NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042360

Metagenome / Metatranscriptome Family F042360

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042360
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 49 residues
Representative Sequence FLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP
Number of Associated Samples 124
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.64 %
% of genes near scaffold ends (potentially truncated) 97.47 %
% of genes from short scaffolds (< 2000 bps) 83.54 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.911 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(17.089 % of family members)
Environment Ontology (ENVO) Unclassified
(27.848 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.570 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.00%    β-sheet: 23.38%    Coil/Unstructured: 76.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 158 Family Scaffolds
PF06750DiS_P_DiS 15.19
PF09859Oxygenase-NA 6.96
PF02861Clp_N 5.70
PF01814Hemerythrin 5.70
PF13633Obsolete Pfam Family 3.80
PF07963N_methyl 3.16
PF00072Response_reg 2.53
PF02538Hydantoinase_B 1.90
PF14235DUF4337 1.90
PF01464SLT 1.90
PF00211Guanylate_cyc 1.27
PF13469Sulfotransfer_3 1.27
PF11604CusF_Ec 1.27
PF13511DUF4124 1.27
PF13544Obsolete Pfam Family 1.27
PF03466LysR_substrate 1.27
PF13561adh_short_C2 1.27
PF08281Sigma70_r4_2 1.27
PF09678Caa3_CtaG 0.63
PF01145Band_7 0.63
PF11104PilM_2 0.63
PF12399BCA_ABC_TP_C 0.63
PF04055Radical_SAM 0.63
PF09382RQC 0.63
PF05362Lon_C 0.63
PF01761DHQ_synthase 0.63
PF13602ADH_zinc_N_2 0.63
PF12787EcsC 0.63
PF03448MgtE_N 0.63
PF03069FmdA_AmdA 0.63
PF00528BPD_transp_1 0.63
PF00754F5_F8_type_C 0.63
PF13414TPR_11 0.63
PF02321OEP 0.63
PF04250DUF429 0.63
PF08352oligo_HPY 0.63
PF02518HATPase_c 0.63
PF02574S-methyl_trans 0.63
PF02746MR_MLE_N 0.63
PF08240ADH_N 0.63
PF01592NifU_N 0.63
PF12019GspH 0.63
PF09285Elong-fact-P_C 0.63
PF02515CoA_transf_3 0.63
PF06114Peptidase_M78 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 158 Family Scaffolds
COG1989Prepilin signal peptidase PulO (type II secretory pathway) or related peptidaseCell motility [N] 45.57
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 5.70
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 3.80
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.27
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.27
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.27
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 0.63
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.63
COG0822Fe-S cluster assembly scaffold protein IscU, NifU familyPosttranslational modification, protein turnover, chaperones [O] 0.63
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.63
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 0.63
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.63
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.63
COG2239Mg/Co/Ni transporter MgtE (contains CBS domain)Inorganic ion transport and metabolism [P] 0.63
COG2410Predicted nuclease (RNAse H fold)General function prediction only [R] 0.63
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 0.63
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.91 %
UnclassifiedrootN/A17.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004156|Ga0062589_100552482Not Available986Open in IMG/M
3300004156|Ga0062589_100574854All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium971Open in IMG/M
3300004157|Ga0062590_100152609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1585Open in IMG/M
3300004643|Ga0062591_101980321All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria600Open in IMG/M
3300005167|Ga0066672_10947217All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_68_9530Open in IMG/M
3300005175|Ga0066673_10238067All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1051Open in IMG/M
3300005176|Ga0066679_10017258All Organisms → cellular organisms → Bacteria → Proteobacteria3747Open in IMG/M
3300005181|Ga0066678_10649622All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium703Open in IMG/M
3300005184|Ga0066671_10210696Not Available1174Open in IMG/M
3300005184|Ga0066671_10960194All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300005330|Ga0070690_100326380All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1107Open in IMG/M
3300005332|Ga0066388_101738222All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1106Open in IMG/M
3300005332|Ga0066388_103950953All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria756Open in IMG/M
3300005340|Ga0070689_100329576All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1277Open in IMG/M
3300005438|Ga0070701_10796434All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium644Open in IMG/M
3300005440|Ga0070705_100116325All Organisms → cellular organisms → Bacteria → Proteobacteria1718Open in IMG/M
3300005440|Ga0070705_100940771All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium698Open in IMG/M
3300005446|Ga0066686_10783967All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300005454|Ga0066687_10196288All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300005457|Ga0070662_100711014Not Available850Open in IMG/M
3300005466|Ga0070685_11034948All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium617Open in IMG/M
3300005545|Ga0070695_100110380All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1865Open in IMG/M
3300005546|Ga0070696_100293679All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1242Open in IMG/M
3300005547|Ga0070693_100675209All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium754Open in IMG/M
3300005552|Ga0066701_10370174All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300005559|Ga0066700_10436858Not Available920Open in IMG/M
3300005560|Ga0066670_10287429Not Available1000Open in IMG/M
3300005566|Ga0066693_10071838All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300005566|Ga0066693_10338630All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium605Open in IMG/M
3300005568|Ga0066703_10065816All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2065Open in IMG/M
3300005568|Ga0066703_10275336Not Available1020Open in IMG/M
3300005568|Ga0066703_10766038All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium553Open in IMG/M
3300005576|Ga0066708_10870523Not Available563Open in IMG/M
3300005578|Ga0068854_101930946All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005615|Ga0070702_100179353All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1385Open in IMG/M
3300005617|Ga0068859_101068068Not Available887Open in IMG/M
3300006358|Ga0068871_101129323All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium733Open in IMG/M
3300006794|Ga0066658_10781645All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium536Open in IMG/M
3300006797|Ga0066659_11218683All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_68_9628Open in IMG/M
3300006800|Ga0066660_10222340All Organisms → cellular organisms → Bacteria1456Open in IMG/M
3300006844|Ga0075428_100034116All Organisms → cellular organisms → Bacteria → Proteobacteria5614Open in IMG/M
3300006845|Ga0075421_100480397All Organisms → cellular organisms → Bacteria → Proteobacteria1479Open in IMG/M
3300006847|Ga0075431_100128596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2614Open in IMG/M
3300006852|Ga0075433_10268674All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1511Open in IMG/M
3300006852|Ga0075433_11617843All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium558Open in IMG/M
3300006853|Ga0075420_100474480All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300006854|Ga0075425_100221912All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2174Open in IMG/M
3300006854|Ga0075425_101922603All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium663Open in IMG/M
3300006854|Ga0075425_101970254All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300006871|Ga0075434_100190463All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2071Open in IMG/M
3300006904|Ga0075424_100581858All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1195Open in IMG/M
3300006954|Ga0079219_12260209All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria525Open in IMG/M
3300007076|Ga0075435_100439950All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300007076|Ga0075435_100743051All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300009012|Ga0066710_100133103All Organisms → cellular organisms → Bacteria3417Open in IMG/M
3300009012|Ga0066710_102138914Not Available820Open in IMG/M
3300009012|Ga0066710_102374017All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium769Open in IMG/M
3300009100|Ga0075418_10002280All Organisms → cellular organisms → Bacteria21931Open in IMG/M
3300009137|Ga0066709_100006433All Organisms → cellular organisms → Bacteria9920Open in IMG/M
3300009137|Ga0066709_104285472All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium520Open in IMG/M
3300009147|Ga0114129_12631401All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300009147|Ga0114129_12791797All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium581Open in IMG/M
3300009156|Ga0111538_11205532All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium957Open in IMG/M
3300009162|Ga0075423_10168257All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2302Open in IMG/M
3300009174|Ga0105241_10387649Not Available1222Open in IMG/M
3300009176|Ga0105242_10776288All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium946Open in IMG/M
3300010321|Ga0134067_10134947All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium870Open in IMG/M
3300010360|Ga0126372_12638547All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium554Open in IMG/M
3300010375|Ga0105239_12365002Not Available619Open in IMG/M
3300010399|Ga0134127_10872700Not Available953Open in IMG/M
3300010400|Ga0134122_10316991All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1345Open in IMG/M
3300010401|Ga0134121_10095844All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2483Open in IMG/M
3300010401|Ga0134121_13302254All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium500Open in IMG/M
3300010403|Ga0134123_12111386All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria624Open in IMG/M
3300011119|Ga0105246_12288523All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300011434|Ga0137464_1172202All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300012203|Ga0137399_10835363Not Available776Open in IMG/M
3300012685|Ga0137397_10146674All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1747Open in IMG/M
3300012685|Ga0137397_10489623All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium916Open in IMG/M
3300012922|Ga0137394_10001139All Organisms → cellular organisms → Bacteria19230Open in IMG/M
3300012922|Ga0137394_10505255All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1027Open in IMG/M
3300012925|Ga0137419_10113780All Organisms → cellular organisms → Bacteria1897Open in IMG/M
3300012925|Ga0137419_10580421All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium898Open in IMG/M
3300012927|Ga0137416_10752502All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium859Open in IMG/M
3300012929|Ga0137404_11208596All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium695Open in IMG/M
3300012929|Ga0137404_11718657All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium583Open in IMG/M
3300012944|Ga0137410_10023674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales4249Open in IMG/M
3300012944|Ga0137410_10598795All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium911Open in IMG/M
3300013306|Ga0163162_11759955All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium708Open in IMG/M
3300014326|Ga0157380_11785070Not Available674Open in IMG/M
3300015241|Ga0137418_11239816All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium523Open in IMG/M
3300015245|Ga0137409_10046274All Organisms → cellular organisms → Bacteria4151Open in IMG/M
3300015245|Ga0137409_10662295All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium876Open in IMG/M
3300015264|Ga0137403_10361205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1337Open in IMG/M
3300015373|Ga0132257_102278448All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium702Open in IMG/M
3300015374|Ga0132255_100243659All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2565Open in IMG/M
3300017792|Ga0163161_10436797All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1056Open in IMG/M
3300017939|Ga0187775_10401305All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium567Open in IMG/M
3300017959|Ga0187779_10535951Not Available778Open in IMG/M
3300018028|Ga0184608_10301812All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria704Open in IMG/M
3300018052|Ga0184638_1013617All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2798Open in IMG/M
3300018059|Ga0184615_10198512All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas1129Open in IMG/M
3300018064|Ga0187773_10089305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1498Open in IMG/M
3300018064|Ga0187773_10144710All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300018433|Ga0066667_10192224All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1490Open in IMG/M
3300021090|Ga0210377_10002187All Organisms → cellular organisms → Bacteria17357Open in IMG/M
3300021090|Ga0210377_10207800All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1243Open in IMG/M
3300025899|Ga0207642_10291206All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium943Open in IMG/M
3300025933|Ga0207706_10241167All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300025935|Ga0207709_10940751All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria704Open in IMG/M
3300025942|Ga0207689_11094051All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium672Open in IMG/M
3300025972|Ga0207668_11975138Not Available526Open in IMG/M
3300026035|Ga0207703_11204121All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria728Open in IMG/M
3300026035|Ga0207703_11871191All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium576Open in IMG/M
3300026067|Ga0207678_10578623Not Available984Open in IMG/M
3300026142|Ga0207698_12619596All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
3300026313|Ga0209761_1187044Not Available931Open in IMG/M
3300026325|Ga0209152_10206541All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium737Open in IMG/M
3300026330|Ga0209473_1028970All Organisms → cellular organisms → Bacteria2521Open in IMG/M
3300026332|Ga0209803_1206285All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria715Open in IMG/M
3300026334|Ga0209377_1182712All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300026335|Ga0209804_1044172All Organisms → cellular organisms → Bacteria → Proteobacteria2201Open in IMG/M
3300026527|Ga0209059_1326367All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300026538|Ga0209056_10659072All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium528Open in IMG/M
3300026542|Ga0209805_1433849All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium510Open in IMG/M
3300027636|Ga0214469_1184266All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium577Open in IMG/M
3300027907|Ga0207428_10313433All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1159Open in IMG/M
3300027909|Ga0209382_10405841All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1517Open in IMG/M
3300028381|Ga0268264_11726736All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria636Open in IMG/M
3300028536|Ga0137415_10433707All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1119Open in IMG/M
3300028536|Ga0137415_10675321Not Available845Open in IMG/M
3300028592|Ga0247822_10029445All Organisms → cellular organisms → Bacteria3772Open in IMG/M
3300028592|Ga0247822_10411237All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300028812|Ga0247825_10076759All Organisms → cellular organisms → Bacteria2242Open in IMG/M
3300028889|Ga0247827_10524087Not Available745Open in IMG/M
3300030336|Ga0247826_10000719All Organisms → cellular organisms → Bacteria → Proteobacteria7859Open in IMG/M
3300030336|Ga0247826_11135315All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium625Open in IMG/M
3300030336|Ga0247826_11480496Not Available550Open in IMG/M
3300031548|Ga0307408_100664486Not Available933Open in IMG/M
3300031716|Ga0310813_10054502All Organisms → cellular organisms → Bacteria2959Open in IMG/M
3300031740|Ga0307468_100134556All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1553Open in IMG/M
3300031740|Ga0307468_101125899All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium701Open in IMG/M
3300031820|Ga0307473_10581628All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300031820|Ga0307473_10838257All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300031854|Ga0310904_10309478Not Available1004Open in IMG/M
3300031943|Ga0310885_10070919All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300032002|Ga0307416_103383791All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium534Open in IMG/M
3300032013|Ga0310906_10095656All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300032013|Ga0310906_11374544All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300032180|Ga0307471_100632452All Organisms → cellular organisms → Bacteria → Proteobacteria1231Open in IMG/M
3300032180|Ga0307471_102484992Not Available655Open in IMG/M
3300032211|Ga0310896_10046376All Organisms → cellular organisms → Bacteria1732Open in IMG/M
3300032421|Ga0310812_10015658All Organisms → cellular organisms → Bacteria2598Open in IMG/M
3300033550|Ga0247829_10672600Not Available861Open in IMG/M
3300033551|Ga0247830_10575546All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria890Open in IMG/M
3300034178|Ga0364934_0016530All Organisms → cellular organisms → Bacteria → Proteobacteria2646Open in IMG/M
3300034665|Ga0314787_031116Not Available811Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil17.09%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.29%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.43%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.53%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.90%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.90%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.27%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.27%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.27%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.27%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.63%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.63%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027636Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeqEnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034665Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062589_10055248233300004156SoilSGWTGSGASYRYDATAAGTFKLCASGDSTAANSNGGSTCP*
Ga0062589_10057485413300004156SoilSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGSTCP*
Ga0062590_10015260933300004157SoilSTPTLPAGWGGSGTSYKYTTTAAGTFVICGTGDSTGADSNGGAPVACP*
Ga0062591_10198032113300004643SoilIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFKLCASGDSTAANSNGGSTCP*
Ga0066672_1094721713300005167SoilGGPFLNSMPTLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTAANSNGGATCP*
Ga0066673_1023806723300005175SoilNQPLSGALLVQQNNQQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0066679_1001725813300005176SoilAGWTGSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP*
Ga0066678_1064962223300005181SoilLPAGWTGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP*
Ga0066671_1021069623300005184SoilSMPTLPAGWTGSGTSYKYSSSTTGTFMLCGSGDSTGVNSNGGNTCP*
Ga0066671_1096019423300005184SoilSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0070690_10032638023300005330Switchgrass RhizosphereSGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP*
Ga0066388_10173822213300005332Tropical Forest SoilFLNALPSLPGGWTGSGTSYKYTTTVAGSFLVCASGDGTAVDSSAGTTCP*
Ga0066388_10395095313300005332Tropical Forest SoilSMPSMPQGWTGSGTTYKYVSTAAGSYYVCGSGDSTAADSNGGATCP*
Ga0070689_10032957613300005340Switchgrass RhizosphereQGQIGGPFLNSLPTLPSGWTGSGASYRYDATASGTFKLCASGDSTAANSNGGATCP*
Ga0070701_1079643423300005438Corn, Switchgrass And Miscanthus RhizosphereLNSLPTLPAGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0070705_10011632513300005440Corn, Switchgrass And Miscanthus RhizosphereAQTNQPLSGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP*
Ga0070705_10094077113300005440Corn, Switchgrass And Miscanthus RhizosphereNSTPTLPAAWTGSGTSYKYSLNATGTFLVCGSGDNSAANSNGGPDLLLTAV*
Ga0066686_1078396713300005446SoilPFLNSLPTLPAGWTGNGASYRYDATAAGTFQLCASGDTVSVNSNGGTTCP*
Ga0066687_1019628813300005454SoilGPFLNSMPTLPAGWTGSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP*
Ga0070662_10071101423300005457Corn RhizosphereRLPGGWTGSGTSYKYTTTAAGTFLVCASGDSTAVDSGGGITCP*
Ga0070685_1103494823300005466Switchgrass RhizosphereQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP*
Ga0070695_10011038043300005545Corn, Switchgrass And Miscanthus RhizosphereNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP*
Ga0070696_10029367913300005546Corn, Switchgrass And Miscanthus RhizosphereIGGPFLNSLPTLPAGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0070693_10067520913300005547Corn, Switchgrass And Miscanthus RhizospherePFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP*
Ga0066701_1037017413300005552SoilGPFLNSLPTLPAGWTGNGASYRYDATAAGTFQLCASGDTVSVNSNGGTTCP*
Ga0066700_1043685813300005559SoilGGPFLNSMPTLPAGWTGSGTSYKYSSSSAGTFMLCGSGDSTGVNSNGGNTCP*
Ga0066670_1028742913300005560SoilGPFLNSMPTLPAGWTGSGTSYKYSSSTTGTFMLCGSGDSTGVNSNGGNTCP*
Ga0066693_1007183843300005566SoilSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP*
Ga0066693_1033863013300005566SoilALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0066703_1006581643300005568SoilPFLNSMPTLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTAANSNGGATCP*
Ga0066703_1027533623300005568SoilGGPFLNSMPTLPAGWTGSGTSYKYSSSSAGTFMLCGSGDSAGVNSNGGNTCP*
Ga0066703_1076603823300005568SoilPTLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTAANSNGGTTCP*
Ga0066708_1087052313300005576SoilLNAMPTLPAGWTGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP*
Ga0068854_10193094623300005578Corn RhizosphereQTNGQNQVGGPFLNGSPRLPSGWTGSGVSYKYSSTAAGTFTVCGAGDSTAADSNGGTTCP
Ga0070702_10017935343300005615Corn, Switchgrass And Miscanthus RhizosphereIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP*
Ga0068859_10106806813300005617Switchgrass RhizosphereGGPFMNSTPTLPAAWTGSGTSYKYSLNATGTFLVCGSGDNTAADSSGGATCP*
Ga0068871_10112932313300006358Miscanthus RhizosphereAAQTNQPLSGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP*
Ga0066658_1078164513300006794SoilPTLPSGWTGNAGSYRYDATAAGTFQLCGSGDSTAVNSNGGATCP*
Ga0066659_1121868313300006797SoilFLNSMPTLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTGANSNGGATCP*
Ga0066660_1022234043300006800SoilPAGWTGSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP*
Ga0075428_10003411663300006844Populus RhizospherePFLNAVPSLPGGWTGSGTSYKYTTTAAGSFVVCASGDGTAVDSGGGSSCP*
Ga0075421_10048039743300006845Populus RhizosphereTGSGTSYKYSLAANGTFLVCGSGDNTAADSNGGTTCP*
Ga0075431_10012859613300006847Populus RhizosphereAAWTGSGTSYKYSLAANGTFLVCGSGDGTAADSNGGTTCP*
Ga0075433_1026867413300006852Populus RhizosphereQVGGPFLNAMPTLPSGWTGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP*
Ga0075433_1028813733300006852Populus RhizosphereLVQQTNAQNQVGGPFLNAMPTLPSGWTGNGTSYRYDAGATGTFQLCGTGDSTAVNSNGGTTCP*
Ga0075433_1161784333300006852Populus RhizosphereTLPAGWTGNGTSYRYDAGATGTFQMCASGDSTAANSNGGATCP*
Ga0075420_10047448033300006853Populus RhizosphereAPTLPAAWTGSGTSYKYSLVANGTFLVCGSGDNTAADSNGGTTCP*
Ga0075425_10022191213300006854Populus RhizosphereAMPTLPAGWTGNGTSYRYDAGATGTFQMCASGDSTAANSNGGATCP*
Ga0075425_10192260333300006854Populus RhizosphereLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP*
Ga0075425_10197025413300006854Populus RhizosphereTGNAASYRYDATAAGTFQLCASGDGTAANSNGGATCP*
Ga0075434_10019046353300006871Populus RhizosphereLVQQTNAQNQVGGPFLNAMPTLPSGWTGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP*
Ga0075424_10058185823300006904Populus RhizosphereGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP*
Ga0079219_1226020923300006954Agricultural SoilSGTSYKYSSSATGTFMICGSGDSTAADSNGGQTCP*
Ga0075435_10043995013300007076Populus RhizosphereLPQGWTGSGTSYKYSSSATGTFMVCATGDSTGANSNGGVTCP*
Ga0075435_10074305133300007076Populus RhizosphereLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP*
Ga0066710_10013310313300009012Grasslands SoilTLPAGWTGNAASYRYDATAAGTFQLCASGDSTAANSNGGATCP
Ga0066710_10213891413300009012Grasslands SoilNAASYRYDATAAGTFQLCASGDSTAANSNGGATCP
Ga0066710_10237401723300009012Grasslands SoilWTGNGTSYRYDAGATGTFQMCASGDSTAANSNGGATCP
Ga0075418_1000228013300009100Populus RhizosphereSMPTLPAGWGGSGTSYKYTTTAAGTFVICGTGDSTGADSNGGAPTACP*
Ga0066709_10000643313300009137Grasslands SoilGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP*
Ga0066709_10428547223300009137Grasslands SoilAQGQIGGPFLNSLPTLPAGWTGNAASYRYDATARGTVEQCESGDSTGANSNGGATCP*
Ga0114129_1263140123300009147Populus RhizosphereAASYRYDATAAGTFQLCASGDGTAANSNGGATCP*
Ga0114129_1279179723300009147Populus RhizosphereQQTNAQNQVGGPFLNAMPTLPSGWTGNGTSYRYDAGATGTFQLCASGDSTAANSNGGATCP*
Ga0111538_1120553223300009156Populus RhizosphereGSGTSYKYSLAANGTFLVCGSGDNTAADSNGGTTCP*
Ga0075423_1016825743300009162Populus RhizosphereFLNALPTLPSGWTGSGASYRYDATAAGTFQLCASVDGTAANSNGGATCP*
Ga0105241_1038764913300009174Corn RhizosphereLNSTPTLPAGWGGSGTSYKYTTTAAGTFTICGTGDSTGADSNGGAPTACP*
Ga0105242_1077628823300009176Miscanthus RhizosphereSGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATASGTFKLCASGDSTAANSNGGATCP*
Ga0134067_1013494733300010321Grasslands SoilFLNSTPTLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTAANSNGGATCP*
Ga0126372_1263854723300010360Tropical Forest SoilPFLNSSPTLPAGWTGSGTSYKYSSTASGTFMLCATGDSTGANSNAGTNCP*
Ga0105239_1236500213300010375Corn RhizosphereGPFLNALPRLPGGWTGSGTSYKYTTTAAGTFLVCASGDSTAVDSGGGITCP*
Ga0134127_1087270013300010399Terrestrial SoilAWTGSGTSYKYSLAANGTFLVCGSGDGTAADSNGGTTCP*
Ga0134122_1031699113300010400Terrestrial SoilNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP*
Ga0134121_1009584453300010401Terrestrial SoilFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP*
Ga0134121_1330225423300010401Terrestrial SoilFMNSTPTLPAAWTGSGTSYKYSLNATGTFLVCGSGDNTAADSNGGATCP*
Ga0134123_1211138613300010403Terrestrial SoilTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP*
Ga0105246_1228852313300011119Miscanthus RhizosphereVGGPFMNSTPTLPAAWTGSGTSYKYSLNATGTFLVCGSGDNTAADSSGGATCP*
Ga0137464_117220213300011434SoilVGGPFLNNAPTLPAGWTGSGTSYKYTSTSVGTFTPCASGDSTAAYSN*
Ga0137399_1083536313300012203Vadose Zone SoilWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0137397_1014667443300012685Vadose Zone SoilFLNSLPTLPAGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0137397_1048962313300012685Vadose Zone SoilALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP*
Ga0137394_10001139233300012922Vadose Zone SoilSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0137394_1050525513300012922Vadose Zone SoilPLSGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP*
Ga0137419_1011378033300012925Vadose Zone SoilTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0137419_1058042113300012925Vadose Zone SoilSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0137416_1075250233300012927Vadose Zone SoilNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP*
Ga0137404_1120859633300012929Vadose Zone SoilGPFLNSMPTMPQGWTGSGTSYKYSSTASGTYLVCATGDGSGANSNGGITCP*
Ga0137404_1171865713300012929Vadose Zone SoilNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0137410_1002367413300012944Vadose Zone SoilGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0137410_1059879533300012944Vadose Zone SoilGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP*
Ga0163162_1175995513300013306Switchgrass RhizosphereNSLPTLPSGWTGSGASYRYDATASGTFKLCASGDSTAANSNGGATCP*
Ga0157380_1178507023300014326Switchgrass RhizosphereVGGPFMNSTPTLPAAWTGSGTSYRYSLNATGTFLVCGIVDNTAADSSGGSTCP*
Ga0137418_1123981613300015241Vadose Zone SoilLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGAVCP*
Ga0137409_1004627453300015245Vadose Zone SoilQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP*
Ga0137409_1066229533300015245Vadose Zone SoilQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP*
Ga0137403_1036120533300015264Vadose Zone SoilLSVQVGALQLPSAQTWLSQSLLVQQQNAQNQTGGPFLNAMPTLPAAWTGNGTSYRYDATAAGTFKICASGDSTAANSNGGSVCP*
Ga0132257_10227844813300015373Arabidopsis RhizosphereRLPGGWTGSGTSYKYTTTAAGTFLVCASGDSTAVDSGGGTTCP*
Ga0132255_10024365913300015374Arabidopsis RhizosphereTAGPFLNALPRLPGGWTGSGTSYKYTTTAAGTFLVCASGDSTAVDSGGGITCP*
Ga0163161_1043679743300017792Switchgrass RhizosphereTLPQGWAGSGTSYKYISTTFGTYTVCGSGDSTAADSNGGATCP
Ga0187775_1040130523300017939Tropical PeatlandGWTGSGTSYKYSSTAVGTFMICGSGDSTAADSNGGTTCP
Ga0187779_1053595123300017959Tropical PeatlandPFLNSTPTLPAGWTGSGTSYKYSSAATGTFIICGSGDSTAADSNGGTTCP
Ga0184608_1030181233300018028Groundwater SedimentQGWTGSGTSYKYSSTAGGVYMVCATGDGTGADSNGGTTCP
Ga0184638_101361753300018052Groundwater SedimentFLNTMPTLPQGWTGSGTSYKYSSTPGGVYMVCATGDGTGADSNGSTTCP
Ga0184615_1019851213300018059Groundwater SedimentLPAGWAGSGTSYKYSQTTAGTFMLCGSGDTVGVNSNAGTTCP
Ga0187773_1008930513300018064Tropical PeatlandNQVGGPFLNSMPTLPAGWTGSGTSYKYSSTAVGTFLICGSGDSTAANSNGGTTCP
Ga0187773_1014471013300018064Tropical PeatlandGPFLNSLPTLPAGWTGSGTSYKYSSTAVGTFMICGSGDSTAADSNGGTTCP
Ga0066667_1019222433300018433Grasslands SoilGWTGNGTSYRYDAGATGTFQMCASGDSTAANSNGGATCP
Ga0210377_10002187203300021090Groundwater SedimentLPAGWTGSGTSYKYSQTVAGTFMLCGSGDSTGADSSGGATCP
Ga0210377_1020780043300021090Groundwater SedimentSGASYKYSQTAAGTFMLCGSGDSTAADSSGGSTCP
Ga0207642_1029120643300025899Miscanthus RhizosphereFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP
Ga0207706_1024116733300025933Corn RhizosphereRLPGGWTGSGTSYKYTTTAAGTFLVCASGDSTAVDSGGGITCP
Ga0207709_1094075123300025935Miscanthus RhizosphereSGWTGSGASYRYDATASGTFKLCASGDSTAANSNGGATCP
Ga0207689_1109405133300025942Miscanthus RhizosphereGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP
Ga0207668_1197513813300025972Switchgrass RhizosphereQGWTGSGTSYKYVSTTFGTYTVCGSGDSTAADSNGGATCP
Ga0207703_1120412113300026035Switchgrass RhizosphereQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP
Ga0207703_1187119113300026035Switchgrass RhizosphereTNQPLSGALLVQQNNTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATASGTFKLCASGDSTAANSNGGATCP
Ga0207678_1057862333300026067Corn RhizosphereQIGGPFLNSMPTLPAGWGGSGTSYKYTSTAVGTFVICGTGDSTGADSNGGSPTACP
Ga0207698_1261959623300026142Corn RhizosphereLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP
Ga0209761_118704413300026313Grasslands SoilPTLPAGWTGNGASYRYDATAAGTFALCASGDSTAANSNASATCP
Ga0209152_1020654133300026325SoilLPVLPAGWTGNAASYRYDATAAGTFQLCASGDSTAANSNGGAVCP
Ga0209473_102897013300026330SoilAGWTGSGTSYKYSSSSTGTFMLCGSGDSTAANSNGGATCP
Ga0209803_120628523300026332SoilGGPFLNSLPTLPAGWTGNAASYRYDATAAGTFQLCASGDSTAANSNGGATCP
Ga0209377_118271213300026334SoilQPLSPALLVQQNNAQGQLGGPFLNALPTLPSGWTGNGASYRYDATAAGTFALCASGDSTAANSNASTTCP
Ga0209804_104417213300026335SoilQVGGPFLNSTPTLPAGWTGSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP
Ga0209059_132636713300026527SoilNAAPTLPAGWAGSGTSYKYSSTAAGTFLICGSGDSTAADSAGGATCP
Ga0209056_1065907213300026538SoilAGWTGNAASYRYDATAAGTFQLCASGDSTAANSNGGATCP
Ga0209805_143384913300026542SoilNQVGGPFLNSLPTLPAGWTGSGTSYKYSSSATGTFVLCGSGDSTAADSNGGATCP
Ga0214469_118426613300027636SoilMNSMPSLPSGWTGSGVSYKYAIVASGTYLACGSGDGTAANSSGGSTCP
Ga0207428_1031343343300027907Populus RhizosphereLPAGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP
Ga0209382_1040584143300027909Populus RhizosphereTGSGTSYKYSLAANGTFLVCGSGDNTAADSNGGTTCP
Ga0268264_1172673623300028381Switchgrass RhizosphereTQGQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGATCP
Ga0137415_1043370713300028536Vadose Zone SoilQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCGAGDTTFVNSNGGSTCP
Ga0137415_1067532113300028536Vadose Zone SoilQIGGPFLNSLPTLPSGWTGSGASYRYDATAAGTFQLCASGDSTAANSNGGAVCP
Ga0247822_1002944553300028592SoilAVPSLPGGWTGSGTSYKYTTTAAGSFVVCATGDGTAVDSGGGSNCP
Ga0247822_1041123713300028592SoilFLNSAPTLPAAWTGSGTSYKYSLAANGTFLVCGSGDNTAADSNGGTTCP
Ga0247825_1007675913300028812SoilAEVGQNQLGGPFMMAPPALPSGWTGSGSSYKYSATAAGTFTICASGDSTAADSNGGTTCL
Ga0247827_1052408723300028889SoilAGPFLNAVPSLPGGWTGSGTSYKYTTTAAGSFVVCATGDGTAVDSGGGSTCP
Ga0247826_1000071963300030336SoilAGPFLNAVPSLPGGWTGSGTSYKYTTTAAGSFVVCASGDGTAVDSGGGSSCP
Ga0247826_1113531513300030336SoilGPFMNSIPSLPAGWTGSGASYKYSIVSSGTFLACGSGDGTAANSSGGNVCP
Ga0247826_1148049623300030336SoilPFLNSMPTLPAGWGGSGTSYKYTTTAAGTFVICGTGDSTGADSNGGAPTACP
Ga0307408_10066448613300031548RhizosphereAGNGTTGYKYSTSAAGTFLVCGTGDATGANSNGGVTCP
Ga0310813_1005450213300031716SoilSGTSYKYASTAVGTFVICGSGDSTAADSNGGSTCP
Ga0307468_10013455613300031740Hardwood Forest SoilFLNSTPTLPAGWGGSGTSYKYTTTAAGTFVICGTGDSTGADSNGGAPVACP
Ga0307468_10112589913300031740Hardwood Forest SoilGPFLNSLPTLPAGWTGSGTSYRYDATAAGTFALCASGDSTAANSNGGATCP
Ga0307473_1058162823300031820Hardwood Forest SoilPTLPAGWTGSGTSYKYSSSSTGTFLICGSGDSTAANSNGGTTCP
Ga0307473_1083825713300031820Hardwood Forest SoilFLNGSPRLPSGWTGSGTSYKYSSTAAGTFTICGAGDSTAADSNGGTTCP
Ga0310904_1030947813300031854SoilSQNQAAGPFLNAVPSLPGGWTGSGTSYKYTTTAAGSFVVCASGDGTAVDSGGGSNCP
Ga0310885_1007091933300031943SoilWTGSGASYKYSSTAAGTFTICGSGDSTAADSNGGASCP
Ga0307416_10338379113300032002RhizosphereTGSGASYRYDATAAGTFQLCASGDGTAANSNGGATCP
Ga0310906_1009565633300032013SoilMNSAPTLPANWAGSGTTYKYSLNATGTFLVCGSGDNSAANSNGGPDLLLTAV
Ga0310906_1137454413300032013SoilSPRLPSGWTGSGASYKYSSTAAGTFTICGSGDSTAADSNGGASCP
Ga0307471_10063245233300032180Hardwood Forest SoilTIPAGWTGSGTSYKYSSSSTGTFLICGSGDSTAADSNGGTTCP
Ga0307471_10248499213300032180Hardwood Forest SoilSLPAGWTGSGTSYKYSSSATGTFMLCGSGDSTAANSNGGATCP
Ga0310896_1004637633300032211SoilNGQNQVGGPFLNASPRLPSGWTGSGASYKYSSTAAGTFTICGSGDSTAADSNGGASCP
Ga0310812_1001565813300032421SoilGGPFLNTMPTLPQGWTGSGTSYKYSSTASGTYLVCATGDSTGANSNGDTTCP
Ga0247829_1067260013300033550SoilQNQAAGPFLNAVPSLPGGWTGSGTSYKYTTTAAGSFVVCATGDGTAVDSGGGSTCP
Ga0247830_1057554623300033551SoilLNGAPRLPATWTGSGTSYKYSLAANGTFLVCGSGDGTAADSNGGTTCP
Ga0364934_0016530_2518_26463300034178SedimentLPAGWTGSGTSYKYASTSVGTFTICGTGDSTAADSNGGATCP
Ga0314787_031116_19_1653300034665SoilMNSTPPLPAAWTGSGTSYKYSLNATGTFLVCGSGDNTAADSNGGATCP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.