Basic Information | |
---|---|
Family ID | F041201 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 160 |
Average Sequence Length | 44 residues |
Representative Sequence | LVQDRGGAEFQTGGILLYVEDLKRGTNKDIGPKDIFEMGS |
Number of Associated Samples | 72 |
Number of Associated Scaffolds | 160 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 54.49 % |
% of genes near scaffold ends (potentially truncated) | 57.50 % |
% of genes from short scaffolds (< 2000 bps) | 71.25 % |
Associated GOLD sequencing projects | 60 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment (19.375 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.625 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (51.875 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 160 Family Scaffolds |
---|---|---|
PF02653 | BPD_transp_2 | 2.50 |
PF00909 | Ammonium_transp | 2.50 |
PF00027 | cNMP_binding | 1.88 |
PF01467 | CTP_transf_like | 1.88 |
PF07883 | Cupin_2 | 1.88 |
PF00416 | Ribosomal_S13 | 1.88 |
PF13414 | TPR_11 | 1.88 |
PF00582 | Usp | 1.25 |
PF00005 | ABC_tran | 1.25 |
PF01850 | PIN | 1.25 |
PF02730 | AFOR_N | 1.25 |
PF04012 | PspA_IM30 | 1.25 |
PF14353 | CpXC | 1.25 |
PF02566 | OsmC | 1.25 |
PF00557 | Peptidase_M24 | 1.25 |
PF07238 | PilZ | 1.25 |
PF02353 | CMAS | 1.25 |
PF00941 | FAD_binding_5 | 1.25 |
PF04879 | Molybdop_Fe4S4 | 1.25 |
PF13189 | Cytidylate_kin2 | 1.25 |
PF00701 | DHDPS | 1.25 |
PF14691 | Fer4_20 | 0.62 |
PF00708 | Acylphosphatase | 0.62 |
PF00332 | Glyco_hydro_17 | 0.62 |
PF02283 | CobU | 0.62 |
PF00107 | ADH_zinc_N | 0.62 |
PF00155 | Aminotran_1_2 | 0.62 |
PF05258 | DciA | 0.62 |
PF05173 | DapB_C | 0.62 |
PF04333 | MlaA | 0.62 |
PF01556 | DnaJ_C | 0.62 |
PF05762 | VWA_CoxE | 0.62 |
PF02803 | Thiolase_C | 0.62 |
PF01336 | tRNA_anti-codon | 0.62 |
PF01970 | TctA | 0.62 |
PF13633 | Obsolete Pfam Family | 0.62 |
PF00691 | OmpA | 0.62 |
PF02518 | HATPase_c | 0.62 |
PF04095 | NAPRTase | 0.62 |
PF02597 | ThiS | 0.62 |
PF03450 | CO_deh_flav_C | 0.62 |
PF00912 | Transgly | 0.62 |
PF04199 | Cyclase | 0.62 |
PF13426 | PAS_9 | 0.62 |
PF12399 | BCA_ABC_TP_C | 0.62 |
PF00596 | Aldolase_II | 0.62 |
PF00535 | Glycos_transf_2 | 0.62 |
PF01558 | POR | 0.62 |
PF00378 | ECH_1 | 0.62 |
PF02782 | FGGY_C | 0.62 |
PF04945 | YHS | 0.62 |
PF01813 | ATP-synt_D | 0.62 |
PF00881 | Nitroreductase | 0.62 |
PF12697 | Abhydrolase_6 | 0.62 |
PF10437 | Lip_prot_lig_C | 0.62 |
PF09832 | DUF2059 | 0.62 |
PF04246 | RseC_MucC | 0.62 |
PF13458 | Peripla_BP_6 | 0.62 |
PF13432 | TPR_16 | 0.62 |
PF00293 | NUDIX | 0.62 |
PF01564 | Spermine_synth | 0.62 |
PF03767 | Acid_phosphat_B | 0.62 |
PF13646 | HEAT_2 | 0.62 |
PF05170 | AsmA | 0.62 |
PF07992 | Pyr_redox_2 | 0.62 |
PF00676 | E1_dh | 0.62 |
PF02954 | HTH_8 | 0.62 |
PF01694 | Rhomboid | 0.62 |
PF14574 | RACo_C_ter | 0.62 |
PF07478 | Dala_Dala_lig_C | 0.62 |
PF01208 | URO-D | 0.62 |
PF03968 | LptD_N | 0.62 |
PF13511 | DUF4124 | 0.62 |
PF05544 | Pro_racemase | 0.62 |
PF13676 | TIR_2 | 0.62 |
PF01070 | FMN_dh | 0.62 |
PF08443 | RimK | 0.62 |
PF05494 | MlaC | 0.62 |
PF16657 | Malt_amylase_C | 0.62 |
PF03061 | 4HBT | 0.62 |
PF00534 | Glycos_transf_1 | 0.62 |
PF00892 | EamA | 0.62 |
PF01575 | MaoC_dehydratas | 0.62 |
PF02885 | Glycos_trans_3N | 0.62 |
PF04226 | Transgly_assoc | 0.62 |
PF00266 | Aminotran_5 | 0.62 |
PF03692 | CxxCxxCC | 0.62 |
PF11874 | DUF3394 | 0.62 |
PF03328 | HpcH_HpaI | 0.62 |
PF04551 | GcpE | 0.62 |
PF01613 | Flavin_Reduct | 0.62 |
PF02881 | SRP54_N | 0.62 |
PF02738 | MoCoBD_1 | 0.62 |
PF12710 | HAD | 0.62 |
PF01039 | Carboxyl_trans | 0.62 |
PF13672 | PP2C_2 | 0.62 |
PF00579 | tRNA-synt_1b | 0.62 |
COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
---|---|---|---|
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 2.50 |
COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 2.50 |
COG1842 | Phage shock protein A | Transcription [K] | 2.50 |
COG0099 | Ribosomal protein S13 | Translation, ribosomal structure and biogenesis [J] | 1.88 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.25 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.25 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.25 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 1.25 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 1.25 |
COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 1.25 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.62 |
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.62 |
COG0289 | 4-hydroxy-tetrahydrodipicolinate reductase | Amino acid transport and metabolism [E] | 0.62 |
COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.62 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.62 |
COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.62 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.62 |
COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 0.62 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.62 |
COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.62 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.62 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.62 |
COG1394 | Archaeal/vacuolar-type H+-ATPase subunit D/Vma8 | Energy production and conversion [C] | 0.62 |
COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.62 |
COG1784 | TctA family transporter | General function prediction only [R] | 0.62 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.62 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.62 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.62 |
COG2087 | Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase | Coenzyme transport and metabolism [H] | 0.62 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.62 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.62 |
COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.62 |
COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 0.62 |
COG2853 | Lipoprotein subunit MlaA of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG3086 | RseC, positive regulator of sigma E activity | Signal transduction mechanisms [T] | 0.62 |
COG3333 | TctA family transporter | General function prediction only [R] | 0.62 |
COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 0.62 |
COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.62 |
COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.62 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.62 |
COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG5309 | Exo-beta-1,3-glucanase, GH17 family | Carbohydrate transport and metabolism [G] | 0.62 |
COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.00 % |
Unclassified | root | N/A | 25.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001687|WOR8_10007805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 10200 | Open in IMG/M |
3300001687|WOR8_10029240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 5704 | Open in IMG/M |
3300001687|WOR8_10033428 | All Organisms → cellular organisms → Bacteria | 7727 | Open in IMG/M |
3300001706|JGI2161J19892_1002279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2888 | Open in IMG/M |
3300001706|JGI2161J19892_1006313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobotulus → Desulfobotulus mexicanus | 1615 | Open in IMG/M |
3300001855|JGI2160J19893_10002078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. BuS5 | 5872 | Open in IMG/M |
3300001855|JGI2160J19893_10004518 | All Organisms → cellular organisms → Bacteria | 3698 | Open in IMG/M |
3300001855|JGI2160J19893_10038183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1012 | Open in IMG/M |
3300001855|JGI2160J19893_10080712 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300001855|JGI2160J19893_10083381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
3300003988|Ga0055475_10089475 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300003989|Ga0055473_10002874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3747 | Open in IMG/M |
3300004004|Ga0055451_10351991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 607 | Open in IMG/M |
3300004029|Ga0055442_10198791 | Not Available | 658 | Open in IMG/M |
3300004055|Ga0055480_10302489 | Not Available | 647 | Open in IMG/M |
3300004147|Ga0055515_10248135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 524 | Open in IMG/M |
3300005214|Ga0069002_10151029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 618 | Open in IMG/M |
3300005589|Ga0070729_10241829 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300005589|Ga0070729_10312632 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300005589|Ga0070729_10317414 | Not Available | 875 | Open in IMG/M |
3300005590|Ga0070727_10092309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio → Desulfovibrio inopinatus | 1748 | Open in IMG/M |
3300005590|Ga0070727_10569909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 634 | Open in IMG/M |
3300005600|Ga0070726_10126333 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
3300005600|Ga0070726_10351122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina alkanivorans | 744 | Open in IMG/M |
3300005600|Ga0070726_10367255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 725 | Open in IMG/M |
3300005600|Ga0070726_10624717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfarculales → Desulfarculaceae → Desulfarculus → unclassified Desulfarculus → Desulfarculus sp. | 544 | Open in IMG/M |
3300005601|Ga0070722_10010284 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
3300005601|Ga0070722_10057483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1402 | Open in IMG/M |
3300005601|Ga0070722_10172239 | Not Available | 878 | Open in IMG/M |
3300005601|Ga0070722_10181546 | Not Available | 858 | Open in IMG/M |
3300005609|Ga0070724_10073802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1476 | Open in IMG/M |
3300005612|Ga0070723_10169432 | Not Available | 980 | Open in IMG/M |
3300005612|Ga0070723_10537754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 581 | Open in IMG/M |
3300005920|Ga0070725_10401205 | Not Available | 611 | Open in IMG/M |
3300005920|Ga0070725_10483091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfarculales → Desulfarculaceae → Desulfarculus → unclassified Desulfarculus → Desulfarculus sp. | 556 | Open in IMG/M |
3300005920|Ga0070725_10495554 | Not Available | 550 | Open in IMG/M |
3300005920|Ga0070725_10521522 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300006467|Ga0099972_12890836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 541 | Open in IMG/M |
3300008062|Ga0114372_1034639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 609 | Open in IMG/M |
3300009027|Ga0102957_1220223 | Not Available | 683 | Open in IMG/M |
3300009035|Ga0102958_1216616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 643 | Open in IMG/M |
3300009060|Ga0102962_1257106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 508 | Open in IMG/M |
3300009145|Ga0102961_1106681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 718 | Open in IMG/M |
3300009488|Ga0114925_10355816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 1004 | Open in IMG/M |
3300009506|Ga0118657_10017253 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 13116 | Open in IMG/M |
3300009506|Ga0118657_10023204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum aliphaticivorans | 9761 | Open in IMG/M |
3300009506|Ga0118657_10028086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 8812 | Open in IMG/M |
3300009506|Ga0118657_10037715 | All Organisms → cellular organisms → Bacteria | 7509 | Open in IMG/M |
3300009506|Ga0118657_10039233 | All Organisms → cellular organisms → Bacteria | 7350 | Open in IMG/M |
3300009506|Ga0118657_10076105 | All Organisms → cellular organisms → Bacteria | 5020 | Open in IMG/M |
3300009506|Ga0118657_10083747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 4739 | Open in IMG/M |
3300009506|Ga0118657_10164428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3142 | Open in IMG/M |
3300009506|Ga0118657_10189324 | All Organisms → cellular organisms → Bacteria | 2878 | Open in IMG/M |
3300009506|Ga0118657_10201325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 5291 | Open in IMG/M |
3300009506|Ga0118657_10315966 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
3300009506|Ga0118657_10326817 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
3300009506|Ga0118657_10406034 | All Organisms → cellular organisms → Bacteria | 3196 | Open in IMG/M |
3300009506|Ga0118657_10674568 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300009506|Ga0118657_10791074 | Not Available | 1184 | Open in IMG/M |
3300009506|Ga0118657_11168482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium PC51MH44 | 928 | Open in IMG/M |
3300009506|Ga0118657_11223740 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira → Nitrospira bacterium SG8_3 | 902 | Open in IMG/M |
3300009509|Ga0123573_10002745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 21076 | Open in IMG/M |
3300009509|Ga0123573_10017728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 8038 | Open in IMG/M |
3300009509|Ga0123573_10500927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1155 | Open in IMG/M |
3300009509|Ga0123573_11251994 | Not Available | 692 | Open in IMG/M |
3300010392|Ga0118731_102080295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 977 | Open in IMG/M |
3300010392|Ga0118731_105520980 | Not Available | 826 | Open in IMG/M |
3300010392|Ga0118731_107889960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium SEEP-SAG10 | 841 | Open in IMG/M |
3300010392|Ga0118731_107891927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 607 | Open in IMG/M |
3300010392|Ga0118731_108046266 | Not Available | 1198 | Open in IMG/M |
3300010392|Ga0118731_109015752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1566 | Open in IMG/M |
3300010392|Ga0118731_109816685 | Not Available | 811 | Open in IMG/M |
3300010392|Ga0118731_111092097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 520 | Open in IMG/M |
3300010412|Ga0136852_11374708 | Not Available | 669 | Open in IMG/M |
3300010413|Ga0136851_10199254 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 2065 | Open in IMG/M |
3300010413|Ga0136851_10394443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1392 | Open in IMG/M |
3300010413|Ga0136851_10498469 | Not Available | 1214 | Open in IMG/M |
3300010413|Ga0136851_10511347 | Not Available | 1197 | Open in IMG/M |
3300010413|Ga0136851_10681925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1013 | Open in IMG/M |
3300010413|Ga0136851_11129837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_48_10 | 759 | Open in IMG/M |
3300010413|Ga0136851_11241386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 720 | Open in IMG/M |
3300010413|Ga0136851_11838573 | Not Available | 580 | Open in IMG/M |
3300010430|Ga0118733_102202684 | Not Available | 1094 | Open in IMG/M |
3300010430|Ga0118733_104156789 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300010430|Ga0118733_104618946 | Not Available | 733 | Open in IMG/M |
3300010430|Ga0118733_108032002 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300014903|Ga0164321_10722903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
3300019711|Ga0193993_1019940 | Not Available | 745 | Open in IMG/M |
3300019717|Ga0193972_1001766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1625 | Open in IMG/M |
3300019718|Ga0193999_1024369 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300019737|Ga0193973_1069311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 512 | Open in IMG/M |
3300019739|Ga0194012_1053841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300019740|Ga0193988_1078061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300019753|Ga0194010_1017488 | Not Available | 980 | Open in IMG/M |
3300019753|Ga0194010_1115652 | Not Available | 513 | Open in IMG/M |
3300022201|Ga0224503_10014054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium | 2291 | Open in IMG/M |
3300022201|Ga0224503_10206840 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300022202|Ga0224498_10018532 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis | 1886 | Open in IMG/M |
3300022206|Ga0224499_10050450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium | 1370 | Open in IMG/M |
3300022218|Ga0224502_10204992 | Not Available | 757 | Open in IMG/M |
3300022220|Ga0224513_10036591 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10480250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 531 | Open in IMG/M |
(restricted) 3300024338|Ga0255043_10050013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1278 | Open in IMG/M |
(restricted) 3300024338|Ga0255043_10055507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1225 | Open in IMG/M |
(restricted) 3300024340|Ga0255042_10178835 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
(restricted) 3300024519|Ga0255046_10007461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 3505 | Open in IMG/M |
(restricted) 3300024519|Ga0255046_10505041 | Not Available | 580 | Open in IMG/M |
(restricted) 3300024528|Ga0255045_10485709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 512 | Open in IMG/M |
3300025566|Ga0210140_1081474 | Not Available | 645 | Open in IMG/M |
3300025797|Ga0210062_1009989 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
3300025801|Ga0210097_1032814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatitalea → Desulfatitalea tepidiphila | 1164 | Open in IMG/M |
3300025813|Ga0210064_1009410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2926 | Open in IMG/M |
3300025983|Ga0210106_1052418 | Not Available | 664 | Open in IMG/M |
3300026106|Ga0209927_1060378 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300027814|Ga0209742_10000464 | All Organisms → cellular organisms → Bacteria | 21531 | Open in IMG/M |
3300027814|Ga0209742_10001070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 13139 | Open in IMG/M |
3300027814|Ga0209742_10011648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2968 | Open in IMG/M |
3300027820|Ga0209578_10261507 | Not Available | 811 | Open in IMG/M |
3300027828|Ga0209692_10156067 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300027828|Ga0209692_10265382 | Not Available | 767 | Open in IMG/M |
3300027845|Ga0209271_10267664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 687 | Open in IMG/M |
3300027845|Ga0209271_10372563 | Not Available | 565 | Open in IMG/M |
(restricted) 3300027856|Ga0255054_10000822 | All Organisms → cellular organisms → Bacteria | 18241 | Open in IMG/M |
(restricted) 3300027856|Ga0255054_10002780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 9928 | Open in IMG/M |
(restricted) 3300027856|Ga0255054_10003764 | All Organisms → cellular organisms → Bacteria | 8444 | Open in IMG/M |
(restricted) 3300027881|Ga0255055_10119636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1449 | Open in IMG/M |
(restricted) 3300027881|Ga0255055_10652507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 562 | Open in IMG/M |
3300027917|Ga0209536_100013372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 11840 | Open in IMG/M |
3300027917|Ga0209536_100054497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5231 | Open in IMG/M |
3300027917|Ga0209536_100056280 | All Organisms → cellular organisms → Bacteria | 5130 | Open in IMG/M |
3300027917|Ga0209536_100328709 | Not Available | 1913 | Open in IMG/M |
3300027917|Ga0209536_100430752 | Not Available | 1648 | Open in IMG/M |
3300027917|Ga0209536_100527266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1473 | Open in IMG/M |
3300027917|Ga0209536_101208417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 927 | Open in IMG/M |
3300027917|Ga0209536_102360471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 630 | Open in IMG/M |
3300027978|Ga0209165_10135984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 857 | Open in IMG/M |
3300028420|Ga0210366_10421094 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 562 | Open in IMG/M |
3300028599|Ga0265309_10812911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 639 | Open in IMG/M |
3300028600|Ga0265303_10959961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
3300031691|Ga0316579_10110122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
3300031691|Ga0316579_10469280 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 609 | Open in IMG/M |
3300032136|Ga0316201_11024420 | Not Available | 694 | Open in IMG/M |
3300032231|Ga0316187_10059029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → unclassified Desulfobacter → Desulfobacter sp. | 3049 | Open in IMG/M |
3300032231|Ga0316187_10101938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2254 | Open in IMG/M |
3300032231|Ga0316187_10126122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfohalobiaceae → Desulfovermiculus → Desulfovermiculus halophilus | 2001 | Open in IMG/M |
3300032231|Ga0316187_10211574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1495 | Open in IMG/M |
3300032231|Ga0316187_10379450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1070 | Open in IMG/M |
3300032252|Ga0316196_10023103 | All Organisms → cellular organisms → Bacteria | 2928 | Open in IMG/M |
3300032252|Ga0316196_10142951 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300032252|Ga0316196_10237049 | Not Available | 805 | Open in IMG/M |
3300032260|Ga0316192_10111970 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
3300032260|Ga0316192_10417496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfarculales → Desulfarculaceae → Desulfarculus → unclassified Desulfarculus → Desulfarculus sp. | 917 | Open in IMG/M |
3300032260|Ga0316192_10511893 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300033429|Ga0316193_10205695 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
3300033429|Ga0316193_10306428 | Not Available | 1260 | Open in IMG/M |
3300034782|Ga0373573_0007626 | Not Available | 2763 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 19.38% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 13.75% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 10.62% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 8.12% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 7.50% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 5.62% |
Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 5.62% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 5.00% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.00% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.12% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 3.75% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 3.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.50% |
Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.25% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.25% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.62% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.62% |
Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Sediment | 0.62% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.62% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.62% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001687 | Deep Marine Sediments WOR-3-8_10 | Environmental | Open in IMG/M |
3300001706 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 | Environmental | Open in IMG/M |
3300001855 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 | Environmental | Open in IMG/M |
3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
3300003989 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 | Environmental | Open in IMG/M |
3300004004 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 | Environmental | Open in IMG/M |
3300004029 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 | Environmental | Open in IMG/M |
3300004055 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 | Environmental | Open in IMG/M |
3300004147 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 | Environmental | Open in IMG/M |
3300005214 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 | Environmental | Open in IMG/M |
3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
3300008062 | Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - SG7 | Environmental | Open in IMG/M |
3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
3300009060 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MG | Environmental | Open in IMG/M |
3300009145 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG | Environmental | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
3300019711 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MG | Environmental | Open in IMG/M |
3300019717 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_8-9_MG | Environmental | Open in IMG/M |
3300019718 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MG | Environmental | Open in IMG/M |
3300019737 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MG | Environmental | Open in IMG/M |
3300019739 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_8-9_MG | Environmental | Open in IMG/M |
3300019740 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_4-5_MG | Environmental | Open in IMG/M |
3300019753 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_6-7_MG | Environmental | Open in IMG/M |
3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
3300024338 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9 | Environmental | Open in IMG/M |
3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
3300025566 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025797 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025801 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025813 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025983 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026106 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
3300027814 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes) | Environmental | Open in IMG/M |
3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Host-Associated | Open in IMG/M |
3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
3300034782 | Sediment microbial communities from coastal wetland in Texas, United States - D0606M02 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
WOR8_100078051 | 3300001687 | Marine Sediment | RDRRGGVEFQTAGNLLVVEDLKRGTNKDMGPKEIFELASKTFP* |
WOR8_100292403 | 3300001687 | Marine Sediment | LVQDRGGAEFQTGGILGYVEDLKRGTNKDIGPKDIFEMASKKSKV* |
WOR8_100334285 | 3300001687 | Marine Sediment | LVSDRGGAEFQTAGNLRVVEDLKRGANKDMGPKDIFEKASRLYQILTF* |
JGI2161J19892_10022791 | 3300001706 | Marine Sediment | MLVPDRGGAEFQTAGNLLVVEDLKRGSNKDMGLKDIFEIASLKDPQYNCPNC |
JGI2161J19892_10063134 | 3300001706 | Marine Sediment | NRILVPDRGGAEFQTAGNLWVFEDLKRGTNKDMGPKDIFEMVSSA* |
JGI2160J19893_100020782 | 3300001855 | Marine Sediment | LVQDRDGAEFKTAGNLLVVEDLKRGTNKDMGPKDIFEIASNFMYAI* |
JGI2160J19893_100045181 | 3300001855 | Marine Sediment | NRILVPDRGGAEFKTAGNLLVVEDLKRGTNKEMGPKDIFEIGSTYKHRTLW* |
JGI2160J19893_100381832 | 3300001855 | Marine Sediment | LVPDRSGAEFQTAGNLLVVEDLKRSSNKDMGPKDIFEIASLKDQQYNCSH* |
JGI2160J19893_100807122 | 3300001855 | Marine Sediment | LVQDRGGAEFKTAGILLYVEDFKLGSNKDIGPKDIFELGS |
JGI2160J19893_100833812 | 3300001855 | Marine Sediment | RDGAEFKTAGNLLVVEDLKRGTNKDIGPKDIFEIAAK* |
Ga0055475_100894751 | 3300003988 | Natural And Restored Wetlands | DRGGAEFQIAGILLDANLKRDTNKDIGPKDIFELGSKKAC* |
Ga0055473_100028741 | 3300003989 | Natural And Restored Wetlands | LVQDRGGAELKTGGILLYVEDFKRGPNKDIGPKDFFEMGSSKI* |
Ga0055451_103519911 | 3300004004 | Natural And Restored Wetlands | LVQDLGGAEFKTGGILLYVEDFKRGSNKDIGPKDIFEIGS |
Ga0055442_101987911 | 3300004029 | Natural And Restored Wetlands | LVQDRGGAEFKTGGILLYVEDFKRGANKDIGPKDIFEMGSKEKL* |
Ga0055480_103024892 | 3300004055 | Natural And Restored Wetlands | AEFKTGGILLYVEDFKRGTNKDIGPKDIFEMGSKYPDLRY* |
Ga0055515_102481351 | 3300004147 | Natural And Restored Wetlands | LVQDRGGAEFKTGGILMYVEDFKRGSNKDIGPKDIFEMDS |
Ga0069002_101510292 | 3300005214 | Natural And Restored Wetlands | LAQDRGGAEFKTAGILVYVEDLKRGTNKDMGPKDIFEIASKRFSQASPG* |
Ga0070729_102418292 | 3300005589 | Marine Sediment | FKIRILVQGRGGAEFKTAGILEYFEDFKRGTNKEIGPKDIFEIASR* |
Ga0070729_103126321 | 3300005589 | Marine Sediment | RGGAEFHTGGILWYFEDLKLGTNKEIGTKDIFEMAYN* |
Ga0070729_103174142 | 3300005589 | Marine Sediment | LVQVRGGAEFKTAGIIEYFEDFKLGTNKEIGPKDIFEIAYSLHPMQ* |
Ga0070727_100923092 | 3300005590 | Marine Sediment | LVQDRGGAELQTGGILLYVEDLKRGTNKDIGPKDIFEMASK* |
Ga0070727_105699091 | 3300005590 | Marine Sediment | LVQDRGGAEFQTGGILLYVEDLKRGTNPAKGGRPKDIFEMDSIYLSLRSY* |
Ga0070726_101263332 | 3300005600 | Marine Sediment | LVQDRGGAEFKTGGILLYVEDLKRGTNKDIGPKDIFEMGSNKLERRSLL* |
Ga0070726_103511222 | 3300005600 | Marine Sediment | LVQDRGGAEFHTAGILLYVEDLKRGTNKDIGPKDIFEMGSSNIGGKQRGQ* |
Ga0070726_103672552 | 3300005600 | Marine Sediment | LVQDRGGAEFQTGGILLYVEDLKRGTNKDIGPKDIFEMSSNTIKF* |
Ga0070726_106247171 | 3300005600 | Marine Sediment | LVQDRGGAEFKTGGILLYVEDFKRGTNKDIGPKDIFEMA |
Ga0070722_100102841 | 3300005601 | Marine Sediment | RILVQDRGGAELQTGGILLYVEDLKRGTNKDIGPKDIFEMASK* |
Ga0070722_100574831 | 3300005601 | Marine Sediment | LKNRILVQDRGGAEFQTGGILLYVEDLKLGTNKDIGPKDIFEMVSK* |
Ga0070722_101722393 | 3300005601 | Marine Sediment | RILVQDRGGAELQTGGILLYVEDLKRGTNKDIGPKDIFETASYKVLSLTGI* |
Ga0070722_101815463 | 3300005601 | Marine Sediment | LVQDRGGAEFQTGGILLYVEDLKQGTNKDIGPKDIFEMDSESG* |
Ga0070724_100738021 | 3300005609 | Marine Sediment | GGAEFQTGGILLYVEDLKRGTNKDIGPKDIFEMGSIYLSLRSY* |
Ga0070723_101694321 | 3300005612 | Marine Sediment | LVQDRGGAKFQTGGILLYVEDLKLGTNKDIGPKDIFEM |
Ga0070723_105377542 | 3300005612 | Marine Sediment | LVQDRGGASFQTGGILLYVEDLKRGTNKDIGPKDIFEM |
Ga0070725_104012051 | 3300005920 | Marine Sediment | LVQDRGGAEFQTGGILLYVEDLKLSTNKDIGPKDIFETGS* |
Ga0070725_104830912 | 3300005920 | Marine Sediment | LVQDRGGAEFQTAGILVYVEDLKRGTNPAKGGRPKDIFEMVS |
Ga0070725_104955541 | 3300005920 | Marine Sediment | LVQDRGGASFQTGGILLYVEDLKRGTNKDIGPKDIF |
Ga0070725_105215222 | 3300005920 | Marine Sediment | LVQDRGGAELKTGGILLYVEDLKRDTNKDMGPKDIFEMGSS* |
Ga0099972_128908362 | 3300006467 | Marine | LVQDRGGAEFQTGGILLYVEDLKLSTNKDIGPKDIF |
Ga0114372_10346392 | 3300008062 | Marine Sediment | LVQDSGGAEFKTGGILLYVEDLKRGTNKDIGPKDIFEMG |
Ga0102957_12202232 | 3300009027 | Pond Water | GAEFKTAGILLYVEDLKRGSNKDIGPKDIFELGSNQIIP* |
Ga0102958_12166162 | 3300009035 | Soil | LVQDRGGAEFKTGGILLYVEDFKRGTNKDIGPKDIFEMGSK |
Ga0102962_12571062 | 3300009060 | Soil | LVQDRGGAEFKTGGILLYVEDFKRGTNKDIGPKDIFEMGSKKPSGSSATY* |
Ga0102961_11066812 | 3300009145 | Soil | LVQDRGGAEFQTGGILLYVEDLKRGTNKDMGSKDIFELGSNKKQSG |
Ga0114925_103558162 | 3300009488 | Deep Subsurface | LVQDRGGAELQTGGILLYVEDLKRGTNKDIGPKDIFE |
Ga0118657_100172537 | 3300009506 | Mangrove Sediment | LVQDRGAAEFQTAGNLLVVEDLKRGTNKDIEPKDIFEMGSKNT* |
Ga0118657_100232043 | 3300009506 | Mangrove Sediment | LVQDRGGAEFKTAGNLWVVEDLKRGSNKDMGPKDISEMTSKVN* |
Ga0118657_1002808610 | 3300009506 | Mangrove Sediment | LVPDRGGAEFKTAGNLLVVEDLKQGTNKDMGPKDIFKISSQN* |
Ga0118657_100377155 | 3300009506 | Mangrove Sediment | LVQDRGRAEFQTAGNLLVVEDLKRGTNKDMGPKDIFEIGSHQFNWRGTEYGT* |
Ga0118657_100392333 | 3300009506 | Mangrove Sediment | LVQDRGGAEFQTAGNLLVVEDLKRGTNKDIGPKDIFEMPSSRRRKTNSGFGS* |
Ga0118657_100761052 | 3300009506 | Mangrove Sediment | MLVQDRGGAEFQTAGNLWVVEDLKRGTNKDIGPKDLFEMVFVN* |
Ga0118657_100837473 | 3300009506 | Mangrove Sediment | LVQDRGGAEFQTAGNLLVVEDLKGGTNKDIGPKDIFELDSKSLPDLAADAGV* |
Ga0118657_101644283 | 3300009506 | Mangrove Sediment | LVQDRGGAEFQTAGKLFYVEDLKRDTNKDIGPKDIFEMGSNNR* |
Ga0118657_101893245 | 3300009506 | Mangrove Sediment | LVQNRGGTEFKTAGNLLVVEDLKRGPNKDIGPKDIFGLVSKYSL* |
Ga0118657_102013257 | 3300009506 | Mangrove Sediment | LVQDRGGAEFKTAGNLLVVEDLKRGTNKDIGPKDIFEISST* |
Ga0118657_103159663 | 3300009506 | Mangrove Sediment | LVQNRGGAEFKTEGILLYVEDFKRGTNPAEKGGRPKDIFE* |
Ga0118657_103268171 | 3300009506 | Mangrove Sediment | VQDRGGAEFQTAGNLLVVEDLKRGPNKDIGPKDIFEMGSIQNPGQR* |
Ga0118657_104060342 | 3300009506 | Mangrove Sediment | LVQDRGGAEFKTAGILLYVEDLKRGSNKDIGPKDIFEMASTQF* |
Ga0118657_106745681 | 3300009506 | Mangrove Sediment | LVQDRGGVKFQTAGKLEYVEDLKRGANKDIGPKDIF |
Ga0118657_107910742 | 3300009506 | Mangrove Sediment | GRHLKNRILVQDRGEAEFKTAGNLLVVEDLKRRINKDIGPKDIF* |
Ga0118657_111684822 | 3300009506 | Mangrove Sediment | MRGGAEFQTAGNQLVVEDLKRGSNKDMGPKDIFEMGSTYQ* |
Ga0118657_112237401 | 3300009506 | Mangrove Sediment | LVQDRGGAEYQTAGILLYVEDLKRGTNKDMGPKDIFEMGWNLH |
Ga0123573_100027455 | 3300009509 | Mangrove Sediment | LVPDRSGAAFQTAGNLLVVEDLKRGSNKDMGPKGILEIASLKDQQYNCSH* |
Ga0123573_100177282 | 3300009509 | Mangrove Sediment | LVQDRGGAEFKTAGNLLVVEDLKRGTNKDMGPKDIFEMASS* |
Ga0123573_105009272 | 3300009509 | Mangrove Sediment | LGQNRGGAVFKTGGILQYFEDLKQGTNKEFGPKDIFEIASSYWLIE* |
Ga0123573_112519942 | 3300009509 | Mangrove Sediment | LVPDRGGAEFQTAGNLLVVEDLKRGSNKDMGPKDIFEIASIKRSAI* |
Ga0118731_1020802951 | 3300010392 | Marine | NRILVQDRGGAEFQTGGILLYVEDLKRGTNKDIGPKDIFEMGSS* |
Ga0118731_1055209802 | 3300010392 | Marine | KNRILVQDRGGAEFQTGGILLYVEDLKRGTNKDVGPKDIFEMASG* |
Ga0118731_1078899601 | 3300010392 | Marine | GGAEFLTGGILLYFEDLKPGTNKEIGQKDIFEMPSRY* |
Ga0118731_1078919272 | 3300010392 | Marine | GGAEFQTGGILLYVEDLKLGTNKDIGPKDIFEMVSK* |
Ga0118731_1080462661 | 3300010392 | Marine | LVQDRGGAELLTGGILLYVEDLKRGTNKDIGPKDIF |
Ga0118731_1090157522 | 3300010392 | Marine | LVQDCGGAEFKTGGILLYVEDFKRGTNNDIGPKDIFEMGSKNPYHRGQDDDR* |
Ga0118731_1098166852 | 3300010392 | Marine | LKNRILVQDRGGAEFKTGGILLYVEDFKRGSNKDIGPKDIFEIGS* |
Ga0118731_1110920971 | 3300010392 | Marine | LVQDRGGAKFQTGGILLYVEDLKLGTNKDIGPKDIFEMGSTKNKEVLNHD* |
Ga0136852_113747082 | 3300010412 | Mangrove Sediment | LVPDRSGAAFQTAGNLLVVEDLKRGSNKDMGPKDIFEIASIKRSAI* |
Ga0136851_101992542 | 3300010413 | Mangrove Sediment | LVQDRGRAEFQTAGNLLVVEDLERGTNKDMGPKDIFEIGSHQFNWRGTEYGT* |
Ga0136851_103944432 | 3300010413 | Mangrove Sediment | LVQDRGGAEFKTAGNLLVVEDLKRGTNPAEKGGRPKDIFEMASTEK* |
Ga0136851_104984692 | 3300010413 | Mangrove Sediment | RGGAEFQTAGNLLVVEDLKRGTNKDIGPKDIFAWLLN* |
Ga0136851_105113473 | 3300010413 | Mangrove Sediment | ILVQDRGGIEFKTAGNLLVVEDLKRGPNKDIGPKDIFGLVSKYSL* |
Ga0136851_106819252 | 3300010413 | Mangrove Sediment | LVQDRGGAEFQTAGNPLVVEDLKRGTNPAEKGGRPKDIFEMASS* |
Ga0136851_111298372 | 3300010413 | Mangrove Sediment | GAEFRTAGNLWVVEDSKRGTNTDIGPKDIFEMGSKR* |
Ga0136851_112413862 | 3300010413 | Mangrove Sediment | LVQDRGGTEFKTAGILLVVEDLKRGTNKDIGPKDIFEMSSSYLIGHKP* |
Ga0136851_118385732 | 3300010413 | Mangrove Sediment | LIPDRGGAEFQTAGNLLVVEDLKRGTNKDMGPKDIFERGSMHWDARLP* |
Ga0118733_1022026841 | 3300010430 | Marine Sediment | DRGGAEFKTGGILLYVEDFKRGSNKDIGPKDIFEIGS* |
Ga0118733_1041567892 | 3300010430 | Marine Sediment | ILVQDRGGAEFKTGGILLYVEDFKRGTNPAKGGRPKDIFEMGSNYR* |
Ga0118733_1046189462 | 3300010430 | Marine Sediment | QDRGGAEFKTGGILLYVEDFKRGTNKEVGPKDIFEMSSNKKQSG* |
Ga0118733_1080320021 | 3300010430 | Marine Sediment | LVQDRGGAEFLTAGILLYVEDFKRGTNKDIGPKDIFEMGS |
Ga0164321_107229031 | 3300014903 | Marine Sediment | LVQDRGGAEFQTGGILLYVEDLKRGTNKDIGPKDIFEMGS |
Ga0193993_10199402 | 3300019711 | Sediment | LVQDRGGAEFQTAGILLYVEDLKRGTNKDIGPKDIFEMGSKKSSESSAA |
Ga0193972_10017663 | 3300019717 | Sediment | VQDRGGAEFHTGGILLYVEDLKRGTNKDMGPKDIFEMGSSYLF |
Ga0193999_10243692 | 3300019718 | Sediment | LVKDRGGAKLYTGGILLYVEDLKRGTNKDMGPKDIFEMGSSYLF |
Ga0193973_10693112 | 3300019737 | Sediment | VQDRGGAEFKTAGILLYVEDLKPGTNKDIGPKDIFEMGSW |
Ga0194012_10538411 | 3300019739 | Sediment | LVQDRDGAEFKTAGILLYVEDLKRGTNKDMGPKDIFEMGS |
Ga0193988_10780611 | 3300019740 | Sediment | LVQDRDGAEFKTAGILLYVEDLKRGTNKDMGPKDIFEMGSYH |
Ga0194010_10174882 | 3300019753 | Sediment | HFKNRILVQDRGGAEFKTGGILLYVEDFKRGSNKDIGPKDIFEMGSK |
Ga0194010_11156522 | 3300019753 | Sediment | LVQDRGEAEFQTGGILLYVEDLKRGTNKDMGPKDIFE |
Ga0224503_100140542 | 3300022201 | Sediment | RGGAELKTAGRLLYVEDFKRGTHKDMGPKDIFEMGLKNTT |
Ga0224503_102068401 | 3300022201 | Sediment | DRGGAEFQTAGNLWVVEDLKPGTNKDMGPKDIFEMGSIEKGDDQ |
Ga0224498_100185323 | 3300022202 | Sediment | LVQDRDGAEFKTAGILLYVEDLKRGTNKDMGPKDIFEMGSYHSQ |
Ga0224499_100504502 | 3300022206 | Sediment | TRGGAELKTAGRLLYVEDFKRGTHKDMGPKDIFEMGLKSTT |
Ga0224502_102049921 | 3300022218 | Sediment | LVQDRGGAEFQTAGILLYVEDLKRGTNKDIGPKDIFEMGSKKSFESSAA |
Ga0224513_100365914 | 3300022220 | Sediment | LKNRILVQDRGGAEFKTAGILLYVEDFKRGSNKDIGPKDIFELGSNQIIP |
(restricted) Ga0255040_104802501 | 3300024059 | Seawater | LVQDRGGAEFHTAGILLYVEDLKRGTNKDIGPKDIFEMGSKKKGE |
(restricted) Ga0255043_100500132 | 3300024338 | Seawater | LVQDRGGAEFKTGGILLYVEDLKRGTNKDIGPKDIFEMGSNKLERRSLL |
(restricted) Ga0255043_100555071 | 3300024338 | Seawater | VQDRGGAEFQTGGILLYVEDLKRGTNKDIGPKDIFEMGSIYLSLRSY |
(restricted) Ga0255042_101788352 | 3300024340 | Seawater | LVQDRGGAEFKTGGILLYVEDLKRDTNKDIGPKDIFELGSNKYERRRLL |
(restricted) Ga0255046_100022436 | 3300024519 | Seawater | CGGAEFKTGGILLYVEDFKRGTNKDIGPKDIFEMASSNLLPHTVTARL |
(restricted) Ga0255046_100074615 | 3300024519 | Seawater | QDRGGAEFQTGGILLYVEDLKRDTNKDIGPKDIFEMASG |
(restricted) Ga0255046_105050412 | 3300024519 | Seawater | LKNRILVQDCGGAEFKTAGILLYVEDFKRGSNKDIGPKDIFELGSNQIIP |
(restricted) Ga0255045_104857092 | 3300024528 | Seawater | ILVQDRGGAEFQTGGILLYVEDLKRDTNKDIGPKDIFEMASG |
Ga0210140_10814742 | 3300025566 | Natural And Restored Wetlands | NRILVQDRGGAEFKTGGILLYVEDFKRGANKDIGPKDIFEMGSKEKL |
Ga0210062_10099893 | 3300025797 | Natural And Restored Wetlands | LAQDRGGAEFKTGGILLYVEDFKRGTNKDIELKDIFEMDSK |
Ga0210097_10328141 | 3300025801 | Natural And Restored Wetlands | LVQDRGGVEFQTAGILRYVEDLKRGTNKDIGPKDIFVM |
Ga0210064_10094104 | 3300025813 | Natural And Restored Wetlands | QDRGGVSFQTGGILLYVEDLKRGTNKDIGPKDIFERGSTQSQSIS |
Ga0210106_10524181 | 3300025983 | Natural And Restored Wetlands | KNRILVQDRDGAEFKTAGILLYVEDLKRGTNKDIGPKDIFAIGL |
Ga0209927_10603782 | 3300026106 | Soil | RILVQDRGGSEFQTGGILLYVEDLKRGTNKDIGPKDIFEMGSSYLF |
Ga0209742_100004648 | 3300027814 | Marine Sediment | LVSDRGGAEFQTAGNLRVVEDLKRGANKDMGPKDIFEKASRLYQILTF |
Ga0209742_100010701 | 3300027814 | Marine Sediment | DRDGAEFKTAGNLLVVEDLKRGTNKDIGPKDIFKIASNFMYAI |
Ga0209742_100116483 | 3300027814 | Marine Sediment | DRDGAEFKTAGNLLVVEDLKRGTNKDIGPKDIFEIAAK |
Ga0209742_101473792 | 3300027814 | Marine Sediment | LVQDHGGAEFQTAGNLWVVEDLKRGPNKDIGRKDIFEMDSKRMRCDKSLI |
Ga0209578_102615073 | 3300027820 | Marine Sediment | LVQDRGGAEFQTGGILLYVEDLKQGTNKDIGPKDIFEMD |
Ga0209692_101560672 | 3300027828 | Marine Sediment | NRILVQFRGGAEFKTAGILEYFEDFKRGTNKEIGPKDIFEIASR |
Ga0209692_102653821 | 3300027828 | Marine Sediment | LVQVRGGAEFKTAGIIEYFEDFKLGTNKEIGPKDIFEIAYSLHPMQ |
Ga0209271_100255581 | 3300027845 | Marine Sediment | LVQDRGGAEFQTGGILLYVEDFKGGTNKDIGPKDIFEMGSIISSPIKWFSPLARWH |
Ga0209271_102676642 | 3300027845 | Marine Sediment | LVQVRGGAEFKTAGIIEYFEDFKLGTNKEIGPKDIFEIAYS |
Ga0209271_103725632 | 3300027845 | Marine Sediment | LVQDRGGAEFQTGGILLYVEDLKQGTNKDIGPKDIFEMDSESG |
(restricted) Ga0255054_100008229 | 3300027856 | Seawater | LVQDRGGAEFQTGGILLYVEDLKRGTNKDIGPKDIFEMGSNETGL |
(restricted) Ga0255054_100027801 | 3300027856 | Seawater | NRILVQDRGGAELKTAGILLYVEDLKRGTNKDIGPKDIFEMGSNASPC |
(restricted) Ga0255054_100037648 | 3300027856 | Seawater | LVQDRGGAEFKTAGILLYVEDLKRGTNKEVGPKDIFEMGSKMCCQALNG |
(restricted) Ga0255055_101196361 | 3300027881 | Seawater | GGAELKTAGILLYVEDLKRGTNKDIGPKDIFEMGYRNRQRHPSRMFF |
(restricted) Ga0255055_106525072 | 3300027881 | Seawater | LVQDRGGVEFLTGGILLYVEDYKLGTNKDIGPKDIFELGSRKEVNYEQ |
Ga0209536_1000133721 | 3300027917 | Marine Sediment | GAEFQTAGNLWVVEDLKRGTNKDMGPKDIFEMVSSA |
Ga0209536_1000544973 | 3300027917 | Marine Sediment | LVQDRGGAEFQTGGILGYVEDLKRGTNKDIGPKDIFEMASKKSKV |
Ga0209536_1000562805 | 3300027917 | Marine Sediment | EFKTAGNLLVVEDLKRGTNKEMGPKDIFEIGSTYKHRTLW |
Ga0209536_1003287092 | 3300027917 | Marine Sediment | LVQDRGGAEFQTAGILLYVEDLKRGTNKDIGPKDIFETASNMYYEVYHGE |
Ga0209536_1004307523 | 3300027917 | Marine Sediment | LVPDRGGAEFKTAGNLLVVEDLKRGTNKDMGPKDIFEMASS |
Ga0209536_1005272663 | 3300027917 | Marine Sediment | LVPDRGGAEFQTAGNLLVVEDLKQGTNKDMGPKDIFEITSIKRSAI |
Ga0209536_1012084172 | 3300027917 | Marine Sediment | VQDRGGAEFQTAGILLYVEDLKRGTNKDIGPKDIFELASNNRTA |
Ga0209536_1023604711 | 3300027917 | Marine Sediment | LVQFRGEAEFKTAGILQYFEDFKRGTNKEIGPKDIFEMLL |
Ga0209165_101359841 | 3300027978 | Marine Sediment | LVQDRGGTEFQTGGILLYVEDLKRGTNKDIGPKDIFEMGS |
Ga0210366_104210942 | 3300028420 | Estuarine | VQDRGGAEFKTAGILKYFENFKQGTNKDIGPKDIFKIASSWD |
Ga0265309_108129111 | 3300028599 | Sediment | GAEFKTAGILEYFEDFKRGTNKEIGPKDIFEIASTY |
Ga0265303_109599612 | 3300028600 | Sediment | LVQVRGGAEFKTAGILEYFEDFKRDTNPAEKGGKPKDIFEIASNNN |
Ga0316579_101101222 | 3300031691 | Rhizosphere | LVPDRGGAEFQTAGILLYVEDLKRGTNKDMGPKDIFEMSSK |
Ga0316579_104692801 | 3300031691 | Rhizosphere | ILFQDCGGAEFQTGGILLYVEDLKRGTNKDIGPKDIFELGSNYLQ |
Ga0316201_110244201 | 3300032136 | Worm Burrow | QDRGGAEFQTGGILLYVEDLKRGTNKDIGPKDIIEMGSD |
Ga0316187_100590292 | 3300032231 | Worm Burrow | LVQDRDGVEFHTAGILLYVEDLKRGTNKDFGQKDIFEMGSNKNA |
Ga0316187_101019384 | 3300032231 | Worm Burrow | LVQDRGGAEFHTAGILLYVEDLKRGTNKDIGPKDIFEMGSSNIGGKQRGQ |
Ga0316187_101261223 | 3300032231 | Worm Burrow | DRGGAEFQTGGILLYVEDLKRGTNKDIGPKDIFETASRKVLRWPY |
Ga0316187_102115741 | 3300032231 | Worm Burrow | LVQDRDGAEFKTAGILLYVEDLKRGTNKDMGPKDIFEMGSYHS |
Ga0316187_103794502 | 3300032231 | Worm Burrow | LVQDRGGAEFQTGGILLYVEDLKRGTNKDIGPKDIFEM |
Ga0316196_100231031 | 3300032252 | Sediment | LVQDRGGAELQTGGILLYVEDLKRGTNKDIGPKDIFEMGSKKVTPT |
Ga0316196_100725972 | 3300032252 | Sediment | LVQDRDGVEFHTAGILLYVEDLKRGTNKDIGPKDIFEMGSNKNAENISWTKEILK |
Ga0316196_101429512 | 3300032252 | Sediment | LVQDRGGAELQTGGILLYVEDLKRGTNKDIGPKDIFEMGSTWL |
Ga0316196_102370491 | 3300032252 | Sediment | RILVQDCGGAELHTGGILLYVEDLKRGSNKDIGPKDIFEIDSSDSQV |
Ga0316192_101119702 | 3300032260 | Worm Burrow | QDRGGAELKTGGILLYVEDLKRDTNKDIGPKDIFEMGSS |
Ga0316192_104174961 | 3300032260 | Worm Burrow | LVQDRGGAEFKTGGILLYVEDFKRGTNKDIGPKDIFEM |
Ga0316192_105118933 | 3300032260 | Worm Burrow | RGGAEFKTAGILTYFENFKRGTNKEIGPKDFFEIASSVYCR |
Ga0316193_102056952 | 3300033429 | Sediment | LVQDRGGAEFKTGGILLYVEDFKRGTNKDIGPKDIFEMASSNLLPHTVTARL |
Ga0316193_103064282 | 3300033429 | Sediment | DCGGAEFKTAGILLYVEDFKRGSNKDIGPKDIFEMCSTVRHDSGV |
Ga0373573_0007626_770_898 | 3300034782 | Sediment | LVPDRGGAEFQTAGNLMVVEDLKRGTNKDMGPKDIFETASNI |
⦗Top⦘ |