Metagenome Family F040928

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F040928
Family Type	Metagenome
Number of Sequences	161
Average Sequence Length	42 residues
Representative Sequence	GLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK
Number of Associated Samples	139
Number of Associated Scaffolds	161

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.62 %
% of genes near scaffold ends (potentially truncated)	98.76 %
% of genes from short scaffolds (< 2000 bps)	91.93 %
Associated GOLD sequencing projects	129
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (98.758 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.938 % of family members)
Environment Ontology (ENVO)	Unclassified (45.342 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (62.733 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.40
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 161 Family Scaffolds
PF02563	Poly_export	60.25
PF10531	SLBB	19.88
PF02706	Wzz	3.11
PF13807	GNVR	1.86
PF14559	TPR_19	1.24
PF01061	ABC2_membrane	1.24
PF14332	DUF4388	0.62
PF00196	GerE	0.62
PF13432	TPR_16	0.62
PF13578	Methyltransf_24	0.62
PF13579	Glyco_trans_4_4	0.62
PF16363	GDP_Man_Dehyd	0.62
PF13414	TPR_11	0.62
PF13181	TPR_8	0.62
PF14306	PUA_2	0.62
PF04325	DUF465	0.62
PF13424	TPR_12	0.62
PF01370	Epimerase	0.62
PF12833	HTH_18	0.62

COG ID	Name	Functional Category	% Frequency in 161 Family Scaffolds
COG1596	Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold	Cell wall/membrane/envelope biogenesis [M]	60.25
COG3206	Exopolysaccharide export protein/domain GumC/Wzc1	Cell wall/membrane/envelope biogenesis [M]	3.11
COG3524	Capsule polysaccharide export protein KpsE/RkpR	Cell wall/membrane/envelope biogenesis [M]	3.11
COG3765	LPS O-antigen chain length determinant protein, WzzB/FepE family	Cell wall/membrane/envelope biogenesis [M]	3.11
COG3944	Capsular polysaccharide biosynthesis protein YveK	Cell wall/membrane/envelope biogenesis [M]	3.11

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.76 %
Unclassified	root	N/A	1.24 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	98.76 %
Unclassified	root	N/A	1.24 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	98.76 %
Unclassified	root	N/A	1.24 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	91.93 %
Unclassified	root	N/A	1.24 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.62 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.62 %

Name	Rank	Taxonomy	Distribution
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	15.53 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	6.21 %
Unclassified	root	N/A	1.24 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.62 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.62 %

Name	Rank	Taxonomy	Distribution
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	14.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.59 %
Unclassified	root	N/A	1.24 %
Acidobacteria bacterium 13_1_20CM_3_53_8	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8	0.62 %
Chloracidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	0.62 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	0.62 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.62 %

Name	Rank	Taxonomy	Distribution
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	14.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.59 %
Unclassified	root	N/A	1.24 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	0.62 %
Acidobacteria bacterium 13_1_20CM_3_53_8	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8	0.62 %
Chloracidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	0.62 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.62 %

Name	Rank	Taxonomy	Distribution
Pyrinomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas	14.29 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.59 %
Unclassified	root	N/A	1.24 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	0.62 %
Akkermansiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Akkermansiaceae	0.62 %
Acidobacteria bacterium 13_1_20CM_3_53_8	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8	0.62 %
Chloracidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	0.62 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.62 %

Name	Rank	Taxonomy	Distribution
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	14.29 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.59 %
Unclassified	root	N/A	1.24 %
Akkermansia	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Akkermansiaceae → Akkermansia	0.62 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	0.62 %
Acidobacteria bacterium 13_1_20CM_3_53_8	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8	0.62 %
Chloracidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	0.62 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.62 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2032320005\|FACEOR_FY84VJD01B8PES	All Organisms → cellular organisms → Bacteria → Acidobacteria	500	Open in IMG/M
3300000559\|F14TC_103350814	All Organisms → cellular organisms → Bacteria → Acidobacteria	766	Open in IMG/M
3300000574\|JGI1357J11328_10147682	All Organisms → cellular organisms → Bacteria → Acidobacteria	670	Open in IMG/M
3300000789\|JGI1027J11758_11333869	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	507	Open in IMG/M
3300001431\|F14TB_101863455	All Organisms → cellular organisms → Bacteria → Acidobacteria	608	Open in IMG/M
3300003993\|Ga0055468_10198026	All Organisms → cellular organisms → Bacteria → Acidobacteria	617	Open in IMG/M
3300004156\|Ga0062589_101565566	All Organisms → cellular organisms → Bacteria → Acidobacteria	651	Open in IMG/M
3300004480\|Ga0062592_100845442	All Organisms → cellular organisms → Bacteria → Acidobacteria	817	Open in IMG/M
3300004480\|Ga0062592_101549963	All Organisms → cellular organisms → Bacteria → Acidobacteria	638	Open in IMG/M
3300004643\|Ga0062591_102101606	All Organisms → cellular organisms → Bacteria → Acidobacteria	585	Open in IMG/M
3300005171\|Ga0066677_10556866	All Organisms → cellular organisms → Bacteria → Acidobacteria	655	Open in IMG/M
3300005177\|Ga0066690_10005645	All Organisms → cellular organisms → Bacteria	5856	Open in IMG/M
3300005180\|Ga0066685_10260977	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1196	Open in IMG/M
3300005180\|Ga0066685_10660616	All Organisms → cellular organisms → Bacteria → Acidobacteria	719	Open in IMG/M
3300005289\|Ga0065704_10288634	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	908	Open in IMG/M
3300005293\|Ga0065715_10164505	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium	1599	Open in IMG/M
3300005293\|Ga0065715_10516329	All Organisms → cellular organisms → Bacteria → Acidobacteria	767	Open in IMG/M
3300005294\|Ga0065705_10106560	All Organisms → cellular organisms → Bacteria	6485	Open in IMG/M
3300005295\|Ga0065707_10952964	All Organisms → cellular organisms → Bacteria → Acidobacteria	552	Open in IMG/M
3300005329\|Ga0070683_102036942	All Organisms → cellular organisms → Bacteria → Acidobacteria	551	Open in IMG/M
3300005330\|Ga0070690_100649755	All Organisms → cellular organisms → Bacteria → Acidobacteria	805	Open in IMG/M
3300005334\|Ga0068869_100603146	All Organisms → cellular organisms → Bacteria → Acidobacteria	928	Open in IMG/M
3300005334\|Ga0068869_102131696	All Organisms → cellular organisms → Bacteria → Acidobacteria	504	Open in IMG/M
3300005337\|Ga0070682_101247585	All Organisms → cellular organisms → Bacteria → Acidobacteria	629	Open in IMG/M
3300005343\|Ga0070687_100228831	All Organisms → cellular organisms → Bacteria → Acidobacteria	1143	Open in IMG/M
3300005364\|Ga0070673_100704953	All Organisms → cellular organisms → Bacteria → Acidobacteria	927	Open in IMG/M
3300005439\|Ga0070711_100490692	All Organisms → cellular organisms → Bacteria → Acidobacteria	1011	Open in IMG/M
3300005441\|Ga0070700_100625590	All Organisms → cellular organisms → Bacteria → Acidobacteria	847	Open in IMG/M
3300005445\|Ga0070708_100639107	All Organisms → cellular organisms → Bacteria → Acidobacteria	1003	Open in IMG/M
3300005445\|Ga0070708_101605234	All Organisms → cellular organisms → Bacteria → Acidobacteria	605	Open in IMG/M
3300005445\|Ga0070708_101634377	All Organisms → cellular organisms → Bacteria → Acidobacteria	599	Open in IMG/M
3300005454\|Ga0066687_10523688	All Organisms → cellular organisms → Bacteria → Acidobacteria	702	Open in IMG/M
3300005459\|Ga0068867_100311108	All Organisms → cellular organisms → Bacteria → Acidobacteria	1302	Open in IMG/M
3300005459\|Ga0068867_100818238	All Organisms → cellular organisms → Bacteria → Acidobacteria	832	Open in IMG/M
3300005539\|Ga0068853_101221933	All Organisms → cellular organisms → Bacteria → Acidobacteria	726	Open in IMG/M
3300005543\|Ga0070672_101565526	All Organisms → cellular organisms → Bacteria → Acidobacteria	591	Open in IMG/M
3300005545\|Ga0070695_100489931	All Organisms → cellular organisms → Bacteria → Acidobacteria	949	Open in IMG/M
3300005546\|Ga0070696_100086891	All Organisms → cellular organisms → Bacteria → Acidobacteria	2221	Open in IMG/M
3300005546\|Ga0070696_101668337	All Organisms → cellular organisms → Bacteria → Acidobacteria	549	Open in IMG/M
3300005549\|Ga0070704_100451012	All Organisms → cellular organisms → Bacteria → Acidobacteria	1107	Open in IMG/M
3300005553\|Ga0066695_10307842	All Organisms → cellular organisms → Bacteria → Acidobacteria	998	Open in IMG/M
3300005566\|Ga0066693_10453701	All Organisms → cellular organisms → Bacteria → Acidobacteria	525	Open in IMG/M
3300005575\|Ga0066702_10421950	All Organisms → cellular organisms → Bacteria → Acidobacteria	816	Open in IMG/M
3300005578\|Ga0068854_101565299	All Organisms → cellular organisms → Bacteria → Acidobacteria	600	Open in IMG/M
3300005615\|Ga0070702_100220832	All Organisms → cellular organisms → Bacteria → Acidobacteria	1267	Open in IMG/M
3300005616\|Ga0068852_101751820	All Organisms → cellular organisms → Bacteria → Acidobacteria	644	Open in IMG/M
3300005617\|Ga0068859_100493266	All Organisms → cellular organisms → Bacteria → Acidobacteria	1320	Open in IMG/M
3300005617\|Ga0068859_102863075	All Organisms → cellular organisms → Bacteria → Acidobacteria	529	Open in IMG/M
3300005618\|Ga0068864_101690439	All Organisms → cellular organisms → Bacteria → Acidobacteria	638	Open in IMG/M
3300005618\|Ga0068864_101844211	All Organisms → cellular organisms → Bacteria → Acidobacteria	610	Open in IMG/M
3300005764\|Ga0066903_106224416	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	624	Open in IMG/M
3300005840\|Ga0068870_10187602	All Organisms → cellular organisms → Bacteria → Acidobacteria	1245	Open in IMG/M
3300005841\|Ga0068863_101764399	All Organisms → cellular organisms → Bacteria → Acidobacteria	629	Open in IMG/M
3300005842\|Ga0068858_100506992	All Organisms → cellular organisms → Bacteria → Acidobacteria	1166	Open in IMG/M
3300005843\|Ga0068860_100867934	All Organisms → cellular organisms → Bacteria → Acidobacteria	918	Open in IMG/M
3300006755\|Ga0079222_10185805	All Organisms → cellular organisms → Bacteria	1231	Open in IMG/M
3300006806\|Ga0079220_11729426	All Organisms → cellular organisms → Bacteria → Acidobacteria	548	Open in IMG/M
3300006845\|Ga0075421_101501715	All Organisms → cellular organisms → Bacteria → Acidobacteria	737	Open in IMG/M
3300006852\|Ga0075433_10139440	All Organisms → cellular organisms → Bacteria → Acidobacteria	2155	Open in IMG/M
3300006854\|Ga0075425_100425163	Not Available	1530	Open in IMG/M
3300006903\|Ga0075426_10966579	All Organisms → cellular organisms → Bacteria → Acidobacteria	643	Open in IMG/M
3300006904\|Ga0075424_101095878	All Organisms → cellular organisms → Bacteria → Acidobacteria	849	Open in IMG/M
3300007004\|Ga0079218_11269989	All Organisms → cellular organisms → Bacteria → Acidobacteria	772	Open in IMG/M
3300007076\|Ga0075435_100013953	All Organisms → cellular organisms → Bacteria	5992	Open in IMG/M
3300007076\|Ga0075435_101459521	All Organisms → cellular organisms → Bacteria → Acidobacteria	600	Open in IMG/M
3300009011\|Ga0105251_10450113	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	597	Open in IMG/M
3300009090\|Ga0099827_11999145	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	503	Open in IMG/M
3300009093\|Ga0105240_11810315	All Organisms → cellular organisms → Bacteria → Acidobacteria	636	Open in IMG/M
3300009094\|Ga0111539_12944845	All Organisms → cellular organisms → Bacteria → Acidobacteria	551	Open in IMG/M
3300009098\|Ga0105245_11642484	All Organisms → cellular organisms → Bacteria → Acidobacteria	695	Open in IMG/M
3300009101\|Ga0105247_10161080	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1486	Open in IMG/M
3300009147\|Ga0114129_12449564	All Organisms → cellular organisms → Bacteria → Acidobacteria	624	Open in IMG/M
3300009156\|Ga0111538_11136366	All Organisms → cellular organisms → Bacteria → Acidobacteria	987	Open in IMG/M
3300009156\|Ga0111538_13994593	All Organisms → cellular organisms → Bacteria → Acidobacteria	510	Open in IMG/M
3300009162\|Ga0075423_12561327	All Organisms → cellular organisms → Bacteria → Acidobacteria	557	Open in IMG/M
3300009177\|Ga0105248_10496366	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1376	Open in IMG/M
3300009545\|Ga0105237_10004118	All Organisms → cellular organisms → Bacteria	16956	Open in IMG/M
3300009789\|Ga0126307_11444889	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	557	Open in IMG/M
3300010037\|Ga0126304_11278453	All Organisms → cellular organisms → Bacteria → Acidobacteria	503	Open in IMG/M
3300010038\|Ga0126315_10460800	All Organisms → cellular organisms → Bacteria → Acidobacteria	806	Open in IMG/M
3300010040\|Ga0126308_10572516	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	768	Open in IMG/M
3300010045\|Ga0126311_11516309	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300010046\|Ga0126384_10243711	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1449	Open in IMG/M
3300010046\|Ga0126384_11213497	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	696	Open in IMG/M
3300010047\|Ga0126382_10177720	All Organisms → cellular organisms → Bacteria → Acidobacteria	1490	Open in IMG/M
3300010304\|Ga0134088_10612979	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	542	Open in IMG/M
3300010360\|Ga0126372_12403082	All Organisms → cellular organisms → Bacteria → Acidobacteria	577	Open in IMG/M
3300010362\|Ga0126377_11863166	All Organisms → cellular organisms → Bacteria → Acidobacteria	677	Open in IMG/M
3300010362\|Ga0126377_13594397	All Organisms → cellular organisms → Bacteria → Acidobacteria	501	Open in IMG/M
3300010366\|Ga0126379_10040339	All Organisms → cellular organisms → Bacteria → Acidobacteria	3751	Open in IMG/M
3300010399\|Ga0134127_11933716	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	667	Open in IMG/M
3300010399\|Ga0134127_12889226	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	559	Open in IMG/M
3300010401\|Ga0134121_11596008	All Organisms → cellular organisms → Bacteria → Acidobacteria	672	Open in IMG/M
3300011119\|Ga0105246_10892525	All Organisms → cellular organisms → Bacteria → Acidobacteria	796	Open in IMG/M
3300011271\|Ga0137393_11087659	All Organisms → cellular organisms → Bacteria → Acidobacteria	680	Open in IMG/M
3300012184\|Ga0136610_1239122	All Organisms → cellular organisms → Bacteria → Acidobacteria	621	Open in IMG/M
3300012203\|Ga0137399_10377146	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1181	Open in IMG/M
3300012207\|Ga0137381_10438351	All Organisms → cellular organisms → Bacteria → Acidobacteria	1140	Open in IMG/M
3300012208\|Ga0137376_10989780	All Organisms → cellular organisms → Bacteria → Acidobacteria	720	Open in IMG/M
3300012208\|Ga0137376_11424600	All Organisms → cellular organisms → Bacteria → Acidobacteria	584	Open in IMG/M
3300012350\|Ga0137372_10057949	All Organisms → cellular organisms → Bacteria → Acidobacteria	3386	Open in IMG/M
3300012353\|Ga0137367_10237926	All Organisms → cellular organisms → Bacteria → Acidobacteria	1311	Open in IMG/M
3300012918\|Ga0137396_10916115	All Organisms → cellular organisms → Bacteria → Acidobacteria	641	Open in IMG/M
3300012922\|Ga0137394_10223174	All Organisms → cellular organisms → Bacteria	1611	Open in IMG/M
3300012923\|Ga0137359_11472099	All Organisms → cellular organisms → Bacteria → Acidobacteria	569	Open in IMG/M
3300012929\|Ga0137404_11758028	All Organisms → cellular organisms → Bacteria → Acidobacteria	576	Open in IMG/M
3300012929\|Ga0137404_11997453	All Organisms → cellular organisms → Bacteria → Acidobacteria	541	Open in IMG/M
3300012930\|Ga0137407_10455469	All Organisms → cellular organisms → Bacteria → Acidobacteria	1191	Open in IMG/M
3300012930\|Ga0137407_12371520	All Organisms → cellular organisms → Bacteria → Acidobacteria	507	Open in IMG/M
3300012948\|Ga0126375_11384116	All Organisms → cellular organisms → Bacteria → Acidobacteria	595	Open in IMG/M
3300012957\|Ga0164303_10902878	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	619	Open in IMG/M
3300012975\|Ga0134110_10183602	All Organisms → cellular organisms → Bacteria → Acidobacteria	873	Open in IMG/M
3300012977\|Ga0134087_10515245	All Organisms → cellular organisms → Bacteria → Acidobacteria	604	Open in IMG/M
3300013100\|Ga0157373_10252050	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1249	Open in IMG/M
3300013102\|Ga0157371_11058750	All Organisms → cellular organisms → Bacteria → Acidobacteria	621	Open in IMG/M
3300013296\|Ga0157374_10629664	All Organisms → cellular organisms → Bacteria → Acidobacteria	1084	Open in IMG/M
3300013297\|Ga0157378_10849472	All Organisms → cellular organisms → Bacteria → Acidobacteria	941	Open in IMG/M
3300013307\|Ga0157372_12658776	All Organisms → cellular organisms → Bacteria → Acidobacteria	574	Open in IMG/M
3300014325\|Ga0163163_11830258	All Organisms → cellular organisms → Bacteria → Acidobacteria	667	Open in IMG/M
3300015200\|Ga0173480_10894063	All Organisms → cellular organisms → Bacteria → Acidobacteria	576	Open in IMG/M
3300015371\|Ga0132258_10310303	All Organisms → cellular organisms → Bacteria	3884	Open in IMG/M
3300017792\|Ga0163161_11278471	All Organisms → cellular organisms → Bacteria → Acidobacteria	637	Open in IMG/M
3300018422\|Ga0190265_12564310	All Organisms → cellular organisms → Bacteria → Acidobacteria	608	Open in IMG/M
3300018431\|Ga0066655_11134100	All Organisms → cellular organisms → Bacteria → Acidobacteria	549	Open in IMG/M
3300018468\|Ga0066662_10457040	All Organisms → cellular organisms → Bacteria → Acidobacteria	1146	Open in IMG/M
3300019767\|Ga0190267_11145841	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	564	Open in IMG/M
3300025325\|Ga0209341_10580170	All Organisms → cellular organisms → Bacteria → Acidobacteria	882	Open in IMG/M
3300025885\|Ga0207653_10006374	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3682	Open in IMG/M
3300025918\|Ga0207662_11197114	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	540	Open in IMG/M
3300025927\|Ga0207687_11549084	All Organisms → cellular organisms → Bacteria → Acidobacteria	569	Open in IMG/M
3300025935\|Ga0207709_11866966	All Organisms → cellular organisms → Bacteria → Acidobacteria	500	Open in IMG/M
3300025936\|Ga0207670_11550308	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	563	Open in IMG/M
3300025940\|Ga0207691_11280028	All Organisms → cellular organisms → Bacteria → Acidobacteria	606	Open in IMG/M
3300025942\|Ga0207689_10311836	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1305	Open in IMG/M
3300025945\|Ga0207679_10877709	All Organisms → cellular organisms → Bacteria → Acidobacteria	820	Open in IMG/M
3300025945\|Ga0207679_11853891	All Organisms → cellular organisms → Bacteria → Acidobacteria	550	Open in IMG/M
3300025961\|Ga0207712_10455301	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1086	Open in IMG/M
3300025981\|Ga0207640_10463824	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1047	Open in IMG/M
3300026075\|Ga0207708_10058550	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2939	Open in IMG/M
3300026095\|Ga0207676_10742205	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	954	Open in IMG/M
3300026095\|Ga0207676_10971635	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	836	Open in IMG/M
3300026095\|Ga0207676_11920605	All Organisms → cellular organisms → Bacteria → Acidobacteria	591	Open in IMG/M
3300026116\|Ga0207674_10713733	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	968	Open in IMG/M
3300026118\|Ga0207675_100120725	All Organisms → cellular organisms → Bacteria	2479	Open in IMG/M
3300026142\|Ga0207698_11780515	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	631	Open in IMG/M
3300026527\|Ga0209059_1303088	All Organisms → cellular organisms → Bacteria → Acidobacteria	541	Open in IMG/M
3300027654\|Ga0209799_1040568	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1038	Open in IMG/M
3300027725\|Ga0209178_1437848	All Organisms → cellular organisms → Bacteria → Acidobacteria	502	Open in IMG/M
3300027875\|Ga0209283_10249876	All Organisms → cellular organisms → Bacteria → Acidobacteria	1176	Open in IMG/M
3300028047\|Ga0209526_10392740	All Organisms → cellular organisms → Bacteria → Acidobacteria	922	Open in IMG/M
3300028381\|Ga0268264_11507274	All Organisms → cellular organisms → Bacteria → Acidobacteria	683	Open in IMG/M
3300028381\|Ga0268264_12536927	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	518	Open in IMG/M
3300031731\|Ga0307405_10340407	All Organisms → cellular organisms → Bacteria → Acidobacteria	1153	Open in IMG/M
3300031740\|Ga0307468_101358867	All Organisms → cellular organisms → Bacteria → Acidobacteria	650	Open in IMG/M
3300031824\|Ga0307413_11780185	All Organisms → cellular organisms → Bacteria → Acidobacteria	551	Open in IMG/M
3300032005\|Ga0307411_12256415	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	511	Open in IMG/M
3300032074\|Ga0308173_10721405	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	912	Open in IMG/M
3300033475\|Ga0310811_10932658	All Organisms → cellular organisms → Bacteria → Acidobacteria	776	Open in IMG/M
3300034175\|Ga0334939_0122031	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8	830	Open in IMG/M
3300034376\|Ga0334923_029695	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Akkermansiaceae → Akkermansia	1153	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	59.01%
Host-Associated	Host-Associated	40.99%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	57.14%
Plants	Host-Associated → Plants	40.99%
Aquatic	Environmental → Aquatic	1.86%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	56.52%
Rhizosphere	Host-Associated → Plants → Rhizosphere	21.74%
Rhizoplane	Host-Associated → Plants → Rhizoplane	18.63%
Freshwater	Environmental → Aquatic → Freshwater	1.24%
Marine	Environmental → Aquatic → Marine	0.62%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.62%
Roots	Host-Associated → Plants → Roots	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	39.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	18.63%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	16.15%
Loam	Environmental → Terrestrial → Soil → Loam	15.53%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.48%
Soil Crust	Environmental → Terrestrial → Soil → Soil Crust	1.24%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.62%
Ice	Environmental → Aquatic → Freshwater → Ice	0.62%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.62%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.62%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	26.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	18.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	16.15%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.18%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.83%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.97%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.48%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.86%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.86%
Unclassified	Environmental → Terrestrial → Soil → Soil Crust → Unclassified	1.24%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.62%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.62%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.62%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.62%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.62%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.62%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.62%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.62%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	8.07%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.45%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.59%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.97%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.11%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.11%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.48%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.48%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.48%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.48%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.86%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.86%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.86%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.86%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.24%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.24%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.24%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	1.24%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.24%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.24%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.62%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.62%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.62%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.62%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.62%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.62%
Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust	0.62%
Hypolithic Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust	0.62%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.62%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.62%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2032320005	Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2-	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000574	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m	Environmental	Open in IMG/M
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300003993	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012184	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06)	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019767	Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T	Environmental	Open in IMG/M
3300021362	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09	Environmental	Open in IMG/M
3300025325	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026527	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)	Environmental	Open in IMG/M
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M
3300034175	Biocrust microbial communities from Mojave Desert, California, United States - 35SMC	Environmental	Open in IMG/M
3300034376	Biocrust microbial communities from Mojave Desert, California, United States - 19HNC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FACEORA_1260880	2032320005	Soil	YDDLMVLVSNTVLNLARPNHMREALLSRRIGLGGK
F14TC_1033508142	3300000559	Soil	EHEELLVLLSNTVLNLANPNHMREALLSRRIGIAGK*
JGI1357J11328_101476822	3300000574	Groundwater	YEELMVLVSNTVLNLAHPNHMREALLSRRMGLGGK*
JGI1027J11758_113338692	3300000789	Soil	GPLTGAFAREHEELMILLSNTVLNLAHPNHIREAMLSRRMAMGH*
F14TB_1018634552	3300001431	Soil	EHEELLVLLSNTVLNLAHPNHMREALLSRRVGMSGK*
Ga0055468_101980262	3300003993	Natural And Restored Wetlands	RGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0062589_1015655662	3300004156	Soil	FRRQHEELLVLLSNTILNLAHPNHMREALLSRRIGISGK*
Ga0062592_1008454422	3300004480	Soil	VVKTGEQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGVSGR*
Ga0062592_1015499631	3300004480	Soil	LTGVFVRDNEELMVVLSNTVLNVANQNHLNEALSSRRLKKTKGS*
Ga0062591_1021016062	3300004643	Soil	LTGSFKREHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK*
Ga0066677_105568661	3300005171	Soil	GTFLREYGELMVLVSNTVLNLAHPNHMREALLSRRSGLGRK*
Ga0066690_100056451	3300005177	Soil	GAFRREHDELMVLVSNTVLNLAHPNHMREALLSRRIGLAGK*
Ga0066685_102609771	3300005180	Soil	NPLTGMFLRDHEELMVLVSNTVLNLAHPNHMREALLSRRIGLGKK*
Ga0066685_106606161	3300005180	Soil	QDKPLTGMFQREHEELLVLVSNTVLNLAHPNHMREALLSRRVGLSGK*
Ga0065704_102886342	3300005289	Switchgrass Rhizosphere	GEQPLTGIFKREHEELLVILSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0065715_101645051	3300005293	Miscanthus Rhizosphere	EQPLTGIFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0065715_105163292	3300005293	Miscanthus Rhizosphere	VVKTGEQPLTGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0065705_101065601	3300005294	Switchgrass Rhizosphere	LFKREHEELLVLLSNTVLNLAHPNHMREALMSRRIGMTGR*
Ga0065707_109529642	3300005295	Switchgrass Rhizosphere	LTGSFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMAGK*
Ga0070683_1020369422	3300005329	Corn Rhizosphere	QPLTGLFRREHEELMVLLSNTILNLAHPNHMREALLSRRIGMSGK*
Ga0070690_1006497551	3300005330	Switchgrass Rhizosphere	LTGLFRREHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK*
Ga0068869_1006031462	3300005334	Miscanthus Rhizosphere	FRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG*
Ga0068869_1021316961	3300005334	Miscanthus Rhizosphere	GEQPLTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRKTGMVGK*
Ga0070682_1012475852	3300005337	Corn Rhizosphere	LFRREHEELMVLLSNTVLNLAHPNHMREALLSRRVGMSGHR*
Ga0070687_1002288311	3300005343	Switchgrass Rhizosphere	EFSREHSELMVLVSNTVLNLAHPNHMREALLSRRMGLGGK*
Ga0070673_1007049532	3300005364	Switchgrass Rhizosphere	KTGEQPLTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRRTGMSGK*
Ga0070711_1004906921	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	DNPLTGAFRRDHEELMVLVSNTVLNLAHPNHMREALASRRIGLGGK*
Ga0070700_1006255902	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	FNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0070708_1006391071	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	GDQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMAGK*
Ga0070708_1016052342	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	GLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGISGR*
Ga0070708_1016343771	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	DQPLTGQFRREHEELMVLLSNTVLNLAHPNHMREALLSRKVGLSSR*
Ga0066687_105236882	3300005454	Soil	GMFRRDHEELMVLVSNTVLNLAHPNHMREALASRRIGLGGK*
Ga0068867_1003111081	3300005459	Miscanthus Rhizosphere	GLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRLGMSGK*
Ga0068867_1008182382	3300005459	Miscanthus Rhizosphere	LTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0068853_1012219332	3300005539	Corn Rhizosphere	EQPLTGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRVGMSGHR*
Ga0070672_1015655262	3300005543	Miscanthus Rhizosphere	HEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0070695_1004899312	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	LTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK*
Ga0070696_1000868911	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	LFKREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0070696_1016683372	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	TKTGEQPLTGLFNREHEELLVLLSNTILNLAHPNHMREALLSRRVGISGK*
Ga0070704_1004510122	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	DNPLTGTFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGLARK*
Ga0066695_103078422	3300005553	Soil	QDGPLTGEFLREHEELMVLVSNTVLSLAHPNHMREALLSRRIGLGGK*
Ga0066693_104537011	3300005566	Soil	TGTFRRDHEELMVMVSNTVLNLAHPNHMREALLSRRLGLGGK*
Ga0066702_104219502	3300005575	Soil	TGAFRREHDDLMVLVSNTVLNLARPNHMREALLSRRIGLGGK*
Ga0068854_1015652992	3300005578	Corn Rhizosphere	KTGEQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0070702_1002208322	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	LFRREHEELMVLLSNTILNLAHPNHMREALLSRRIGMSGK*
Ga0068852_1017518201	3300005616	Corn Rhizosphere	GLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0068859_1004932662	3300005617	Switchgrass Rhizosphere	GDNPLTGAFRRDHEELLVLVSNTVLNLAHPNHMREALASRRIGLGGK*
Ga0068859_1028630751	3300005617	Switchgrass Rhizosphere	FNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGHR*
Ga0068864_1016904392	3300005618	Switchgrass Rhizosphere	GLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGHR*
Ga0068864_1018442112	3300005618	Switchgrass Rhizosphere	EHEELLVLLSNTVLNLAHPNHMREALTSRRIGISGK*
Ga0066903_1062244162	3300005764	Tropical Forest Soil	TFRRDHEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK*
Ga0068870_101876023	3300005840	Miscanthus Rhizosphere	GLFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIAMSGK*
Ga0068863_1017643991	3300005841	Switchgrass Rhizosphere	REHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG*
Ga0068858_1005069921	3300005842	Switchgrass Rhizosphere	EHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK*
Ga0068860_1008679342	3300005843	Switchgrass Rhizosphere	EELMVLLSNTVLNLAHPNHMREALLSRRLGMSGK*
Ga0079222_101858051	3300006755	Agricultural Soil	GLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK*
Ga0079220_117294261	3300006806	Agricultural Soil	TGEQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0075421_1015017152	3300006845	Populus Rhizosphere	EQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGISGR*
Ga0075433_101394401	3300006852	Populus Rhizosphere	HEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK*
Ga0075425_1004251633	3300006854	Populus Rhizosphere	RENEELMVLLANTVLNVAHPIHLREALLARRTGLARR*
Ga0075426_109665792	3300006903	Populus Rhizosphere	QDQPLTGAYVREYDDLMVLVSNTVLNLARPNHMREALLSRRIGLGGK*
Ga0075424_1010958782	3300006904	Populus Rhizosphere	QPLRGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK*
Ga0079218_112699891	3300007004	Agricultural Soil	DSPLTGTFKRDHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK*
Ga0075435_1000139531	3300007076	Populus Rhizosphere	ENEELMIVLSNTVLNLAHPNHIREAMMSRRTALGH*
Ga0075435_1014595212	3300007076	Populus Rhizosphere	FKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK*
Ga0105251_104501132	3300009011	Switchgrass Rhizosphere	GLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMGHR*
Ga0099827_119991452	3300009090	Vadose Zone Soil	GPLTGEFLREYEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK*
Ga0105240_118103151	3300009093	Corn Rhizosphere	LTGLFRREHEELMVLLSNTVLNLAHPNHIREALLSRRIGMSGK*
Ga0111539_129448451	3300009094	Populus Rhizosphere	KREHEELLVILSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0105245_116424841	3300009098	Miscanthus Rhizosphere	TFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGLARK*
Ga0105247_101610803	3300009101	Switchgrass Rhizosphere	LTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMGHR*
Ga0114129_124495642	3300009147	Populus Rhizosphere	FRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMAGK*
Ga0111538_111363661	3300009156	Populus Rhizosphere	REHEELMVLLSNTVLNLAHPNHMREALLSRKTGMVGK*
Ga0111538_139945932	3300009156	Populus Rhizosphere	EHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0075423_125613272	3300009162	Populus Rhizosphere	EHEELLVLLRNTVLNLAHPNHMREALLSRRVGMAGK*
Ga0105248_104963661	3300009177	Switchgrass Rhizosphere	FKREHEELMVLLSNTVLNLAHPNNMREALLSRKTGMGK*
Ga0105237_1000411816	3300009545	Corn Rhizosphere	LFRREHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK*
Ga0126307_114448892	3300009789	Serpentine Soil	EGIVVKTGEQPLTGLFKREHEELLVLLSNTILNLAHPNHMREALLSRRIGMSGK*
Ga0126304_112784532	3300010037	Serpentine Soil	TGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0126315_104608002	3300010038	Serpentine Soil	EELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0126308_105725161	3300010040	Serpentine Soil	EQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGISGK*
Ga0126311_115163091	3300010045	Serpentine Soil	EYEELMVIMSNTVLNLAHPNHTREALASRHLGLAKR*
Ga0126384_102437111	3300010046	Tropical Forest Soil	IVIKTGEQPLTGLFKREHEALMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0126384_112134972	3300010046	Tropical Forest Soil	EYEELMVLVSNTVLNLAHPNHMREALASRRIALGRK*
Ga0126382_101777202	3300010047	Tropical Forest Soil	GKYRREYDELMVLVSNTVLNLAHPNHMREALASRRIGLGGK*
Ga0134088_106129791	3300010304	Grasslands Soil	REHDELMVLVSNTVLNLAHPNHMREALLSRRIGLAGK*
Ga0126372_124030821	3300010360	Tropical Forest Soil	REHQELLVLLSNTVLNLAHPNHMREALLSRRMGISGR*
Ga0126377_118631661	3300010362	Tropical Forest Soil	PLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0126377_135943972	3300010362	Tropical Forest Soil	TGLFSREHQELMVLLSNTVLNLAHPNHMREALLSRRLGMSGR*
Ga0126379_100403391	3300010366	Tropical Forest Soil	TADQPLTGTFRRDHEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK*
Ga0134127_119337162	3300010399	Terrestrial Soil	GDQPLTGLFRRQHEELLVLLSNTILNLAHPNHMREALLSRRIGISGK*
Ga0134127_128892261	3300010399	Terrestrial Soil	EQPLTGLFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0134121_115960081	3300010401	Terrestrial Soil	KREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0105246_108925251	3300011119	Miscanthus Rhizosphere	PLTGLFRREHEELMVLLSNTILNLAHPNHMREALLSRRIGIAGK*
Ga0137393_110876591	3300011271	Vadose Zone Soil	NPLTGTFLREYGELMVLVSNTVLNLAHPNHMREALLSRRRGLGRK*
Ga0136610_12391221	3300012184	Polar Desert Sand	HEELLVILSNTVLNLAHPNHMREALLSRRIGMGGK*
Ga0137399_103771461	3300012203	Vadose Zone Soil	LTGALRREHEELMVVLSNTILNLAHPNHLHEALALRRVGMSGR*
Ga0137381_104383511	3300012207	Vadose Zone Soil	REYDDLMVLISNTVLNLARPNHMREALLSRRIGLGGK*
Ga0137376_109897801	3300012208	Vadose Zone Soil	KTDDHPLTGTFRRDHEQLMVLVSNTVLNLAHPNHMREALMSRRMGLGGK*
Ga0137376_114246002	3300012208	Vadose Zone Soil	CEQPLTGSCSREHEELIVLVSNTVLNLAHPNHMREALLSRRIGISGK*
Ga0137372_100579491	3300012350	Vadose Zone Soil	ITKTQDKPLTGMFVRDHEELMVLVSNTILNLAHPNHMREALLSRRTGVGRK*
Ga0137367_102379261	3300012353	Vadose Zone Soil	HEELLVLLSNTVLNLAHPNHMREALLSRRMGKQN*
Ga0137396_109161151	3300012918	Vadose Zone Soil	DHPLTGTFVREHEELMVLVSKTVLNLAHPNHMREALLSRRLGVAGR*
Ga0137394_102231743	3300012922	Vadose Zone Soil	EHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK*
Ga0137359_114720992	3300012923	Vadose Zone Soil	LREHGELMVLISNTVLNLAHPNHMREALMSRRLGIGGK*
Ga0137404_117580281	3300012929	Vadose Zone Soil	DHPLTGTFRRDHEELMVMVSNTVLNLAHPNHMREALLSRRLGLGGK*
Ga0137404_119974532	3300012929	Vadose Zone Soil	SPLTGTFNREHEELLVLLSNTVLNMAHPNHMREALLSRRVGLARK*
Ga0137407_104554691	3300012930	Vadose Zone Soil	GEFLREYEELMVLVSNTVLNLAYPNHMREALLSRRIGLGGK*
Ga0137407_123715202	3300012930	Vadose Zone Soil	HEELMVLVSNTVLNLAHPNHMREDMLSRRTGLGGK*
Ga0126375_113841162	3300012948	Tropical Forest Soil	TGEFKREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0164303_109028781	3300012957	Soil	RDQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMAGK*
Ga0134110_101836022	3300012975	Grasslands Soil	DELMVLVSNTVLNLAHPNHMREALLSRRIGLAGK*
Ga0134087_105152452	3300012977	Grasslands Soil	GRARLRTVLMVLVSNTVLNLARPNHMREALLSRRLGLGGK*
Ga0157373_102520501	3300013100	Corn Rhizosphere	GEQPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK*
Ga0157371_110587501	3300013102	Corn Rhizosphere	REHEELMVLLSNTVLNLACPNHMREALLSRRVGMAGK*
Ga0157374_106296641	3300013296	Miscanthus Rhizosphere	PLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGHR*
Ga0157378_108494721	3300013297	Miscanthus Rhizosphere	GIFVREDEELFIVLSNTVLNLANPNHLGEALASRRLRRLKKA*
Ga0157372_126587761	3300013307	Corn Rhizosphere	HEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK*
Ga0163163_118302582	3300014325	Switchgrass Rhizosphere	KRDHEELWVLLSNTVLNLADPNHMREALLSRRIGIAGK*
Ga0173480_108940631	3300015200	Soil	FSREHSEFMVLVSNTVLNLAHPNHMREALLSRRMGLGGK*
Ga0132258_103103031	3300015371	Arabidopsis Rhizosphere	QPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRVGMAGK*
Ga0163161_112784712	3300017792	Switchgrass Rhizosphere	KREHEELLVLLSNTVLNLAHPNHMREALMSRRIGISGK
Ga0190265_125643101	3300018422	Soil	HEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK
Ga0066655_111341002	3300018431	Grasslands Soil	GEFLREHEELMVLISNTVLNLAHPNHMREALLSRRIGLGGK
Ga0066662_104570401	3300018468	Grasslands Soil	REHEELLVILSNTVLDLAHPNHVREALSSRRTGLGKR
Ga0190267_111458412	3300019767	Soil	FSREHEELLVLVSNTVLNLACPNHLSEALRSRKLSSGSK
Ga0213882_102844112	3300021362	Exposed Rock	VVCKTGDNPLTGHFSREHQESLVVLSNTILNRAHPNHLQEALRTRRAALTRR
Ga0209341_105801702	3300025325	Soil	WREHQELMVLISNTVLNLAHPNHMREALLSRRVGLAGK
Ga0207653_100063741	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	RREHEELMVLLSNTVLNLACPNHMREALLSRRVGIAGK
Ga0207662_111971142	3300025918	Switchgrass Rhizosphere	TGAFLREYEELMVLVSNTVLNLAHPNHMREALASRRIALGRK
Ga0207687_115490842	3300025927	Miscanthus Rhizosphere	LTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGIAGK
Ga0207709_118669661	3300025935	Miscanthus Rhizosphere	TGSFKREHEELMVLLSNTVLNLAHPNHMREALLSRRVGLARK
Ga0207670_115503082	3300025936	Switchgrass Rhizosphere	TGDQPLTGLFRRQHEELLVLLSNTILNLAHPNHMREALLSRRIGISGK
Ga0207691_112800282	3300025940	Miscanthus Rhizosphere	LFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK
Ga0207689_103118363	3300025942	Miscanthus Rhizosphere	FRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG
Ga0207679_108777091	3300025945	Corn Rhizosphere	DQPLQGLFKREHEELLVLLSNTVLNLAHPNHMREALMSRRIGISGK
Ga0207679_118538912	3300025945	Corn Rhizosphere	PLTGLFKREHEELLVLLSNTILNLAHPNHMREALLSRRVGIAGK
Ga0207712_104553012	3300025961	Switchgrass Rhizosphere	GVVIKTGEQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRVGLARK
Ga0207640_104638241	3300025981	Corn Rhizosphere	DRPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALLSRRIGVSGK
Ga0207708_100585501	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	HEELLVLLSNTILNLAHPNHMREALLSRRIGISGK
Ga0207676_107422052	3300026095	Switchgrass Rhizosphere	TGEQPLTGLFRREHEELMVLLSNTVLNLAHPNHIREALLSRRIGMSGK
Ga0207676_109716352	3300026095	Switchgrass Rhizosphere	EQPLTGLFRREHQELLVLLSNTVLNLAHPNHMREALLSRRLGVSGR
Ga0207676_119206052	3300026095	Switchgrass Rhizosphere	RREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG
Ga0207674_107137332	3300026116	Corn Rhizosphere	GEQPLTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGK
Ga0207675_1001207254	3300026118	Switchgrass Rhizosphere	LFRREHEELMVLLSNTVLNLAHPNHMREALLSRRIGIAGK
Ga0207698_117805152	3300026142	Corn Rhizosphere	GDQPLTGLFKREHEELLVLLSNTVLNLAHPNHMREALMSRRIGMGNR
Ga0209059_13030882	3300026527	Soil	TGTFRRDHEELMVLVSNTVLNLAHPNHMREALMSRRLGLGGK
Ga0209799_10405682	3300027654	Tropical Forest Soil	TGMFLRDHEELMVLVSNTVLNLAHPHHMREALLSRRIGLGKK
Ga0209178_14378482	3300027725	Agricultural Soil	GLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK
Ga0209283_102498762	3300027875	Vadose Zone Soil	FLREYEELMVLVSNTVLNLAHPNHMREALLSRRIGLGGK
Ga0209526_103927402	3300028047	Forest Soil	GTFAREHEELMVLLSNTVLNLAHPNHMREALLSRRVGLAGK
Ga0268264_115072741	3300028381	Switchgrass Rhizosphere	EELLVLLSNTVLNLAHPNHMREALLSRRIGMSSRG
Ga0268264_125369271	3300028381	Switchgrass Rhizosphere	LTGLFKREHEELMVLLSNTVLNLAHPNHMREALLSRKIGMT
Ga0307405_103404072	3300031731	Rhizosphere	PLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK
Ga0307468_1013588672	3300031740	Hardwood Forest Soil	PLTGKFKRDHEELLVLVSNTVLNLAHPNHMREALLSRRIGLGK
Ga0307413_117801851	3300031824	Rhizosphere	GLFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGHR
Ga0307411_122564152	3300032005	Rhizosphere	GEQPLTGLFNREHEELMVLLSNTVLNLAHPNHMREALLSRRIGMSGHR
Ga0308173_107214052	3300032074	Soil	VVKTGEQPLTGLFRREHEELLVLLSNTVLNLAHPNHMREALLSRRLGMSGK
Ga0310811_109326581	3300033475	Soil	HEELLVLLSNTVLNLAHPNHMREALLSRRIGMSGK
Ga0334939_0122031_670_801	3300034175	Biocrust	LTGAFHREHEELMVVMSNTVLNLAHPNHVREALSSRRLGLAKK
Ga0334923_029695_1043_1153	3300034376	Hypolithic Biocrust	EHEESLIVLSNTVLNLEHPNHLREALMSRRLGMSGK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F040928

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences