawaterIFQCDGYDVFAAEPDTLGTSKDGVDVKAVQIPKISVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVILPWRIRDHMRSHEGQKVYVVNCNKFPNSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGQA
Ga0314708_1043496613300032750SeawaterGRFRNYDWTIKVDPDAVLVPWRIRDHMRSHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGKATAPPPEPVAAPAR
Ga0314694_1051858013300032751SeawaterDVFAAEPDTLGTSEDGIEVKAIQIPKISVGVSQDGTAGNAKLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLVPWRIRDHMRSHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGA
Ga0314700_1051302613300032752SeawaterLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLVPWRIRDHMRSHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGKATAPPPEPVAAPAR
Ga0314700_1063783413300032752SeawaterLFMAVWDKVIAGGRFRNYDWTIKVDPDAVLVPWRIRDHMRSHVGQKVYVVNCNKFPGSPNFPMMYGAVEVFSQSAMVQYAQNSWKCGKQLPWASWGEDYYMTHCMDFIGVGRIGDFGILGDNMCTGANCADGGIASFHPFKSEGLWMQCWGKATAPPPKPGAAAPAR
Ga0307390_1057365113300033572MarineKIKVGKSQDGTAGNAKLFMAVWDKVIAAGRFRNFDWTIKVDADAVMLPWRVRDHMRPHTGERVYVVNCNKYPDSPNFPMMYGSMEIFSGPAMDSYAKSSWKCGKDLPWAAWGEDYFMTKCMDYVGVNRIADFGVIGDNVCTGANCGDTYTGAFHPFKTVKKWRECWEEATSTGL
Ga0307390_1059634613300033572MarineSQDGTAGNAKLFMAVWDKVIAGGRFRYYDWTVKVDPDAVLLAWRLRDHMKPYTGQKIYVVNCNKFPSSPNFPMMYGALEIFSHAAMDTYAYNSWKCGQELDWKAWGEDYFMTHCMDFIGVGRIGDFGVLGDNVCTGANCGDGWTAAYHPFKDIGVWKECWGMATAE
Ga0307390_1092115913300033572MarineFMAVWDKVIAGGRFRNYDWTIKVDPDAVLIPWRIRDHMQQHNGGNLYVVNCNKVPGSPNFPMMFGAVEIFSQKAMISYALSSWKCGKQLPWKLWGEDYYMTHCMDFIGVGRIGDFGVLGDNMCSGANCKDSYTASFHPFKDTESWMQCWGQATIPAPAPAPTIVIRK
Ga0307390_1099353213300033572MarineGNAKLFMAVWDKIIAQGRFRYYDWTIKVDPDAVLLAWRVRDKLLDITGESVYVVNCNKFPDSPNFPMMYGAVEVFSNLAMDAYARNSWKCGQDLPWKSWGEDYYMTHCMDYVGVGRADDFGLLGDSLCLGADCKNTGMASFHPFKTAGAWLDCWGEATNSGM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.