NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042140

Metagenome / Metatranscriptome Family F042140

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042140
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 60 residues
Representative Sequence KSNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGPQMVWVPKET
Number of Associated Samples 92
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.90 %
% of genes near scaffold ends (potentially truncated) 89.24 %
% of genes from short scaffolds (< 2000 bps) 98.10 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.367 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(75.949 % of family members)
Environment Ontology (ENVO) Unclassified
(93.671 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(74.051 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.02%    β-sheet: 22.89%    Coil/Unstructured: 71.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005445|Ga0070708_101933826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum547Open in IMG/M
3300009092|Ga0105250_10243618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum767Open in IMG/M
3300009101|Ga0105247_10794091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae722Open in IMG/M
3300009975|Ga0105129_106762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum704Open in IMG/M
3300009976|Ga0105128_115788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae564Open in IMG/M
3300009976|Ga0105128_116354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum558Open in IMG/M
3300009976|Ga0105128_120252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum518Open in IMG/M
3300009989|Ga0105131_130094All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum576Open in IMG/M
3300009989|Ga0105131_141083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum516Open in IMG/M
3300009992|Ga0105120_1026435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum668Open in IMG/M
3300009992|Ga0105120_1047744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum538Open in IMG/M
3300009994|Ga0105126_1034237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum607Open in IMG/M
3300009995|Ga0105139_1088407All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum589Open in IMG/M
3300009995|Ga0105139_1091219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum581Open in IMG/M
3300009995|Ga0105139_1096743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum566Open in IMG/M
3300009995|Ga0105139_1117504All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum516Open in IMG/M
3300010399|Ga0134127_12824917All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum565Open in IMG/M
3300010400|Ga0134122_11935089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum626Open in IMG/M
3300010401|Ga0134121_12078940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum602Open in IMG/M
3300010403|Ga0134123_12855952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae552Open in IMG/M
3300015270|Ga0182183_1066187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum566Open in IMG/M
3300015280|Ga0182100_1018052All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae873Open in IMG/M
3300015280|Ga0182100_1032686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum731Open in IMG/M
3300015280|Ga0182100_1046427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae655Open in IMG/M
3300015280|Ga0182100_1092818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum515Open in IMG/M
3300015280|Ga0182100_1097412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum505Open in IMG/M
3300015290|Ga0182105_1054564All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum640Open in IMG/M
3300015290|Ga0182105_1092711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum533Open in IMG/M
3300015293|Ga0182103_1030721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae740Open in IMG/M
3300015293|Ga0182103_1077781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum556Open in IMG/M
3300015297|Ga0182104_1032150All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum789Open in IMG/M
3300015297|Ga0182104_1032321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum788Open in IMG/M
3300015297|Ga0182104_1092551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum555Open in IMG/M
3300015301|Ga0182184_1060801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum600Open in IMG/M
3300015301|Ga0182184_1061176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum599Open in IMG/M
3300015309|Ga0182098_1060143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum656Open in IMG/M
3300015309|Ga0182098_1092999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae565Open in IMG/M
3300015310|Ga0182162_1028720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum851Open in IMG/M
3300015310|Ga0182162_1066389All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum644Open in IMG/M
3300015310|Ga0182162_1099156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum557Open in IMG/M
3300015310|Ga0182162_1106025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum543Open in IMG/M
3300015310|Ga0182162_1115998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum525Open in IMG/M
3300015313|Ga0182164_1082643All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum613Open in IMG/M
3300015315|Ga0182120_1126747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum522Open in IMG/M
3300015315|Ga0182120_1130173All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum516Open in IMG/M
3300015316|Ga0182121_1105103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae577Open in IMG/M
3300015317|Ga0182136_1064177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum678Open in IMG/M
3300015318|Ga0182181_1030048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum793Open in IMG/M
3300015318|Ga0182181_1107158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum517Open in IMG/M
3300015319|Ga0182130_1073772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum633Open in IMG/M
3300015319|Ga0182130_1094137All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum580Open in IMG/M
3300015319|Ga0182130_1120512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae529Open in IMG/M
3300015320|Ga0182165_1085312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum625Open in IMG/M
3300015320|Ga0182165_1109770All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum567Open in IMG/M
3300015324|Ga0182134_1120442All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae546Open in IMG/M
3300015324|Ga0182134_1121563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum544Open in IMG/M
3300015326|Ga0182166_1078551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum635Open in IMG/M
3300015326|Ga0182166_1101089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae579Open in IMG/M
3300015327|Ga0182114_1035946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum893Open in IMG/M
3300015327|Ga0182114_1102453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum609Open in IMG/M
3300015327|Ga0182114_1155823All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum511Open in IMG/M
3300015329|Ga0182135_1132141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum537Open in IMG/M
3300015330|Ga0182152_1069945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum686Open in IMG/M
3300015330|Ga0182152_1121801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum555Open in IMG/M
3300015330|Ga0182152_1150384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum508Open in IMG/M
3300015331|Ga0182131_1082628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum647Open in IMG/M
3300015331|Ga0182131_1116409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum567Open in IMG/M
3300015334|Ga0182132_1121732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae579Open in IMG/M
3300015334|Ga0182132_1144986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum537Open in IMG/M
3300015334|Ga0182132_1158432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum517Open in IMG/M
3300015335|Ga0182116_1029844All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1009Open in IMG/M
3300015335|Ga0182116_1136952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum568Open in IMG/M
3300015335|Ga0182116_1139711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum563Open in IMG/M
3300015335|Ga0182116_1153379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum540Open in IMG/M
3300015335|Ga0182116_1160655All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum529Open in IMG/M
3300015335|Ga0182116_1164151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum524Open in IMG/M
3300015336|Ga0182150_1098097All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum623Open in IMG/M
3300015337|Ga0182151_1022238All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1035Open in IMG/M
3300015337|Ga0182151_1119353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum576Open in IMG/M
3300015337|Ga0182151_1158794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum512Open in IMG/M
3300015338|Ga0182137_1179796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum501Open in IMG/M
3300015339|Ga0182149_1039733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum891Open in IMG/M
3300015339|Ga0182149_1112552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum604Open in IMG/M
3300015340|Ga0182133_1150437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae560Open in IMG/M
3300015340|Ga0182133_1166822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum535Open in IMG/M
3300015340|Ga0182133_1173372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum526Open in IMG/M
3300015348|Ga0182115_1279369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum529Open in IMG/M
3300015349|Ga0182185_1236685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum555Open in IMG/M
3300015349|Ga0182185_1266572All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum522Open in IMG/M
3300015350|Ga0182163_1171063All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum678Open in IMG/M
3300015350|Ga0182163_1240304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum568Open in IMG/M
3300015350|Ga0182163_1247206All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum559Open in IMG/M
3300015350|Ga0182163_1262581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum541Open in IMG/M
3300015350|Ga0182163_1267141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae536Open in IMG/M
3300015352|Ga0182169_1105346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum905Open in IMG/M
3300015352|Ga0182169_1141849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum782Open in IMG/M
3300015352|Ga0182169_1303312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum515Open in IMG/M
3300015353|Ga0182179_1248990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum573Open in IMG/M
3300015353|Ga0182179_1299316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae523Open in IMG/M
3300015353|Ga0182179_1318901All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum507Open in IMG/M
3300017412|Ga0182199_1107240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae648Open in IMG/M
3300017414|Ga0182195_1215431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum508Open in IMG/M
3300017422|Ga0182201_1101631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum570Open in IMG/M
3300017445|Ga0182198_1030332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1002Open in IMG/M
3300017445|Ga0182198_1138179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum586Open in IMG/M
3300017691|Ga0182212_1102679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum642Open in IMG/M
3300017691|Ga0182212_1160269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum514Open in IMG/M
3300017694|Ga0182211_1128726All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum599Open in IMG/M
3300017792|Ga0163161_11915792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Levilactobacillus → Levilactobacillus brevis527Open in IMG/M
3300020031|Ga0182119_107240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum509Open in IMG/M
3300025885|Ga0207653_10065161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1237Open in IMG/M
3300026095|Ga0207676_11801692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum611Open in IMG/M
3300028049|Ga0268322_1055247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum508Open in IMG/M
3300028054|Ga0268306_1019471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum610Open in IMG/M
3300028056|Ga0268330_1023846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum707Open in IMG/M
3300028061|Ga0268314_1024467All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae668Open in IMG/M
3300028062|Ga0268342_1034247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum552Open in IMG/M
3300028143|Ga0268348_1022150All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum531Open in IMG/M
3300028143|Ga0268348_1026039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum505Open in IMG/M
3300028151|Ga0268308_1013563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum675Open in IMG/M
3300028151|Ga0268308_1030388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum521Open in IMG/M
3300028154|Ga0268341_1024845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum545Open in IMG/M
3300028262|Ga0268310_1000351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum2461Open in IMG/M
3300028262|Ga0268310_1024716All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum647Open in IMG/M
3300028262|Ga0268310_1046604All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum523Open in IMG/M
3300028475|Ga0268327_1021198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum545Open in IMG/M
3300028523|Ga0268313_1011706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum593Open in IMG/M
3300032464|Ga0214492_1030144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1037Open in IMG/M
3300032465|Ga0214493_1157902All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae523Open in IMG/M
3300032502|Ga0214490_1113589All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum617Open in IMG/M
3300032502|Ga0214490_1149310All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum528Open in IMG/M
3300032502|Ga0214490_1152168All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum522Open in IMG/M
3300032548|Ga0214483_1064871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum607Open in IMG/M
3300032589|Ga0214500_1112397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum776Open in IMG/M
3300032592|Ga0214504_1060780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum741Open in IMG/M
3300032593|Ga0321338_1029210All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1694Open in IMG/M
3300032593|Ga0321338_1220314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum682Open in IMG/M
3300032698|Ga0214485_1092713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum569Open in IMG/M
3300032698|Ga0214485_1099515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum544Open in IMG/M
3300032757|Ga0314753_1075051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum601Open in IMG/M
3300032758|Ga0314746_1106798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum641Open in IMG/M
3300032761|Ga0314733_1028268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1045Open in IMG/M
3300032791|Ga0314748_1076958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum708Open in IMG/M
3300032811|Ga0314718_1040821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum545Open in IMG/M
3300032822|Ga0314740_1031135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum800Open in IMG/M
3300032824|Ga0314735_1031246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum990Open in IMG/M
3300032825|Ga0314724_100179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum3412Open in IMG/M
3300032845|Ga0314727_1038510All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum661Open in IMG/M
3300032875|Ga0314737_1010097All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1447Open in IMG/M
3300032917|Ga0314721_124000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae644Open in IMG/M
3300032934|Ga0314741_1065335All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum846Open in IMG/M
3300032934|Ga0314741_1127989All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum575Open in IMG/M
3300032959|Ga0314738_1013230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1365Open in IMG/M
3300033526|Ga0314761_1087251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum693Open in IMG/M
3300033526|Ga0314761_1123554All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum573Open in IMG/M
3300033530|Ga0314760_1052804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1004Open in IMG/M
3300033533|Ga0314770_1007110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum2468Open in IMG/M
3300033534|Ga0314757_1026061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1336Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere75.95%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere9.49%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated8.23%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300020031Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028061Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028143Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028151Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028154Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028475Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028523Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032464Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032548Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032589Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032592Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032757Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032758Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032811Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032822Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032824Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032825Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032845Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032875Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032917Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032934Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033533Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033534Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070708_10193382613300005445Corn, Switchgrass And Miscanthus RhizosphereKKLTIKSSLIYTKPNRRNKSNSTSYVIKKNTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGPQMVWVPKET*
Ga0105250_1024361813300009092Switchgrass RhizosphereKKKTNSKVVAHKVGKQEKSWNHSIWVPKEIITNMKGPQMVWVPKET*
Ga0105247_1079409113300009101Switchgrass RhizosphereSNNTSYMIKKKINDKVVAHKVAKQERSWNHSIWVPKNVITNMKGPQMVWVPKET*
Ga0105129_10676223300009975Switchgrass AssociatedMIKKKDNGKVVAHKVGKKDWSWNRSIWVPKEVITNMKGPQMVWVPKDT*
Ga0105128_11578813300009976Switchgrass AssociatedVIKKKTNDKVVAHKVGKIEMSLNRSIWVPKELITNMNGPQMVWVPKET*
Ga0105128_11635413300009976Switchgrass AssociatedVIKKKTNGKVVAHKVGKKERSWNRPIWVPKDVIINMKGLQMVWVPKEI*
Ga0105128_12025213300009976Switchgrass AssociatedRKNKSNSTSYVIKKNTNGKMVAHKIGKKERSWNHSIWVPRDIITNFKGPQMVWVLKET*
Ga0105131_13009413300009989Switchgrass AssociatedMIKKKDNGKVVAHKVGKKDWSWNRSIWVPKKVITNMKGSQMVWVPKDT*
Ga0105131_14108313300009989Switchgrass AssociatedSLIYTKPNRRNKSNSTTYVIKKKTNGKVVAHKVGKQERSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0105120_102643513300009992Switchgrass AssociatedNKSNSTSYMIKKKTNGKVVAHKVGKKERSWNHSIWVPKNIITNMKGPQMLWVPKET*
Ga0105120_104774413300009992Switchgrass AssociatedNKKKLTIKSSLIYTKPNWTNKSHSTSYVIKKKTNGKVVAHKVGKQERSWNHSIWVPKDIITNMKGSQMVWVPKKT*
Ga0105126_103423713300009994Switchgrass AssociatedIYTKPNWRNKNNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGSQKVWVPKET*
Ga0105139_108840713300009995Switchgrass AssociatedPQPRKKLPDEKNKKKLTIKSSLICTKPNLRNKSNSTSYVIKKNTNGKVIAHKVGKKERSWNRSIWVPRDIITNLKGPQMVWVPKET*
Ga0105139_109121913300009995Switchgrass AssociatedYMIKKKDNGKVVAHKVGKKDWSWNRSIWVPKEVITNMKGPQMVWVPKDT*
Ga0105139_109674313300009995Switchgrass AssociatedSLIYTKPNRRNKNNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITKLKGPQMVWVPKET*
Ga0105139_111750413300009995Switchgrass AssociatedNKKKLTIKSSLVYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNLKGPQIVWVPKET*
Ga0134127_1282491713300010399Terrestrial SoilKSSLIYTKPNRRNKSNNTSYVIKKTNGKVVAHKVGKKERSWNRSIWVPKDIITNMKGPQMVWVPKET*
Ga0134122_1193508913300010400Terrestrial SoilLIYTKPNRRNKINSTTYVIKKKTNGKVVAHKVGKQEKSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0134121_1207894013300010401Terrestrial SoilKSNSTSYVIKKKTNGKVVAHKVGKKEMSWNHSIWVPKDIITNMKGPQMVWVPKET*
Ga0134123_1285595213300010403Terrestrial SoilMAAGLPLIYAKPNRRNQSNSTTYMIKKKTYGKVVAHKVGKKERSWNHSIWVPKDVITNMKGPQMVWVAKET*
Ga0182183_106618713300015270Switchgrass PhyllosphereKKLSDEKNKKKLTIKSSLIYTKPNRRNKSHSTSYVIKKNTNGKVVAHKIGKQERSWNHSIWVSKDVITNMKGPQIVWVPKET*
Ga0182100_101805223300015280Switchgrass PhyllosphereVIKKKTNGKVVAHKVRKKERSWNSSIWVLKEIITNMKGPQMVWVPKET*
Ga0182100_103268613300015280Switchgrass PhyllosphereNSTSYVVKQKTKGKVVAHKVGKKERSWNRSIWVPKDIITNMKGPQMVWVPKET*
Ga0182100_104642713300015280Switchgrass PhyllosphereSMVVAHKIGKQERSCNHFIWVPKDVITNMKGPQMVWVPKET*
Ga0182100_109281813300015280Switchgrass PhyllosphereKSNSTSYVIKKKTNGKVVAHKVGKKERSWNHSICVPKDIITNLKGP*
Ga0182100_109741233300015280Switchgrass PhyllosphereMKKLTIKSSLIYTKSNRRNKSHITSYVIKKKTNGKVVAHKVVKKERSWNHSIWVPKDIITNMKGPQ
Ga0182105_105456413300015290Switchgrass PhyllosphereNKKKLTIKSSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKQEKSWNHPIWVPKDIIINIKGPQMVWVPKET*
Ga0182105_109271113300015290Switchgrass PhyllosphereLDEKNKKKRTINSFLIYTKPNRRNKSNSTIYMIKKKTNGKVVAHKVGKQERSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0182103_103072113300015293Switchgrass PhyllosphereMARWLLTRLGRRNKINSTSYVIKKKINGKVVAHKIGKKKRSWNHSIWVPKDIITNMKGPQMVWVPKET*
Ga0182103_107778113300015293Switchgrass PhyllosphereKIPDEKNKKNLSIMSYLIYTKSNRRNKSKRTSYIIKKMNNGRMVAYKVGKKDWSWNRSIWVPKEVITNMKGPQMVWVPKET*
Ga0182104_103215013300015297Switchgrass PhyllosphereMIKKKDNDKVVAHKVGKKDWSWNRSIWVPKEVITNMKGPQMVWVPKDT*
Ga0182104_103232113300015297Switchgrass PhyllospherePNRRNKSNSTSYVIKKKTNGKVVAHKVGKQERNWNHPIWVPKGVIINMKGPQMVWVPKET
Ga0182104_109255113300015297Switchgrass PhyllosphereSSLIYTKPNRRNKNNSTSYVIKKKTNGKEVAHKVGKKERSWNRSIWVPKEIITNMKGP*
Ga0182184_106080113300015301Switchgrass PhyllosphereRNKSNSTSYVIKKKTNGKVVAHKVGKQERSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0182184_106117613300015301Switchgrass PhyllosphereKTNGKVVVHKVGKQGRSWNHSIWVPKDVITNMKGPQMVWVPKDT*
Ga0182098_106014313300015309Switchgrass PhyllosphereKKKLTIKSSLIYTKPNRRNKSNSTTYVIKKKTNGKVVAHKVGKQEKSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0182098_109299913300015309Switchgrass PhyllospherePNRKNKSKSSTYMIKIKANGKVVAHKVGKKERSWNHSIWVPKDIITNMKGSQMVCVTKET
Ga0182162_102872013300015310Switchgrass PhyllosphereNKKKLTIKNFLIYTKPNRRNKSHSTSYVIKKKTNGKVVAHKVGKKERSWNRPIWVPKEIITNMKGPQMVWVSKET*
Ga0182162_106638913300015310Switchgrass PhyllosphereMIKKKTNGKVVAHKVAKKERSWNRSIWVPKEVITYMKGHQMVWVPKET*
Ga0182162_109915613300015310Switchgrass PhyllosphereRNKSNSTSYVIKKKTNGKVIAHKVVKKERSWNHSIWVPKDIITNMNGPQMVWVPKDT*
Ga0182162_110602513300015310Switchgrass PhyllosphereYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKQERSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0182162_111599813300015310Switchgrass PhyllosphereTKPNRRNKSNSTSYVIKKKTNGKVVAHQVGKKERSWNHSIWVPKDIITNMKGPQTVWVPKET*
Ga0182164_108264313300015313Switchgrass PhyllosphereKKKLTIKSSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKQERSWNRPIWVPKDDIINMKGPQMVWVPKET*
Ga0182120_112674713300015315Switchgrass PhyllosphereLIYTKPNRRNKSNSTTYVIKKKTNGKVVAHKVGKQEKSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0182120_113017313300015315Switchgrass PhyllosphereKLSDEKNMKKLTIKSSLIYTKSNRRNKSHITSYVIKKKTNDKMVAHKVGKQERSWNHSIWVPKEIITNMKGPQMVWVPKES*
Ga0182121_110510313300015316Switchgrass PhyllosphereIKKTNGKMVAHKVEKKERSWNHSIWVPKDIITNIKGPKIVWVPKET*
Ga0182136_106417713300015317Switchgrass PhyllosphereKKNNSTSYVIKKKTNGKVVAHKVGKKERSWNRPIWVPKEIITNMKGPQMVWVSKET*
Ga0182181_103004823300015318Switchgrass PhyllosphereSDEKNKKKLTIKSSLIYTKPNQRNKSNSTTYVIKKKTNGKVVAHKVGKQEKSWNRPIWVPKDIIINMKGPQMVWVPKET*
Ga0182181_110715813300015318Switchgrass PhyllosphereNRRNKSDSTSYMIKKKTNGKVVAHKVGKKERSWNRSIWVPKEVITNMKEPQMVWVPKDT*
Ga0182130_107377213300015319Switchgrass PhyllosphereKKLTIKSSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGSQTVWVPKET*
Ga0182130_109413723300015319Switchgrass PhyllosphereSYVIKKKTNGKVVAHKVGKQERSWNHSIWVPKDVITNMKGPQMVWVPKET*
Ga0182130_112051213300015319Switchgrass PhyllosphereKMPSKAKHEERTQRNKSNSTIYVIKKKTNGNVVAHKVGKQERSWNHSIWVSKDVITNMKGAQMVWVPKET*
Ga0182165_108531213300015320Switchgrass PhyllosphereRNKSNSTSYMIKKKTNGKVVAHKVAKKERSWNRSIWVPKEVITNMKGHQMVWVPKET*
Ga0182165_110977013300015320Switchgrass PhyllosphereTTYVIKKKTNGKVVAHKVGKQEKSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0182134_112044213300015324Switchgrass PhyllosphereITIKSSLINTKPNQRNKSNSTSYMIKKKTNGKVVAHKVAKKEGSWNRSIWVPKKVITNMKGHQMVWVPKET*
Ga0182134_112156313300015324Switchgrass PhyllosphereKKKTNGKVVAHKVGKQERSWNHSIWVPKEIITNMKGPQMVWVPKET*
Ga0182166_107855123300015326Switchgrass PhyllosphereMIKKKTNGKVVAHKVAKKERSWNRSIWVPKEVITNMKGHQMVWVP
Ga0182166_110108923300015326Switchgrass PhyllosphereIKSSLIYTKPNRKNKSKSTTYMIKKKENEKVVAHKVGKQEMSWNHSIWMPNDVISKMKWPQMVWVPNET*
Ga0182114_103594623300015327Switchgrass PhyllosphereMIKKKDNGKMVAHKVGKKDWSWNRSIWVPKEVITNMKGHQMVWVPKDI*
Ga0182114_110245313300015327Switchgrass PhyllosphereNLTIKSSPIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDVITNMKGAQMVWVPKET*
Ga0182114_115582313300015327Switchgrass PhyllosphereNSTTYMIKKKTNGKLVAHKVGKQERSWNHSIWVPKDIITNMKGPQMVWVPNET*
Ga0182135_113214113300015329Switchgrass PhyllosphereMIKKKDNGKVVAHKVGKKESSLNHSIWVPKDIITNMKGPQMMWVPKET*
Ga0182152_106994513300015330Switchgrass PhyllosphereMIKKKTNGKVVAHKVAKKERSWNRSIWVPKEVITNMKGHQMVWVPKET*
Ga0182152_112180113300015330Switchgrass PhyllosphereKKKDNGKVVAHKVGKKDWSWNRSIWVPKEVITNMKGHQMVWVPKDI*
Ga0182152_115038413300015330Switchgrass PhyllosphereNKKKLTIKSSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKKERSWNYSILVPKDIITNMKGPQMVWVPKET*
Ga0182131_108262813300015331Switchgrass PhyllosphereLDEKNKKKLTIKSSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVVKQERSWNHSIWVPKDIITNMKGAQMVWVPKET*
Ga0182131_111640913300015331Switchgrass PhyllosphereRRNKSHSTSYVIKKKTNGKVVAHKIGKQERSWNHSIWVPKEVITNMKGPQIVWVPKDT*
Ga0182132_112173213300015334Switchgrass PhyllosphereYVIKKNTNGKVVAHKVGKKERSWNRSIWVPKKINNNMKGPQMVWVLKDT*
Ga0182132_114498613300015334Switchgrass PhyllosphereQPEEQKQKLQIKKKSNGKVVAHKVRKKDWSWNLSIWVPKEVITNMKGPQMLWVPKET*
Ga0182132_115843213300015334Switchgrass PhyllosphereMIKKKTNGKVVAHKVGKKERSWNRPTCVPKDIITNMKGPQMVWVSKET
Ga0182116_102984413300015335Switchgrass PhyllosphereKSNSTTYVVKKKSNGKVVAHKIGKQERSWNRPIWVPKDIITNMKGPQMVWVPKET*
Ga0182116_113695213300015335Switchgrass PhyllosphereSKSTSYVIKKKSNGKVVAHKFGKKDWSWNRSIWVPKEIITNMKGPQMVWVPKDT*
Ga0182116_113971113300015335Switchgrass PhyllosphereKKKLTIKSSLIYTKPNRRNKSHSTSYVIKKKTNGKVVAHKIGKQERSWNHSIWVPKDVITNMKGPQIVWVPKET*
Ga0182116_115337913300015335Switchgrass PhyllosphereKITIKSSLIYTKPNRKNKSKSTTYMIKKDNDKAVAHKVGKKDWSWNRSIWVPKEVITNMKGPQMVWVPKDT*
Ga0182116_116065513300015335Switchgrass PhyllosphereKKKINGKVVAHKVGKKEKSWNHSIWVPKDVITNMKGTQMVWVPKET*
Ga0182116_116415113300015335Switchgrass PhyllosphereKPNRKNKSKSTTYMIKKKDNGKVVAHKVGNKDWSWNRSIWVPKEVITNMKGPQMVWVLKDT*
Ga0182150_109809713300015336Switchgrass PhyllosphereMIKKKTNGKVVAHKIGKQEKSWNHSIWMPKDVITNMKGPQMV*
Ga0182151_102223823300015337Switchgrass PhyllosphereMIKKKTNGKVVAHKVGKKERGWNHSIWVPKDIIANMKGPQMVWVPKKI*
Ga0182151_111935313300015337Switchgrass PhyllosphereEKNKKKITIKSSLIYTKPNWKNKSKNTTYMITKKDNGKVIAHKVGKKDWSWNRSIWVPKKVITNMKVLQMVWVAKDT*
Ga0182151_115879413300015337Switchgrass PhyllosphereEKNKKKLTIKSSLIYTKPNRRNKSNSTFYVIKQKINVKVVAHKVGKKKRRWNHSIWVPKDIITKMKGPQMVWVPKET*
Ga0182137_117979613300015338Switchgrass PhyllosphereSSLIYTKPNRRNKNNSTFYVIKKNTNGKVVAHKVGKKERSWNHSIWVPKDIITKLKGPQMVWVPKET*
Ga0182149_103973313300015339Switchgrass PhyllosphereLIKDEKNMKIFTIKSSLIYTKPNRRNKSNSTIYVIKKETNGKVVAHKVGKQERSWNHPIWMPKDVITNMKGSQMVWVPKET*
Ga0182149_111255213300015339Switchgrass PhyllosphereMIKKKTNGKVVAHKIGKQERSWNHSIWVPKDVITNMKGPQMVWVPKET
Ga0182133_115043723300015340Switchgrass PhyllosphereKKKTNGKVVAHKVGKKEKIWNHSIWVPKDIITNMKGPQMVRVPKEI*
Ga0182133_116682213300015340Switchgrass PhyllospherePNRRNKSKSTSYMIKKKTNGNVVAHKVEKQERSWNHTIWVPKDVITNMKGPQMVWVPKET
Ga0182133_117337213300015340Switchgrass PhyllosphereLSYTKPNRKNKSKNTTYMIKKKNNGKVVAHNVGKKDWSWNRSIWVPKEVITNMKESQIVWVPKDT*
Ga0182115_127936913300015348Switchgrass PhyllospherePNRKNKSKSTTYMIKKKDNGKVVAHKVGEKDWSWNLSIWVPKEVITNMKGPQMVWVPKKT
Ga0182185_123668513300015349Switchgrass PhyllosphereSNSTTYVIKKKTNGKVVAHKVGKQEKSWNRPIWVPKDIIINMKGPQMVWVPKET*
Ga0182185_126657213300015349Switchgrass PhyllospherePRKKLSDEKNKKKLTIKSSLIYTKPNRRNKSNSTTYVIKMKTNGKVIAHKVGKQERSWNHPIWVPKDVIINMKGPQMVWVPKET*
Ga0182163_117106313300015350Switchgrass PhyllosphereIYTKPNRRNKSNSTTYVIKKKTNGKVIAHKVGKQEKSWNRPIWVPKDVIINIKGPQMVWVPKET*
Ga0182163_124030413300015350Switchgrass PhyllosphereNRRNKSNSTSYVIKKKTNGKVVAHKDGKKERSWNNSIWVPKDIITNMKGPQMVWVPKET*
Ga0182163_124720613300015350Switchgrass PhyllosphereSLIYTKSNRKNKSKNTTYMIKKKINGKVVAHKVEKKDWSWNRSIWMPKEVITNMKGSQMVWVPKDI*
Ga0182163_126258113300015350Switchgrass PhyllosphereMDHLLPLKKSNGKVVANKVGKKDWSWNSSIWVPTEIITNMKGPQ
Ga0182163_126714113300015350Switchgrass PhyllosphereNRRNKSNSTSYMIKKKTNGKGVAHKVVKKKRRWNRSIWVPKEVITNMKGPQMVWVPKET*
Ga0182169_110534613300015352Switchgrass PhyllosphereRRNKSNSTTYVIKKKTNGKVVAHKVGKQEKSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0182169_114184923300015352Switchgrass PhyllosphereMPSKAKHEERTQRNKSNSTIYMIKKKTNGNVVAHKVGKQEKSWNHSIWVPKDVITNMKGPQMVWVPKET*
Ga0182169_130331213300015352Switchgrass PhyllosphereKSSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKQERSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0182179_124899013300015353Switchgrass PhyllosphereTANLDMCSFLSHRNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGPQMVWVTKET*
Ga0182179_129931613300015353Switchgrass PhyllosphereTIKSSLIYTKPNQRNKSNSTSYVFKKTNGKVVAHKVGKKEKSWNHSIWVPKDVITNMKGPQMVWVLKEA*
Ga0182179_131890113300015353Switchgrass PhyllosphereSSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKQERSWNRPIWVPKDVIINMKGPQMVWVPKET*
Ga0182199_110724013300017412Switchgrass PhyllosphereKTNDKVVGHKVGKNERSCNRFIWVPKEIITNMKGPQTVWVPKDI
Ga0182195_121543113300017414Switchgrass PhyllosphereYTKPNRRNKSNSTSYVIKKKTNGKVVAHKIRKKERSWNRSIWVPKDIIANIKGPQMVWVPKET
Ga0182201_110163113300017422Switchgrass PhyllosphereNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNLKGPQMVWVPKET
Ga0182198_103033213300017445Switchgrass PhyllosphereYVIKKKSNGNVVAHKIGKKERSWNHSIWVAKDVITNMKGPQIVLVPKKT
Ga0182198_113817923300017445Switchgrass PhyllosphereTIKSSFMYTKPNRRNKSTSYVIKKKTIGKVVAHKVGKQERSWNRSIWVPKDVITNMKQPQMVWVPKET
Ga0182212_110267913300017691Switchgrass PhyllospherePNRRNKSNSTTYVIKKKTNGKVVAHKVGKQEKSWNRPIWVPKDVIINMKGPQMVWVPKET
Ga0182212_116026913300017691Switchgrass PhyllospherePDEKNKKKLTIKSSLIYTKPNRRNKNNSTSYVIKKKTNGKVVAHKVGKQETSWNHSIWVPNDVITNMKGSQMVWVPKET
Ga0182211_112872613300017694Switchgrass PhyllosphereKLPDEENKKKLTIKSSLIYTKPNQRNKSNSTSYMIKEKTNGQVVAHKVGKNERSWNHSIWVPKNIITNMKGPQMLWVPKET
Ga0163161_1191579213300017792Switchgrass RhizosphereDEKNKKKLTIKSSLIYTKPNQRNKSNSTSYVIKKKTNGKVVAHKVGKKESSLNHSIWVPKDIITNMKGPQMVWVPKKT
Ga0182119_10724013300020031Switchgrass PhyllosphereNRRNKSNSTTYVIKKKTNGKVVAHKVGKQEKSWNRPIWVPKDVIINMKGPQMVWVPKET
Ga0207653_1006516113300025885Corn, Switchgrass And Miscanthus RhizosphereVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGPQMVWVPKET
Ga0207676_1180169213300026095Switchgrass RhizosphereKSNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGPQMVWVPKET
Ga0268322_105524713300028049PhyllosphereRRNKSHSTSYVIKKKTNGKVVAHKVGKQERSWNHSIWVPKDVITNMKGPQIVWVPKET
Ga0268306_101947123300028054PhyllosphereNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGPQMVWVPKEI
Ga0268330_102384613300028056PhyllosphereKKKTNGKVVAHKVGKKERSWNRPIWVPKEIITNMKGPQMVWVSKET
Ga0268314_102446713300028061PhyllosphereNKSNSTSYVIKKKTNGKVVAHKVGKKERSWNRPICVPKEIITNMKVPQMVWVPKEI
Ga0268342_103424713300028062PhyllosphereNWRNKSNSTSYVIKKKTNGKMVAHKVGKKERSWNHSIWVPKDIITNMKWPQMVWVPKET
Ga0268348_102215013300028143PhyllospherePDEKNEKKLTIKSSLIYTKLNRRNKSNSTSYVIKNKANGKVITHKVGKKKRSWKRSIWVPKEIITNMKGPQMVWVPKET
Ga0268348_102603913300028143PhyllosphereVITKRINGKVVAHKIRKKERSWNHSIWVPKDIITNMKGPQMVWVPKET
Ga0268308_101356313300028151PhyllosphereNSTSYVIKKKTNGKVVAHKVGKKERSWNRPIWVPKEIITNMKGPQMVWVSKET
Ga0268308_103038823300028151PhyllosphereKSNSTSYVIKKKTNGKVVAHKVGKQERSWNHSIWVPKDVITNMKGPQMVWVPKDT
Ga0268341_102484513300028154PhyllosphereYTKPNRRNKSNSTTYVIKKKTNGKVVAHKVGKQERSWNRPIWVPKDVIINMKGTQMVWVPKET
Ga0268310_100035133300028262PhyllosphereLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGPQMVWVPKEI
Ga0268310_102471613300028262PhyllosphereMIKKKTNGKVVAHKVGKHERSWNHSIWVPKNVIANMKGP
Ga0268310_104660413300028262PhyllosphereYTKPNRRNKSNSTSYVIKKKTNDKVVAHKVGKKERSWNYSIWVPKDVITNIKGPQMVWVPKEI
Ga0268327_102119823300028475PhyllosphereKKKTNGKVVAHKVGKKERSWNHSIWMPKDIITNMKVPQMVWVPKET
Ga0268313_101170613300028523PhyllosphereSNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGPQMVWVPKEI
Ga0214492_103014413300032464Switchgrass PhyllosphereKKKLTIKSSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKKESSWNHSIWVSKDIITNMKGPQMIWVPMET
Ga0214493_115790213300032465Switchgrass PhyllosphereLTIKSSLIYTKPNRRNKSNSASYMIKKKTNGKVVAPNVIKKERSWNHSIWVPKDIITNLKEPQMVWVPKET
Ga0214490_111358923300032502Switchgrass PhyllosphereVIKNKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGPQMVWVP
Ga0214490_114931023300032502Switchgrass PhyllosphereHKVGKKKRSWNRSIWVPKDIITNIKGPQMVWVPKET
Ga0214490_115216813300032502Switchgrass PhyllosphereRRNKSNSTSYVIKKKTNGKVVAHKVVKQERSWNHSIWVPKDIITNMKGPQTVWVPKET
Ga0214483_106487113300032548Switchgrass PhyllosphereYTKSNQRNKSNSISYVIKKKTNGKVVAHKVGKQGRSWNYSIWVPKDVITNMKGPQIVWVPKDT
Ga0214500_111239723300032589Switchgrass PhyllosphereMKSSLIYTKPNRRSKSNSTPYVIKKKINGKMVAHKVGKKERSWNHCIWVPKEIIINMKGPQMVWVPKET
Ga0214504_106078013300032592Switchgrass PhyllosphereKSNSTPYVIKKKINGKMVAHKVGKKERSWNHCIWVPKEIIINMKGPQMVWVPKET
Ga0321338_102921013300032593Switchgrass PhyllosphereSSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVRKQGRSWNYSIWVPKDVITNMKGPQMVWVPKDT
Ga0321338_122031413300032593Switchgrass PhyllosphereKSNSTSYVIKKKTNGKVVAHKVGKKEKSWNHSIWVPKDIITNIKVPQMVWVPKET
Ga0214485_109271313300032698Switchgrass PhyllosphereVIKKKTNGKVVAHKVRKQGRSWNYSIWVPKDVITNMKGPQMVWVPKDT
Ga0214485_109951513300032698Switchgrass PhyllosphereNRRNKSNSTSYVIKKKTNGKVVAHKVGKQERSWNHSIWIPKDVITNMMGPQIVWVPKET
Ga0314753_107505113300032757Switchgrass PhyllosphereMIKKKINGKVVAHKVGKKERSWNRSIWVPKKIITNMKGPQMVWVPKET
Ga0314746_110679813300032758Switchgrass PhyllosphereNKSNSTSYVIKKKTNGKVVAHKVGKQERSWNHSIWVPKDIITNMKGPQMVWVPKET
Ga0314733_102826823300032761Switchgrass PhyllosphereSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVGKQGRSWNYSIWVPKDVITNMKGPQIVWVPKDT
Ga0314748_107695813300032791Switchgrass PhyllosphereMIKKKINGKVVAHKIGKKERSWNRSIWVPKKIITNMKGPQMVWVPKET
Ga0314718_104082113300032811Switchgrass PhyllosphereTNGKVVAHKVGKKKSSWNHSIWVTKDILTNMKGPQMVWVPKET
Ga0314740_103113513300032822Switchgrass PhyllosphereSLIYTKPNRRNKRNSTSYVIKKKINGKVVAHKVGKQERSWNRPIWVPKDIVTNMKGPQMVWVPKET
Ga0314735_103124613300032824Switchgrass PhyllosphereKKKLTIKSSLIYTKPNRRNKSNSTSYVIKKKTNGKVVAHKVRKQGRSWNYSIWVPKDVITNMKGPQMVWVPKDT
Ga0314724_10017913300032825Switchgrass PhyllosphereNKSNITSYVIKKKTNGKVVAHKVGKQETSWNHSIWVPKDVITNMKGPQMVWVPKET
Ga0314727_103851013300032845Switchgrass PhyllosphereGKVVAHKVRKQGRSWNYSIWVPKDVITNMKGPQMVWVPKDT
Ga0314737_101009713300032875Switchgrass PhyllosphereNKSNSISYVIKKKTNGKVVAHKVGKQGRSWNYSIWVPKDVITNMKGPQIVWVPKDT
Ga0314721_12400013300032917Switchgrass PhyllosphereYVNKKKTNGKVFDHKVGKQERSCNHSIWVPKDVITNKKGPQMVWVPKET
Ga0314741_106533513300032934Switchgrass PhyllosphereKSTSYVIKKKTNGKVVAHKVGKQERSWNRSIWVPKNVITNMKGHQMVWVPKET
Ga0314741_112798913300032934Switchgrass PhyllosphereGKVIAHKVGKKERSWNHSIWVPKDIITNLKGAQMVWVPK
Ga0314738_101323013300032959Switchgrass PhyllosphereKKKTNGKVVAHKVGKKERSWNHSIWVPNDIITNMKGPQMVWVPKET
Ga0314761_108725113300033526Switchgrass PhyllosphereLSDEKNKKKLTIKSSLIYTKSNQRNKSNSISYVIKKKTNGKVVAHKVGKQERSWNRSIWVPKNVITNMKGPQMVWVPKET
Ga0314761_112355413300033526Switchgrass PhyllospherePNRKNKSKSTTYVIKKKSDGKVVAHKVGKKERNWNRSIWVPKEIITNMKGPQMVWVPKEI
Ga0314760_105280413300033530Switchgrass PhyllosphereNSTSYVIKKKTNGKVVAHKVGKKERSWNHSIWVPKDIITNMKGPQMVWVPKET
Ga0314770_100711033300033533Switchgrass PhyllosphereKKTNVKVVAHKVGKQERSWNRPIWVPKDIITNMKGPQMVWVPKET
Ga0314757_102606113300033534Switchgrass PhyllosphereRRNKSNSTSYVIKKKINGKVVAHKVGKQERSWNHSIWVPKDVITNMKGPQMVWVPKET

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.