Metagenome Family F040952

Basic Information
Family ID	F040952
Family Type	Metagenome
Number of Sequences	160
Average Sequence Length	44 residues
Representative Sequence	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAA
Number of Associated Samples	54
Number of Associated Scaffolds	160

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	12.88 %
% of genes near scaffold ends (potentially truncated)	73.12 %
% of genes from short scaffolds (< 2000 bps)	81.88 %
Associated GOLD sequencing projects	54
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Unclassified (85.625 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (98.750 % of family members)
Environment Ontology (ENVO)	Unclassified (98.750 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (98.750 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 160 Family Scaffolds
PF02666	PS_Dcarbxylase	1.25
PF14223	Retrotran_gag_2	0.62
PF14303	NAM-associated	0.62
PF13966	zf-RVT	0.62
PF01566	Nramp	0.62
PF00069	Pkinase	0.62

COG ID	Name	Functional Category	% Frequency in 160 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.50
COG0688	Phosphatidylserine decarboxylase	Lipid transport and metabolism [I]	1.25
COG1914	Mn2+ or Fe2+ transporter, NRAMP family	Inorganic ion transport and metabolism [P]	0.62

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
All Organisms	root	All Organisms	14.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
cellular organisms	root	All Organisms → cellular organisms	14.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	13.75 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	13.12 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	13.12 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	13.12 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13.12 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	10.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	10.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	10.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	10.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	10.00 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	10.00 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	10.00 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	10.00 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	10.00 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	8.12 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	3.75 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	1.25 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	3.12 %
Pooideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae	1.25 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	1.88 %
Triticodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae	1.25 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.25 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1.88 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	1.25 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.25 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Hordeinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae	1.25 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	1.25 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	0.62 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.62 %
Dichantheliinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae	0.62 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Hordeum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum	1.25 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1.25 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.62 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	0.62 %
Dichanthelium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium	0.62 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Hordeum vulgare	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare	1.25 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1.25 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.62 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	0.62 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.62 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.62 %
Hordeum vulgare subsp. vulgare	subspecies	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare	1.25 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1.25 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.62 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	0.62 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.62 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.62 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005718\|Ga0068866_10972153	Not Available	602	Open in IMG/M
3300015267\|Ga0182122_1022826	Not Available	691	Open in IMG/M
3300015269\|Ga0182113_1052515	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	608	Open in IMG/M
3300015274\|Ga0182188_1029596	Not Available	611	Open in IMG/M
3300015277\|Ga0182128_1049488	Not Available	578	Open in IMG/M
3300015281\|Ga0182160_1042539	Not Available	613	Open in IMG/M
3300015282\|Ga0182124_1002579	Not Available	1301	Open in IMG/M
3300015283\|Ga0182156_1011415	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	895	Open in IMG/M
3300015283\|Ga0182156_1014214	Not Available	844	Open in IMG/M
3300015283\|Ga0182156_1050569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare	594	Open in IMG/M
3300015283\|Ga0182156_1070435	Not Available	538	Open in IMG/M
3300015286\|Ga0182176_1058819	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare	567	Open in IMG/M
3300015287\|Ga0182171_1076800	Not Available	525	Open in IMG/M
3300015288\|Ga0182173_1023626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	727	Open in IMG/M
3300015288\|Ga0182173_1025194	Not Available	714	Open in IMG/M
3300015291\|Ga0182125_1053105	Not Available	598	Open in IMG/M
3300015291\|Ga0182125_1067988	All Organisms → cellular organisms → Eukaryota	556	Open in IMG/M
3300015294\|Ga0182126_1049134	Not Available	614	Open in IMG/M
3300015294\|Ga0182126_1050239	Not Available	610	Open in IMG/M
3300015295\|Ga0182175_1039300	Not Available	661	Open in IMG/M
3300015295\|Ga0182175_1070882	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	557	Open in IMG/M
3300015298\|Ga0182106_1016738	Not Available	857	Open in IMG/M
3300015300\|Ga0182108_1009596	Not Available	1013	Open in IMG/M
3300015300\|Ga0182108_1026003	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	765	Open in IMG/M
3300015300\|Ga0182108_1056953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	610	Open in IMG/M
3300015300\|Ga0182108_1090033	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	530	Open in IMG/M
3300015303\|Ga0182123_1009539	Not Available	960	Open in IMG/M
3300015303\|Ga0182123_1069328	Not Available	559	Open in IMG/M
3300015303\|Ga0182123_1088736	Not Available	519	Open in IMG/M
3300015304\|Ga0182112_1081629	Not Available	545	Open in IMG/M
3300015304\|Ga0182112_1100496	Not Available	511	Open in IMG/M
3300015305\|Ga0182158_1064697	Not Available	583	Open in IMG/M
3300015314\|Ga0182140_1011624	Not Available	981	Open in IMG/M
3300015314\|Ga0182140_1034712	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	723	Open in IMG/M
3300015314\|Ga0182140_1065035	Not Available	603	Open in IMG/M
3300015321\|Ga0182127_1023907	Not Available	830	Open in IMG/M
3300015322\|Ga0182110_1048195	Not Available	674	Open in IMG/M
3300015322\|Ga0182110_1073323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	595	Open in IMG/M
3300015322\|Ga0182110_1097542	Not Available	544	Open in IMG/M
3300015323\|Ga0182129_1084553	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	554	Open in IMG/M
3300015323\|Ga0182129_1102619	Not Available	522	Open in IMG/M
3300015341\|Ga0182187_1031768	Not Available	948	Open in IMG/M
3300015341\|Ga0182187_1035304	Not Available	917	Open in IMG/M
3300015341\|Ga0182187_1051506	Not Available	809	Open in IMG/M
3300015341\|Ga0182187_1121932	Not Available	602	Open in IMG/M
3300015341\|Ga0182187_1172317	Not Available	531	Open in IMG/M
3300015342\|Ga0182109_1000715	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	2931	Open in IMG/M
3300015342\|Ga0182109_1134149	Not Available	611	Open in IMG/M
3300015342\|Ga0182109_1150577	Not Available	585	Open in IMG/M
3300015343\|Ga0182155_1119210	Not Available	636	Open in IMG/M
3300015343\|Ga0182155_1131084	Not Available	614	Open in IMG/M
3300015343\|Ga0182155_1135627	Not Available	607	Open in IMG/M
3300015343\|Ga0182155_1210850	Not Available	515	Open in IMG/M
3300015343\|Ga0182155_1213727	Not Available	512	Open in IMG/M
3300015343\|Ga0182155_1217601	Not Available	509	Open in IMG/M
3300015344\|Ga0182189_1042275	Not Available	924	Open in IMG/M
3300015344\|Ga0182189_1074958	Not Available	760	Open in IMG/M
3300015344\|Ga0182189_1183677	Not Available	547	Open in IMG/M
3300015345\|Ga0182111_1013063	Not Available	1410	Open in IMG/M
3300015345\|Ga0182111_1026810	Not Available	1125	Open in IMG/M
3300015345\|Ga0182111_1054082	Not Available	884	Open in IMG/M
3300015345\|Ga0182111_1056921	Not Available	868	Open in IMG/M
3300015345\|Ga0182111_1072730	Not Available	795	Open in IMG/M
3300015345\|Ga0182111_1075350	Not Available	785	Open in IMG/M
3300015345\|Ga0182111_1111207	Not Available	681	Open in IMG/M
3300015345\|Ga0182111_1115874	Not Available	671	Open in IMG/M
3300015345\|Ga0182111_1148810	Not Available	610	Open in IMG/M
3300015345\|Ga0182111_1231809	Not Available	513	Open in IMG/M
3300015346\|Ga0182139_1129672	Not Available	644	Open in IMG/M
3300015346\|Ga0182139_1132779	Not Available	638	Open in IMG/M
3300015346\|Ga0182139_1163641	Not Available	589	Open in IMG/M
3300015347\|Ga0182177_1057905	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	869	Open in IMG/M
3300015347\|Ga0182177_1071452	Not Available	804	Open in IMG/M
3300015351\|Ga0182161_1025872	Not Available	1207	Open in IMG/M
3300015351\|Ga0182161_1028675	Not Available	1165	Open in IMG/M
3300015351\|Ga0182161_1079732	Not Available	808	Open in IMG/M
3300015351\|Ga0182161_1156540	Not Available	623	Open in IMG/M
3300015351\|Ga0182161_1203469	Not Available	562	Open in IMG/M
3300015351\|Ga0182161_1205645	Not Available	559	Open in IMG/M
3300015351\|Ga0182161_1215823	Not Available	548	Open in IMG/M
3300015355\|Ga0182159_1026525	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1410	Open in IMG/M
3300015355\|Ga0182159_1030034	Not Available	1351	Open in IMG/M
3300015355\|Ga0182159_1051568	Not Available	1111	Open in IMG/M
3300015355\|Ga0182159_1125687	Not Available	781	Open in IMG/M
3300015355\|Ga0182159_1200827	Not Available	642	Open in IMG/M
3300015355\|Ga0182159_1236104	Not Available	598	Open in IMG/M
3300015355\|Ga0182159_1256903	Not Available	577	Open in IMG/M
3300015355\|Ga0182159_1295909	Not Available	542	Open in IMG/M
3300015355\|Ga0182159_1311423	Not Available	530	Open in IMG/M
3300015361\|Ga0182145_1012284	Not Available	1205	Open in IMG/M
3300015361\|Ga0182145_1015883	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1118	Open in IMG/M
3300015361\|Ga0182145_1066479	Not Available	720	Open in IMG/M
3300015361\|Ga0182145_1111275	Not Available	607	Open in IMG/M
3300015361\|Ga0182145_1178502	Not Available	517	Open in IMG/M
3300015361\|Ga0182145_1180427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	515	Open in IMG/M
3300017404\|Ga0182203_1025833	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	896	Open in IMG/M
3300017404\|Ga0182203_1035314	Not Available	817	Open in IMG/M
3300017409\|Ga0182204_1101067	Not Available	530	Open in IMG/M
3300017410\|Ga0182207_1067487	Not Available	693	Open in IMG/M
3300017410\|Ga0182207_1096647	Not Available	617	Open in IMG/M
3300017410\|Ga0182207_1103706	Not Available	603	Open in IMG/M
3300017413\|Ga0182222_1075117	Not Available	553	Open in IMG/M
3300017417\|Ga0182230_1095818	Not Available	546	Open in IMG/M
3300017420\|Ga0182228_1082646	Not Available	591	Open in IMG/M
3300017420\|Ga0182228_1115019	Not Available	525	Open in IMG/M
3300017420\|Ga0182228_1117774	Not Available	520	Open in IMG/M
3300017424\|Ga0182219_1127140	Not Available	518	Open in IMG/M
3300017425\|Ga0182224_1151756	Not Available	517	Open in IMG/M
3300017425\|Ga0182224_1153623	Not Available	515	Open in IMG/M
3300017425\|Ga0182224_1157650	Not Available	510	Open in IMG/M
3300017427\|Ga0182190_1013250	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1154	Open in IMG/M
3300017427\|Ga0182190_1028964	Not Available	902	Open in IMG/M
3300017427\|Ga0182190_1124484	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	555	Open in IMG/M
3300017430\|Ga0182192_1053353	Not Available	754	Open in IMG/M
3300017430\|Ga0182192_1120422	Not Available	571	Open in IMG/M
3300017430\|Ga0182192_1126013	Not Available	563	Open in IMG/M
3300017430\|Ga0182192_1127375	Not Available	560	Open in IMG/M
3300017433\|Ga0182206_1158403	Not Available	503	Open in IMG/M
3300017436\|Ga0182209_1088659	Not Available	626	Open in IMG/M
3300017438\|Ga0182191_1005645	Not Available	1493	Open in IMG/M
3300017438\|Ga0182191_1043272	Not Available	809	Open in IMG/M
3300017438\|Ga0182191_1182738	Not Available	502	Open in IMG/M
3300017442\|Ga0182221_1142759	Not Available	532	Open in IMG/M
3300017442\|Ga0182221_1170686	Not Available	502	Open in IMG/M
3300017443\|Ga0182193_1017501	Not Available	1097	Open in IMG/M
3300017683\|Ga0182218_1110860	Not Available	557	Open in IMG/M
3300017685\|Ga0182227_1081126	Not Available	611	Open in IMG/M
3300017686\|Ga0182205_1074492	Not Available	665	Open in IMG/M
3300017686\|Ga0182205_1078991	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	653	Open in IMG/M
3300017686\|Ga0182205_1103297	Not Available	597	Open in IMG/M
3300017686\|Ga0182205_1162496	Not Available	512	Open in IMG/M
3300025935\|Ga0207709_11369237	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	586	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	98.75%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.62%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	98.75%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.62%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	98.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.62%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	98.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.62%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068866_109721531	3300005718	Miscanthus Rhizosphere	MQPVREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQADYTQGQS*
Ga0182122_10228261	3300015267	Miscanthus Phyllosphere	MQPVREAVSYRGLFTVGWFGVREKHYSRLEIYDRLRASEQ
Ga0182113_10525151	3300015269	Miscanthus Phyllosphere	MQPVREAVSYRGLFTVGWFGMREKHCFRLEIYDRLRASEQADDILG*
Ga0182188_10295961	3300015274	Miscanthus Phyllosphere	QPVQETVSYRELFTACWFDVKEKHCSQLKIYDRLRASKQAANQW*
Ga0182128_10494882	3300015277	Miscanthus Phyllosphere	MCHAPKQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASE
Ga0182160_10425391	3300015281	Miscanthus Phyllosphere	VREAVSYRGLFTAGWFGVREKHCFRLEIYDRLRAREQAASS*
Ga0182124_10025791	3300015282	Miscanthus Phyllosphere	IQPVREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQADYTQGQS*
Ga0182124_10799751	3300015282	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAA*
Ga0182156_10114153	3300015283	Miscanthus Phyllosphere	FQPVREAVSYRGLFTAGWFGVREKHYSRLEIYDRLRASEQTDKCL*
Ga0182156_10142141	3300015283	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAV*
Ga0182156_10505691	3300015283	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHSSWLEIYDRLRASEQADGSAELFS*
Ga0182156_10704352	3300015283	Miscanthus Phyllosphere	AVSYRGLFTAGWFGVREKHCSRLEIYDHLRASEQADSKYVLMMN*
Ga0182176_10379081	3300015286	Miscanthus Phyllosphere	PVREAVSYRGLFTVGWFGVREKHCSRLKIYDRLRASEQAARA*
Ga0182176_10588192	3300015286	Miscanthus Phyllosphere	MQPVREAVSYRGLFTVGWFGVREKHCSRREIYDRLRTSEQADDPRGRGGAGA
Ga0182171_10768001	3300015287	Miscanthus Phyllosphere	LSFITLCQPVREAVSYRGLFTAGWFDVREKHYFRLKIYDRLRGNEQV*
Ga0182173_10236261	3300015288	Miscanthus Phyllosphere	MQPVREAVSYRGLFTVGWFGMREKHCSRLKIYDRLRASEQA
Ga0182173_10251942	3300015288	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCFRLEIYDRLRASEHAAK*
Ga0182125_10531051	3300015291	Miscanthus Phyllosphere	VSAGYIVQPVRETVLDRGLFTAGWFGVREKHCFWLEIYDRLRPSE
Ga0182125_10679881	3300015291	Miscanthus Phyllosphere	MVMRADCQPVREAVSYRGLFTAGWFGVREKHCSRLKIYDRLRASEQAA
Ga0182126_10491341	3300015294	Miscanthus Phyllosphere	MQPVQEAVSYRGLFTADWFGVREKHCSRLEIYDRLRASEQAD
Ga0182126_10502391	3300015294	Miscanthus Phyllosphere	MQVVRVHKQPVREAVSYRGLFTAGWFGVRKKYCFRLEIYDRLRASEQAE
Ga0182126_10597531	3300015294	Miscanthus Phyllosphere	QPVREVVSYRGLFTTGWFGVRKKYCSRLEIYDRLRASEHADIYAIKI*
Ga0182175_10070771	3300015295	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQ
Ga0182175_10393001	3300015295	Miscanthus Phyllosphere	REAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQA*
Ga0182175_10708821	3300015295	Miscanthus Phyllosphere	MNSCNNQPVREAVSYRGLFTAGWFDVREKHCSRLEIYDRLRASEQA
Ga0182157_10782161	3300015296	Miscanthus Phyllosphere	VPHKHKQHVREAVSYRGLFIVGWFGVREKHCSRLEIYDRLRA
Ga0182106_10167381	3300015298	Miscanthus Phyllosphere	VREAVSYRGLFTAGWFGVREKHCSRLKIYDRLRASEQAAHGGVRAAHLT*
Ga0182108_10095961	3300015300	Miscanthus Phyllosphere	LPDSHNYQPVREAISYRGLFTVGWFGVREKHCSRLEIYDHLRASEQAI*
Ga0182108_10260031	3300015300	Miscanthus Phyllosphere	LRDITNDLQPVREAVSYRGLFTAGWFGVREKHCSRLKIYDRLRASEQAA
Ga0182108_10569531	3300015300	Miscanthus Phyllosphere	VREAVNYRGLFTAGWFGVREKHGSRLEIYDRLRASEQLKTC*
Ga0182108_10900333	3300015300	Miscanthus Phyllosphere	RTYRNKPIQEAVSYRGLFTAGWFGVRKKYCSRLKIYDRLRANEQTED*
Ga0182123_10095392	3300015303	Miscanthus Phyllosphere	PVREVVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQALII*
Ga0182123_10693281	3300015303	Miscanthus Phyllosphere	MDNQPVREAVSYRGLRGLFTAGWFGVREKYCSRLEIYDRLRASEQAEYYF*
Ga0182123_10887362	3300015303	Miscanthus Phyllosphere	MERTSNQPVRKAVSYRGLFTAGWFGVREKHCFRLKIYDRLRANEQADG
Ga0182112_10816291	3300015304	Miscanthus Phyllosphere	MPYQPVREAVSYRGLFTAGWFGVREKYCSRLEIYDRLRASEQAVCCLVT*
Ga0182112_11004961	3300015304	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCFRLKIYDRLRASEQANGSRGEF*
Ga0182158_10646971	3300015305	Miscanthus Phyllosphere	HALRFQHVQEAVNDRGLFTASWFGVREKYYSQLEIYDRLRASEQALL*
Ga0182140_10116241	3300015314	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVRGKHCFRLEIYDRLRGSEQAADHENV*
Ga0182140_10347121	3300015314	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQADST*
Ga0182140_10650351	3300015314	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCFRLKIYDRLRASKQAKIKRF*
Ga0182127_10239071	3300015321	Miscanthus Phyllosphere	MHQPVRKTVSYRGLFTAGWFGMREKHYSRLEIYDRLRASE
Ga0182110_10481951	3300015322	Miscanthus Phyllosphere	YQPVREAVSYRGLFTAGWFGVREKNCSRLKIYDRLRASEQAV*
Ga0182110_10733231	3300015322	Miscanthus Phyllosphere	YQPVREAVNDRGLFTAGWFGVREKHYSQLKIYDRLRASE*
Ga0182110_10975421	3300015322	Miscanthus Phyllosphere	MKERKAKPPVREAVSYRGLFTAGWFDVREKHYSRLEIYDRLRA
Ga0182129_10845531	3300015323	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLKIYDRLRASEQA
Ga0182129_11026191	3300015323	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQAAWSC*
Ga0182187_10317681	3300015341	Miscanthus Phyllosphere	MQHVREAVSYHRLFIVGWFGVKENHCFQLEIYDHLRASEQADVGRQ*
Ga0182187_10353042	3300015341	Miscanthus Phyllosphere	NYQPVREAVSYRGLFTAGWFGVREKRCSRLKIYDRLRASEQAVCY*
Ga0182187_10515061	3300015341	Miscanthus Phyllosphere	PVREVVSYRGLFTAGWFGVREKHCSPLEIYDRLRASEQAANRCYCA*
Ga0182187_11219321	3300015341	Miscanthus Phyllosphere	MLARANNRPLREAVSYRGLFTAGRFGVREKHCSQLEIYDRLRASEQ
Ga0182187_11599141	3300015341	Miscanthus Phyllosphere	REAVSYRELFTAGWFGVREKHYFLKIYDRLRASEHAE
Ga0182187_11723171	3300015341	Miscanthus Phyllosphere	REAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAEEIQEIFR*
Ga0182109_10007152	3300015342	Miscanthus Phyllosphere	REAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASKQADDIQYP*
Ga0182109_10875521	3300015342	Miscanthus Phyllosphere	QPVREAVLYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAV*
Ga0182109_11341491	3300015342	Miscanthus Phyllosphere	EAVNDRGLFTAGFGVREKHYFQLKIYGRLRANEQAEEQ
Ga0182109_11505771	3300015342	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSSLKIYDRLRASEQAE*
Ga0182155_11192101	3300015343	Miscanthus Phyllosphere	MDSQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQA
Ga0182155_11310841	3300015343	Miscanthus Phyllosphere	EAVSYRGLFTAGWLSVREKYYSRLKIYDRLRVREQAG*
Ga0182155_11356272	3300015343	Miscanthus Phyllosphere	MQPVRKSVSYRGLFTVGGFGVREKYGFWLEIYDRLRASEQADGGLVFPKN*
Ga0182155_12108501	3300015343	Miscanthus Phyllosphere	LAIHQPVWEAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAD
Ga0182155_12137271	3300015343	Miscanthus Phyllosphere	QPVREAVNDRGLFTAGWFGVREKHYSWLEIYDCLRASEQAVYI*
Ga0182155_12176011	3300015343	Miscanthus Phyllosphere	QPIREAVSYRGLFTAGWFGVREKHGSRLEIYDRLRASE*
Ga0182189_10422751	3300015344	Miscanthus Phyllosphere	QPVREAVSYRELFTAGWFGVTEKHCSQLEIYDRLRASEQAEKG*
Ga0182189_10749581	3300015344	Miscanthus Phyllosphere	AVSYRGLFTAGWFDVREKRCFLEIYDRLRASEQAE
Ga0182189_11187751	3300015344	Miscanthus Phyllosphere	VSYRGLFTAGWFGVREKYCFRLKIYDRLRASEQAANSFAN*
Ga0182189_11836771	3300015344	Miscanthus Phyllosphere	MQPVQETVSYRGLFTAGWFGVREKHYSQLEIYDRLRASEQ
Ga0182111_10130633	3300015345	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHYFQLEIYDRLRASEQG*
Ga0182111_10268101	3300015345	Miscanthus Phyllosphere	VPNYQPVREAVNDRGLFTAGWFCVREKHYSWLEIYDRLRASEQ
Ga0182111_10540821	3300015345	Miscanthus Phyllosphere	MPAHTQPVREAVSYRGLFTAGGFSVREKHYCWREIYDRLRASEQA
Ga0182111_10569211	3300015345	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDCLRASEQAYGII*
Ga0182111_10727301	3300015345	Miscanthus Phyllosphere	MEGTDIQPVRETVSYRGLFTAGWFGVREKHCSRLKIYDRLRASEQA
Ga0182111_10753501	3300015345	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHYSQLVIYDRLRASEQADDQRC*
Ga0182111_11009551	3300015345	Miscanthus Phyllosphere	EAVSYRGLFTAGWFGVREKYCSQLEIYNRLRASEQAESCMIR*
Ga0182111_11112072	3300015345	Miscanthus Phyllosphere	AVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADISLR*
Ga0182111_11158741	3300015345	Miscanthus Phyllosphere	QINDVQPVREAVSYRGLFTAGWFDVREKHCSRLEIYDRLRASEQAAYCN*
Ga0182111_11488101	3300015345	Miscanthus Phyllosphere	VIQLVRETISYRGLFIAGWFGVREKHCSRLEIYDRLRASEQADCS*
Ga0182111_12318091	3300015345	Miscanthus Phyllosphere	NQAVREAISYRELFSTDWFGVREKHSFWLKIYDRLRASEQAE*
Ga0182139_11296721	3300015346	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGMREKHCSRLEIYDRLRASEQADEH*
Ga0182139_11327791	3300015346	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHYSRLEIYDRLRANEQAAYMQI*
Ga0182139_11636411	3300015346	Miscanthus Phyllosphere	QPVREAVSYHGLFTVDWFGVKEKHCSRLEIYDCLRASEQAVRSQAHT*
Ga0182177_10261412	3300015347	Miscanthus Phyllosphere	QPVRKAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAASEFEHFLM*
Ga0182177_10579051	3300015347	Miscanthus Phyllosphere	QPVWEAVSYRGLFTAGWFGVREKHYSWLEIYDRLRENEHAK*
Ga0182177_10714521	3300015347	Miscanthus Phyllosphere	NQPVREAVSYRGLFTAGWFGVREKHYSRLEMYNRLRASEQVEYSKSM*
Ga0182177_11819341	3300015347	Miscanthus Phyllosphere	MAHQPVREAVSYRGLFTAGWFDMREKHCYRLEIYDRLRASEQAACPH*
Ga0182161_10258722	3300015351	Miscanthus Phyllosphere	LLSVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASKQAACPQAQ*
Ga0182161_10286751	3300015351	Miscanthus Phyllosphere	QPIREAVSYRGLFTAGWFGVREKHYSPLEIYDRLRASEQAVCNWFCN*
Ga0182161_10797321	3300015351	Miscanthus Phyllosphere	MCVYLQPVREAVNDRGLFTAGWFGVREKHRFWLKIYDRLRTSEQAAN
Ga0182161_11565401	3300015351	Miscanthus Phyllosphere	MDHQPVREAVSYRGLFTADWFGVREKHCFRLEIYDRLRASEQANID*
Ga0182161_12034691	3300015351	Miscanthus Phyllosphere	MALVGNNQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADE*
Ga0182161_12056451	3300015351	Miscanthus Phyllosphere	VREAVNDRGLFTADWFGVREKHCSWLEIYDRLRASEQAAS*
Ga0182161_12158231	3300015351	Miscanthus Phyllosphere	QPVWEAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASERTDRW*
Ga0182161_12318261	3300015351	Miscanthus Phyllosphere	MFSKEMQPVREAVSYRGLFTAGWFGVREKHCSRLEI
Ga0182159_10265253	3300015355	Miscanthus Phyllosphere	VSINLQPVREAVSYRGLFTAGWFGVREKHCFLLEIYDRLRASEQAEILVG*
Ga0182159_10300341	3300015355	Miscanthus Phyllosphere	EAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEHA*
Ga0182159_10515681	3300015355	Miscanthus Phyllosphere	QPVREAVSYRGLFTADWFGVREKHYSRLEIYDRLRASEQAVRPK*
Ga0182159_11256871	3300015355	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAEDHWPF*
Ga0182159_11355521	3300015355	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLR
Ga0182159_12008271	3300015355	Miscanthus Phyllosphere	NQPVREAVSYRGLFTSGWFGVREKHCFRLKIYDRLRASKQADIQ*
Ga0182159_12361041	3300015355	Miscanthus Phyllosphere	MLVREAVNDRGLFTAGWFGVREKHYYWLEIYDFLRASEL
Ga0182159_12569031	3300015355	Miscanthus Phyllosphere	MCHAPKQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAE
Ga0182159_12959092	3300015355	Miscanthus Phyllosphere	VREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRANEQAARFDL*
Ga0182159_13114231	3300015355	Miscanthus Phyllosphere	MKHLGDNQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQA
Ga0182145_10122842	3300015361	Miscanthus Phyllosphere	VREAVNDRELFTAGWFGVREKHCSWLEIYVRLQANEQAEE*
Ga0182145_10128521	3300015361	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEHA*
Ga0182145_10158832	3300015361	Miscanthus Phyllosphere	VREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASKQADDIQYP*
Ga0182145_10664791	3300015361	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGMREKHCSRLEIYDRLRASEQA
Ga0182145_11112751	3300015361	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCFWLEIYDRLRASEQAEY*
Ga0182145_11785022	3300015361	Miscanthus Phyllosphere	EAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADRCHH*
Ga0182145_11804271	3300015361	Miscanthus Phyllosphere	MNSCNNQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAE
Ga0182203_10258331	3300017404	Miscanthus Phyllosphere	PVREAVSYRGLFTADWFDVREKYCSRLEIYDRLRASEQAVYTY
Ga0182203_10353141	3300017404	Miscanthus Phyllosphere	MLIALNALQPVREAVSYRGLFTAVWFGVREKHCSRLEIYDRLRASEQA
Ga0182220_11058211	3300017407	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAV
Ga0182204_11010672	3300017409	Miscanthus Phyllosphere	LLEKVTTEDNQPVREAVSYRGIFTAGWFGVREKHYSRLEIYDRLRASEQAEC
Ga0182207_10674872	3300017410	Miscanthus Phyllosphere	VREAISYRGLFTAGWFGVREKHCSRLKIYDRLRASEQAASCYP
Ga0182207_10966471	3300017410	Miscanthus Phyllosphere	ANKQPVREAVSYRGLFTAGWFGVREKHCFQLEIYDRLRANEQAKVPNEISG
Ga0182207_11037061	3300017410	Miscanthus Phyllosphere	DSSPETVARQPVREALSYRGLFTAGWFGVREKHYSRLEIYDRLRASE
Ga0182207_11121271	3300017410	Miscanthus Phyllosphere	RTMKPSLHQPVREAVSYRGLFTADWFDVREKYCSRLEIYDRLRASDRVAY
Ga0182222_10751171	3300017413	Miscanthus Phyllosphere	YQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAS
Ga0182230_10958181	3300017417	Miscanthus Phyllosphere	MVGAFNQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRANEQADYSP
Ga0182228_10826461	3300017420	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEQAECSSNHINA
Ga0182228_11150191	3300017420	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADSI
Ga0182228_11177741	3300017420	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAV
Ga0182219_11271401	3300017424	Miscanthus Phyllosphere	MQIIAIQPVREAVSCRGLFTAGWFGVREKHCSWLEIYDRLRASEQ
Ga0182224_11517562	3300017425	Miscanthus Phyllosphere	QPVRETVSYRGLFTAGWFGMREKHCFRLKIYDRLRANEQTE
Ga0182224_11536231	3300017425	Miscanthus Phyllosphere	EEITYGARDIQPVWEAVSYRGLFTAGWFGVSEKHCSQLEIYDRLRASEQA
Ga0182224_11576502	3300017425	Miscanthus Phyllosphere	CAQQQPVREAVNDRGLFTAGWFGVREKHCSRLEIYDRLRASERAV
Ga0182190_10132501	3300017427	Miscanthus Phyllosphere	VPSIDIQPVREAVSYRGLFTAGWFGVREKHCFRLEIYDRLRASE
Ga0182190_10289641	3300017427	Miscanthus Phyllosphere	QPVREAVSYRGLFTVGWFGVREKHCSRLKIYDRLRASEQAKRLII
Ga0182190_10735301	3300017427	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKYCSRLKIYDRLRVNEQAE
Ga0182190_11026591	3300017427	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQAANHC
Ga0182190_11244841	3300017427	Miscanthus Phyllosphere	QPVREAVSYRGLFTADWFGVREKYCSQLEIYDRLRASEQAVSI
Ga0182192_10533531	3300017430	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRTSEQAIVSLFT
Ga0182192_11204221	3300017430	Miscanthus Phyllosphere	MQHVREAVSYRGLFTAGWFGVREKYCFRLKIYDRLRANEQATWSVALA
Ga0182192_11209871	3300017430	Miscanthus Phyllosphere	VRKAVSYRGLFTAGWFDVREKHCSRLKIYDHLRVSE
Ga0182192_11260131	3300017430	Miscanthus Phyllosphere	EAVSYRGLFTAGWFGVREKYYSRLEIYDRLRASEQADNKRP
Ga0182192_11273752	3300017430	Miscanthus Phyllosphere	MRRTFTDKQSARETVSYRGLFTASWFGMREKHYFQLEIYDRLRTSEQAECT
Ga0182206_11358931	3300017433	Miscanthus Phyllosphere	QHVREAVSYRGLFTADWFGVREKHCSRLEIYDRLRANEQAA
Ga0182206_11584031	3300017433	Miscanthus Phyllosphere	QPIREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADKG
Ga0182209_10886591	3300017436	Miscanthus Phyllosphere	LQVDQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRAS
Ga0182191_10056451	3300017438	Miscanthus Phyllosphere	QPVREAVSYRGLFTADWFGVREKHCFRLKIYDRLRASEQAEC
Ga0182191_10432722	3300017438	Miscanthus Phyllosphere	IQPVREAVSYRGLFTAGWFGVREKHCFWLEIYDRLRASEQAAT
Ga0182191_11827381	3300017438	Miscanthus Phyllosphere	QPVREALLYRVLFTVVWFGVREKHCSRLEIYDRLRASEQEADG
Ga0182221_10130201	3300017442	Miscanthus Phyllosphere	RPVREAVSYRGLFTAGWFGVRKKYCSRLKIYDRLRASEQAANSFRLYH
Ga0182221_10975322	3300017442	Miscanthus Phyllosphere	MQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRAS
Ga0182221_11355051	3300017442	Miscanthus Phyllosphere	EYNHPVREAVSYRGLFTAGWFSVRGKHCSRLEIYDRLRASEQAD
Ga0182221_11427591	3300017442	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFSVREKHCSRLKIYDRLRASERAILR
Ga0182221_11706861	3300017442	Miscanthus Phyllosphere	MSLPVREAVSYRGLFTAGWFGVREKHCFRLEIYDRLRASEQ
Ga0182193_10129341	3300017443	Miscanthus Phyllosphere	AVSYRGLFTVGWFDVREKHCSWLEIYDCLRASEQSDS
Ga0182193_10175011	3300017443	Miscanthus Phyllosphere	PVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEHAAYKLKDLYI
Ga0182193_10491241	3300017443	Miscanthus Phyllosphere	MSMNLSQRPVREAVSYRGLFTVGWFGVREKHCSRLKIYDRLRASEQAAR
Ga0182218_10442151	3300017683	Miscanthus Phyllosphere	ISEYGIQPVREAVSYRGLFTAGWFGVREKHCSRLKIYDRLRVSE
Ga0182218_10778551	3300017683	Miscanthus Phyllosphere	EAVSYRGLFTAGWFGVREKHCSWLEIYDRLRASEEAVARFKK
Ga0182218_11108601	3300017683	Miscanthus Phyllosphere	MVYQPVREAVSYHGLFTVDWFGVKEKHCSRLEIYDCLRASEQAVRSQAHT
Ga0182227_10811261	3300017685	Miscanthus Phyllosphere	MQPVRETVKDRGLFTAGWFGVKEKYYSWLEIYDRLRASEQAVCHPPLHRQP
Ga0182205_10744921	3300017686	Miscanthus Phyllosphere	DFQPVRFVVNDRGLFTAGWFGVREKYCSQLIIHDHIRASEQTVYL
Ga0182205_10789911	3300017686	Miscanthus Phyllosphere	QPVREAVSYRGLFTAGWFDVTEKHCSRLEIYDRLQASETRKR
Ga0182205_11032971	3300017686	Miscanthus Phyllosphere	PVREAVSYRGLFTVGWFGVREKHCSWLEIYDRLRASEQADYCRTHSAYV
Ga0182205_11516211	3300017686	Miscanthus Phyllosphere	QPVQEAVSYRGLFTAGWFGVREKHCSRLEIYDRLRANEQAVEF
Ga0182205_11624961	3300017686	Miscanthus Phyllosphere	VREAVNDRGLFTAGWFGVRKKHCSWLEIYDHLRASEQAARLLHF
Ga0207709_113692372	3300025935	Miscanthus Rhizosphere	KQPVREAVSYRGLFTAGWFGVREKHCSRLEIYDRLRASEQADNGQ

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F040952

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign