NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042914

Metagenome / Metatranscriptome Family F042914

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042914
Family Type Metagenome / Metatranscriptome
Number of Sequences 157
Average Sequence Length 53 residues
Representative Sequence MLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGVAVNKESKSETISETKSSLTFGK
Number of Associated Samples 107
Number of Associated Scaffolds 157

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 38.85 %
% of genes near scaffold ends (potentially truncated) 38.85 %
% of genes from short scaffolds (< 2000 bps) 85.99 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (42.038 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(35.032 % of family members)
Environment Ontology (ENVO) Unclassified
(78.344 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(93.631 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.82%    β-sheet: 0.00%    Coil/Unstructured: 58.18%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 157 Family Scaffolds
PF12236Head-tail_con 28.03
PF11753DUF3310 0.64
PF03237Terminase_6N 0.64
PF02839CBM_5_12 0.64
PF02518HATPase_c 0.64



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.88 %
UnclassifiedrootN/A33.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10077539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P1167Open in IMG/M
3300000116|DelMOSpr2010_c10070972All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium1417Open in IMG/M
3300000117|DelMOWin2010_c10035491All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae2370Open in IMG/M
3300002488|JGI25128J35275_1024216All Organisms → Viruses → Predicted Viral1464Open in IMG/M
3300004097|Ga0055584_101156765Not Available808Open in IMG/M
3300006025|Ga0075474_10018327All Organisms → Viruses → Predicted Viral2566Open in IMG/M
3300006026|Ga0075478_10008804All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P3462Open in IMG/M
3300006026|Ga0075478_10083460Not Available1027Open in IMG/M
3300006404|Ga0075515_10054219Not Available960Open in IMG/M
3300006637|Ga0075461_10194098Not Available610Open in IMG/M
3300006735|Ga0098038_1045894Not Available1590Open in IMG/M
3300006737|Ga0098037_1108505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae956Open in IMG/M
3300006737|Ga0098037_1116977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P913Open in IMG/M
3300006749|Ga0098042_1000054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales36058Open in IMG/M
3300006749|Ga0098042_1002728All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P6354Open in IMG/M
3300006752|Ga0098048_1060521All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P1177Open in IMG/M
3300006752|Ga0098048_1064120All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae1139Open in IMG/M
3300006752|Ga0098048_1125862All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes769Open in IMG/M
3300006752|Ga0098048_1220722All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae557Open in IMG/M
3300006789|Ga0098054_1076335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P1266Open in IMG/M
3300006789|Ga0098054_1082155Not Available1214Open in IMG/M
3300006789|Ga0098054_1249460Not Available641Open in IMG/M
3300006793|Ga0098055_1171034Not Available832Open in IMG/M
3300006793|Ga0098055_1237294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae687Open in IMG/M
3300006793|Ga0098055_1245424Not Available674Open in IMG/M
3300006793|Ga0098055_1298752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P602Open in IMG/M
3300006802|Ga0070749_10562546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae617Open in IMG/M
3300006874|Ga0075475_10377267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae573Open in IMG/M
3300006916|Ga0070750_10077234All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P1568Open in IMG/M
3300006916|Ga0070750_10299904Not Available687Open in IMG/M
3300006921|Ga0098060_1010165All Organisms → Viruses → Predicted Viral3081Open in IMG/M
3300006922|Ga0098045_1114754Not Available630Open in IMG/M
3300006922|Ga0098045_1118729All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P617Open in IMG/M
3300006924|Ga0098051_1104271Not Available760Open in IMG/M
3300006924|Ga0098051_1165672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes582Open in IMG/M
3300006924|Ga0098051_1178623Not Available557Open in IMG/M
3300006925|Ga0098050_1126689Not Available647Open in IMG/M
3300006990|Ga0098046_1082766Not Available721Open in IMG/M
3300007276|Ga0070747_1099219Not Available1075Open in IMG/M
3300007345|Ga0070752_1203966Not Available787Open in IMG/M
3300007725|Ga0102951_1024184All Organisms → Viruses → Predicted Viral1901Open in IMG/M
3300008050|Ga0098052_1170270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes856Open in IMG/M
3300009000|Ga0102960_1269582All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes602Open in IMG/M
3300009001|Ga0102963_1087566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1272Open in IMG/M
3300010148|Ga0098043_1182344All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes586Open in IMG/M
3300010149|Ga0098049_1064865All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P1156Open in IMG/M
3300010149|Ga0098049_1125267Not Available798Open in IMG/M
3300010149|Ga0098049_1130652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes780Open in IMG/M
3300010149|Ga0098049_1228435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae567Open in IMG/M
3300010150|Ga0098056_1126773Not Available866Open in IMG/M
3300010150|Ga0098056_1307117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae522Open in IMG/M
3300010153|Ga0098059_1117376All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P1054Open in IMG/M
3300010300|Ga0129351_1178091Not Available831Open in IMG/M
3300016737|Ga0182047_1183392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes599Open in IMG/M
3300017708|Ga0181369_1064234All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes801Open in IMG/M
3300017713|Ga0181391_1049237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P997Open in IMG/M
3300017713|Ga0181391_1096850All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes668Open in IMG/M
3300017714|Ga0181412_1016544All Organisms → Viruses → Predicted Viral2116Open in IMG/M
3300017714|Ga0181412_1069441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P862Open in IMG/M
3300017719|Ga0181390_1171641All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes535Open in IMG/M
3300017720|Ga0181383_1008119All Organisms → Viruses2817Open in IMG/M
3300017726|Ga0181381_1005895All Organisms → Viruses → Predicted Viral3005Open in IMG/M
3300017726|Ga0181381_1015536All Organisms → Viruses → Predicted Viral1757Open in IMG/M
3300017727|Ga0181401_1040706Not Available1301Open in IMG/M
3300017727|Ga0181401_1043254All Organisms → Viruses → Predicted Viral1255Open in IMG/M
3300017727|Ga0181401_1050018Not Available1146Open in IMG/M
3300017727|Ga0181401_1057324Not Available1052Open in IMG/M
3300017733|Ga0181426_1018318Not Available1377Open in IMG/M
3300017734|Ga0187222_1026744Not Available1387Open in IMG/M
3300017738|Ga0181428_1104468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes663Open in IMG/M
3300017742|Ga0181399_1066306All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes922Open in IMG/M
3300017742|Ga0181399_1166749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P525Open in IMG/M
3300017744|Ga0181397_1047730All Organisms → Viruses → Predicted Viral1190Open in IMG/M
3300017748|Ga0181393_1082032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P844Open in IMG/M
3300017749|Ga0181392_1072192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P1044Open in IMG/M
3300017749|Ga0181392_1079297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P990Open in IMG/M
3300017751|Ga0187219_1224241All Organisms → Viruses → environmental samples → uncultured marine virus512Open in IMG/M
3300017753|Ga0181407_1139575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes601Open in IMG/M
3300017755|Ga0181411_1139432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes701Open in IMG/M
3300017756|Ga0181382_1040689All Organisms → Viruses → Predicted Viral1370Open in IMG/M
3300017757|Ga0181420_1219503All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes547Open in IMG/M
3300017758|Ga0181409_1150430Not Available681Open in IMG/M
3300017760|Ga0181408_1176770All Organisms → Viruses → environmental samples → uncultured marine virus546Open in IMG/M
3300017762|Ga0181422_1005428All Organisms → Viruses → Predicted Viral4296Open in IMG/M
3300017769|Ga0187221_1123901All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes778Open in IMG/M
3300017770|Ga0187217_1100114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P986Open in IMG/M
3300017776|Ga0181394_1083580Not Available1033Open in IMG/M
3300017781|Ga0181423_1278583Not Available620Open in IMG/M
3300017782|Ga0181380_1002894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P7166Open in IMG/M
3300017786|Ga0181424_10116116Not Available1154Open in IMG/M
3300017950|Ga0181607_10492999Not Available655Open in IMG/M
3300018048|Ga0181606_10645928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes540Open in IMG/M
3300018415|Ga0181559_10766736All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P514Open in IMG/M
3300018416|Ga0181553_10119773All Organisms → Viruses → Predicted Viral1600Open in IMG/M
3300019459|Ga0181562_10213422Not Available1004Open in IMG/M
3300019715|Ga0193966_1036358Not Available592Open in IMG/M
3300020173|Ga0181602_10247039Not Available763Open in IMG/M
3300020188|Ga0181605_10187465Not Available944Open in IMG/M
3300020438|Ga0211576_10630671All Organisms → Viruses → environmental samples → uncultured marine virus531Open in IMG/M
3300020469|Ga0211577_10494600All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes742Open in IMG/M
3300021335|Ga0213867_1012314All Organisms → Viruses → Predicted Viral3599Open in IMG/M
3300021373|Ga0213865_10201628Not Available983Open in IMG/M
3300021425|Ga0213866_10389902All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P681Open in IMG/M
3300021957|Ga0222717_10016166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P5068Open in IMG/M
3300021957|Ga0222717_10051135All Organisms → Viruses → Predicted Viral2677Open in IMG/M
3300021957|Ga0222717_10403050Not Available756Open in IMG/M
3300021957|Ga0222717_10595045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes581Open in IMG/M
3300021958|Ga0222718_10217801All Organisms → Viruses → Predicted Viral1032Open in IMG/M
3300021964|Ga0222719_10354637Not Available929Open in IMG/M
3300022074|Ga0224906_1000391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae25388Open in IMG/M
3300022074|Ga0224906_1007102All Organisms → Viruses → Predicted Viral4560Open in IMG/M
3300022183|Ga0196891_1011983Not Available1704Open in IMG/M
3300022187|Ga0196899_1114702Not Available782Open in IMG/M
3300022921|Ga0255765_1178754Not Available966Open in IMG/M
3300023273|Ga0255763_1270771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes621Open in IMG/M
3300024191|Ga0228636_1103761All Organisms → Viruses642Open in IMG/M
3300024221|Ga0228666_1078228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes637Open in IMG/M
3300024315|Ga0228618_1066742All Organisms → Viruses601Open in IMG/M
3300024320|Ga0233398_1020705All Organisms → Viruses → Predicted Viral1884Open in IMG/M
3300024320|Ga0233398_1032813All Organisms → Viruses → Predicted Viral1418Open in IMG/M
3300024320|Ga0233398_1140499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes539Open in IMG/M
3300024428|Ga0233396_1058794All Organisms → Viruses1029Open in IMG/M
3300025070|Ga0208667_1003787All Organisms → Viruses → Predicted Viral4434Open in IMG/M
3300025070|Ga0208667_1005695All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P3318Open in IMG/M
3300025070|Ga0208667_1018586Not Available1388Open in IMG/M
3300025070|Ga0208667_1022245Not Available1217Open in IMG/M
3300025070|Ga0208667_1032685Not Available920Open in IMG/M
3300025070|Ga0208667_1057073All Organisms → Viruses618Open in IMG/M
3300025070|Ga0208667_1065599Not Available557Open in IMG/M
3300025070|Ga0208667_1068931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P537Open in IMG/M
3300025083|Ga0208791_1013132All Organisms → Viruses → Predicted Viral1868Open in IMG/M
3300025083|Ga0208791_1053756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC035P696Open in IMG/M
3300025084|Ga0208298_1008093All Organisms → Viruses → Predicted Viral2734Open in IMG/M
3300025084|Ga0208298_1020239All Organisms → Viruses → Predicted Viral1483Open in IMG/M
3300025085|Ga0208792_1055799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P734Open in IMG/M
3300025085|Ga0208792_1067986Not Available647Open in IMG/M
3300025098|Ga0208434_1064444Not Available773Open in IMG/M
3300025098|Ga0208434_1105975All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P544Open in IMG/M
3300025099|Ga0208669_1043231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P1051Open in IMG/M
3300025099|Ga0208669_1076046All Organisms → Viruses → environmental samples → uncultured marine virus727Open in IMG/M
3300025101|Ga0208159_1000073All Organisms → Viruses35536Open in IMG/M
3300025101|Ga0208159_1001170All Organisms → Viruses10017Open in IMG/M
3300025610|Ga0208149_1075258All Organisms → Viruses838Open in IMG/M
3300025610|Ga0208149_1082221Not Available792Open in IMG/M
3300025647|Ga0208160_1007438All Organisms → Viruses → Predicted Viral3865Open in IMG/M
3300025671|Ga0208898_1072917Not Available1135Open in IMG/M
3300025671|Ga0208898_1106154Not Available842Open in IMG/M
3300025803|Ga0208425_1104441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P658Open in IMG/M
3300025853|Ga0208645_1060559All Organisms → Viruses1749Open in IMG/M
3300026125|Ga0209962_1028692All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes984Open in IMG/M
(restricted) 3300027861|Ga0233415_10295793All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P763Open in IMG/M
(restricted) 3300027861|Ga0233415_10392995Not Available663Open in IMG/M
(restricted) 3300027861|Ga0233415_10686379Not Available501Open in IMG/M
3300028127|Ga0233401_1109934All Organisms → Viruses → environmental samples → uncultured marine virus626Open in IMG/M
3300028196|Ga0257114_1146443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P914Open in IMG/M
3300032255|Ga0316209_1111799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P717Open in IMG/M
3300034374|Ga0348335_129843Not Available728Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine35.03%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater23.57%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous13.38%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.01%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.37%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.82%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.91%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.91%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.27%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.27%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.27%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.64%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.64%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.64%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.64%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.64%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019715Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_2-3_MGEnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020188Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022921Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaGEnvironmentalOpen in IMG/M
3300023273Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaGEnvironmentalOpen in IMG/M
3300024191Seawater microbial communities from Monterey Bay, California, United States - 45DEnvironmentalOpen in IMG/M
3300024221Seawater microbial communities from Monterey Bay, California, United States - 80DEnvironmentalOpen in IMG/M
3300024315Seawater microbial communities from Monterey Bay, California, United States - 20DEnvironmentalOpen in IMG/M
3300024320Seawater microbial communities from Monterey Bay, California, United States - 38DEnvironmentalOpen in IMG/M
3300024428Seawater microbial communities from Monterey Bay, California, United States - 32DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026125Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300028127Seawater microbial communities from Monterey Bay, California, United States - 49DEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300032255Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyriteEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1007753933300000115MarineMLDKIKKAFTKKKPAAKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK*
DelMOSpr2010_1007097213300000116MarineMLDKIKKAIKKMKPASKKTEPKFNNMNDLQNGVAVNRESKSETKSE
DelMOWin2010_1003549133300000117MarineMLDKIKKAFTKKKPSAKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK*
JGI25128J35275_102421633300002488MarineMLDKVKAAIKKMKPATKKKKAEPKFNNMNDLQNGVAVNREVKSETKSE
Ga0055584_10115676513300004097Pelagic MarineMLDKIKKAFTKKKPANKKTEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK*
Ga0075474_1001832723300006025AqueousMLDKIKKAIKKMKPASKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK*
Ga0075478_1000880473300006026AqueousMLEKIKKAIKKMKPANKKAEPKFNNMNDLQKGVAVNKEAKSETISETKSSLTFGK*
Ga0075478_1008346013300006026AqueousMLEKIKKAIKKMKPAKEKAEPKFNNMNDLQKGIAVNKELKSETVSETKSSLTFGK*
Ga0075515_1005421913300006404AqueousKMKPAKKKAEPKFNNMNDLQKGIAVNKETKSETVSETKSSLTFGK*
Ga0075461_1019409823300006637AqueousKKKPAKKKAEPKFNNMNDLQKGVAVNKETKSETVSETKSSLTFGK*
Ga0098038_104589433300006735MarineMLDKIKKAIKKMTPAKKKAEPKFNNMNDLQNGIAVNRETKSETKTDTKSSLTFGK*
Ga0098037_110850513300006737MarineMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQKGIAVNKEVKSETISETKSSLTFGK*
Ga0098037_111697723300006737MarineMLDKIKKAIKKMTPAKKKAEPKFNNMNDLQNAVAVNRETKSETKSDTKSSLTFGK*
Ga0098042_1000054603300006749MarineMLEKIKKAIKKMKPAAKKTEPKFNNMNDLQNAVAVNREVKSETKSETKSSLTFGK*
Ga0098042_100272853300006749MarineMLDKIKKVIKKIKPTAKKAEPKFNNMNDLQKGIAVNKEVKSETVSETKSSLTFGK*
Ga0098048_106052123300006752MarineMLEKIKKAIKKMKPAAKKTEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK*
Ga0098048_106412013300006752MarineMLDKIKKAIKKMTPAKKKAEPKFNNMNDLQKGVAVNRETKSETISETKSSLTFGK*
Ga0098048_112586223300006752MarineKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETVSETKSSLTFGK*
Ga0098048_122072233300006752MarineMLDKIKKAIKKMKPIAKKAEPKFNNMNDLQNGIAVNKEAKSETVSETKSSLTFGK*
Ga0098054_107633523300006789MarineMLDKIKKAIKKITPAKKTTEPKFNNMNDLQNGIAVNRETKSETKTDTKSSLTFGK*
Ga0098054_108215533300006789MarineMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETVSETKSSLTFGK*
Ga0098054_124946013300006789MarineKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK*
Ga0098055_117103413300006793MarineMLDKIKKAIKKIKPTAKKAEPKFNNMNDLQKGIAVNKEAKSETVSETKSSLTFGE*
Ga0098055_123729433300006793MarineMLDKIKKAIKKMKPTAKKAEPKFNNMNDLQNGVAVNRESKSETKSDTKSSLTFGK*
Ga0098055_124542423300006793MarineDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK*
Ga0098055_129875223300006793MarineMLDKIKKAIKKMTPAAKKAEPKFNNMNDLQNAVAVNRETKSETKSDTKSSLTFGK*
Ga0070749_1056254613300006802AqueousMLEKVKAVIKKIKPAKKKIEPKFNNMNDLQNGVAVNRECKSETKSETKSSLTFGK*
Ga0075475_1037726733300006874AqueousMLEKIKKAIKKMKPAKEKAEPKFNNMNDLQKGIAVNKELKSETVSETKSSLTF
Ga0070750_1007723433300006916AqueousMLDKIKKAFTKKKPANKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK*
Ga0070750_1029990423300006916AqueousMLDKIKKAIKKMTPAKKKAEPKFNNMNDLQNAVAVNRETKSETKTDTKSSLTFGK*
Ga0098060_101016533300006921MarineMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK*
Ga0098045_111475413300006922MarineKMKPAAKKAEPKFNNMNDLQKGIAVNKEAKSETISETKSSLTFGK*
Ga0098045_111872913300006922MarineKKMTPAKKKSEPKFNNMNDLQNAVAVNRETKSETKSDTKSSLTFGK*
Ga0098051_110427123300006924MarineNMLDKIKKAIKKMTPAKKKAEPKFNNMNDLQNAVAVNRETKSETKSDTKSSLTFGK*
Ga0098051_116567213300006924MarineKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETKSSLTFGK*
Ga0098051_117862323300006924MarineIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETVSETKSSLTFGK*
Ga0098050_112668913300006925MarineIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK*
Ga0098046_108276613300006990MarineMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEVKSETISETKSSLTFGK*
Ga0070747_109921933300007276AqueousMLEKIKKAIKKMKPAKEKAEPKFNNMNDLQKGIAVNRETKSETVSETKSSLTFGK*
Ga0070752_120396623300007345AqueousFKKKPAKKKTEPKFNNMNDLQKGIAVNKETKSETVSETKSSLTFGK*
Ga0102951_102418433300007725WaterMLGKIKKVFTKKKPAKKKAEPKFNNMNDLQKGVAVNRETKSETISETKSSLTFGK*
Ga0098052_117027033300008050MarineMLDKIKKAIKKMTPAKKKAEPKFNNMNDLQNAVAVNRETKSETKSDTRSSLTFGK*
Ga0102960_126958223300009000Pond WaterMLGKIKKAFTKKKPAKKKAEPKFNNMNDLQKGIAVNRETKSETISETKSSLTFGK*
Ga0102963_108756643300009001Pond WaterMLNKIKKAFTKKKPAKKKAEPKFNNMNDLQKGIAVNRETKSETISETKSSLTFGK*
Ga0098043_118234423300010148MarineMLDKIKKVIKKIKPTTKKTEKKFNNMNDLQNGIAVNRELKSENLSETKSETKSSLTFGK*
Ga0098049_106486523300010149MarineMLDKIKKAIKKMKPAKKTTEPKFNNMNDLQNGIAVNRETKSETKTDTKSSLTFGK*
Ga0098049_112526713300010149MarineKKMKPAAKKAEPKFNNMNDLQKGIAVNKEAKSETVSETKSSLTFGK*
Ga0098049_113065223300010149MarineDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETVSETKSSLTFGK*
Ga0098049_122843533300010149MarineMLDKIKKAIKKIKPAKKAEPKFNNMNDLQKGIAVNKEAKSETISETKSSLTFG
Ga0098056_112677313300010150MarineKIKPAKKAEPKFNNMNDLQKGIAVNKEAKSETISETKSSLTFGK*
Ga0098056_130711733300010150MarineMLEKIKKAIKKMKPAAKKAEPKFNNMNDLQKGIAVNKEAKSETVSETK
Ga0098059_111737623300010153MarineMLDKIKKAIKKMTPVKKKAEPKFNNMNDLQNAVAVNRETKSETKSDTKSSLTFGK*
Ga0129351_117809113300010300Freshwater To Marine Saline GradientAIKKMKPAKKKAEPKFNNMNDLQKGVAVNKETKSETVSETKSSLTFGK*
Ga0182047_118339233300016737Salt MarshMLDKIKKAFTKKKPANKKAEPKFNNMNDLQKGIAVNRETKSETVSETKSSLTFGK
Ga0181369_106423433300017708MarineMLDKIKKAIKKMKPAAKKAESKFNNMNDLQNGIAVNKEAKSETVSETKSSLTFGK
Ga0181391_104923713300017713SeawaterMLDKIKKAIKKMKPAAKKAEPKFNNMNNLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0181391_109685013300017713SeawaterMLDKIKKAIKKMKPTAKKAEPKFNNMNDLQKGVAINRESKSETVSETKSSLTFGK
Ga0181412_101654433300017714SeawaterMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGVAVNKESKSETISETKSSLTFGK
Ga0181412_106944123300017714SeawaterKIKKAIKKMKPTAKKEEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0181390_117164123300017719SeawaterMLDKIKKAIKKMKPAAKKEEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0181383_100811923300017720SeawaterMLDKIKKVIKKMKPAAKKAEPKFNNMNDLQNGVAVNRESKSETKSDTKSSLTFGK
Ga0181381_100589513300017726SeawaterKKMKPAAKKAEPKFNNMNDLQKGVAVNRESKSETKSDTKSSLTFGK
Ga0181381_101553643300017726SeawaterMFDKIKKAIKKIKPTAKKAEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0181401_104070633300017727SeawaterMLDKIKKAFTKKKPASKKAEPKFNNMNDLQNGVAVNKESKSETISETKSSLTFGK
Ga0181401_104325433300017727SeawaterMLDKIKKAIKKMKPTAKKAEPKFNNMNDLQKGVAVNRQSKSETISETKSSLTFGK
Ga0181401_105001823300017727SeawaterMLDKIKKAIKKITPEKKKAEPKFNNMNDLQKGIAVNREVKSETVSETKSSLTFGK
Ga0181401_105732413300017727SeawaterMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGVAVNKESKSETVSETKSSLTLGK
Ga0181426_101831823300017733SeawaterMLDKIKKAIKKMKPTAKKEEPKFNNMNDLQKGIAVNKESKSETISETKSSLTFGK
Ga0187222_102674413300017734SeawaterMLDKIKKVIKKMKPAEKKAEPKFNNMNDLQNGVAVNKESKSETISETKSSLTFGK
Ga0181428_110446823300017738SeawaterMLDKIKKAIKKMKPAAKKTEPKFNNMNDLQKGVAVNRESKSETISETKSSLTFGK
Ga0181399_106630633300017742SeawaterMLDKIKKAIKKMTPAKKKAEPKFNNMNDLQKGIAVNREAKSETVSETKSSLTFGK
Ga0181399_116674913300017742SeawaterINMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0181397_104773023300017744SeawaterMLDKIKKAFTKKKPDAKKAETKFNNMNDLQNGVAVNRETKSETKSETKSSLTFGK
Ga0181393_108203233300017748SeawaterMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFG
Ga0181392_107219213300017749SeawaterMLDKIKKAIKKMKPAAKKTEPKFNNMNDLQKGVAVNREYKSETKSDTKSSLTFGK
Ga0181392_107929713300017749SeawaterEINMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGVAVNRESKSETKSDTKSSLTFGK
Ga0187219_122424123300017751SeawaterMLDKIKKAIKKMTPTAKKAEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0181407_113957513300017753SeawaterMFDKIKKAIKKIKPTAKKTEPKFNNMNDLQNGVAVNKESKSETVSETKSSLTLGK
Ga0181411_113943223300017755SeawaterMLDKIKKAIKKIKPAAKKAEPKFNNMNDLQKGIAVNIESKSETISETKSSLTFGK
Ga0181382_104068923300017756SeawaterMLDKIKKAIKKMTPTAKKAEPKFNNMNDLQNGVAVNRESKSETKSDTKSSLTFGK
Ga0181420_121950323300017757SeawaterMLDKIKKAIKKMKPTAKKAEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0181409_115043013300017758SeawaterMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGVAVNKESKSETVSETKSSLTFGK
Ga0181408_117677023300017760SeawaterMLDKIKKAIKKMKPAAKKEEPKFNNMNDLQNGVAVNRKSKYETKSGTKSSLTFGK
Ga0181422_100542833300017762SeawaterMLDKIKKVIKKIKPTTKKTEKKFNNMNDLQNGIAVNRELKSENLSETKSETKSSLTFGK
Ga0187221_112390113300017769SeawaterKAFTKKKPAKKKAEPKFNNMNDLQKGIAVNRETKSETISETKSSLTFGK
Ga0187217_110011413300017770SeawaterINMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGVAVNRESKSETKSDTKSSLTFGK
Ga0181394_108358023300017776SeawaterMLDKIKKAIKKMKPTAKKAETKFNNMNDLQNGVAVNRETKSETKSETKSSLTFGK
Ga0181423_127858323300017781SeawaterMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGVAVNRESKSETKSDTKSSLKFGK
Ga0181380_100289463300017782SeawaterMLDKVKAAIKKIKPATKKKKAEPKFNNMNDLQNGIAVNREVKSETKSETKSSLTFGK
Ga0181424_1011611633300017786SeawaterMLDKIKKAIKKMKPAEKKAEPKFNNMNDLQKGIAVNKESKSETISETKSSLTFGK
Ga0181607_1049299923300017950Salt MarshMLDKIKKAIKKMKPASKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK
Ga0181606_1064592823300018048Salt MarshKKKPAKKKAEPKFNNMNDLQKGVAVNKETKSETVSETKSSLTFGK
Ga0181559_1076673613300018415Salt MarshKAIKKMKPAKKKAEPKFNNMNDLQKGVAVNKETKSETVSETKSSLTLGK
Ga0181553_1011977333300018416Salt MarshMLDKIKKAFTKKKPANKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK
Ga0181562_1021342213300019459Salt MarshTKKKPAKKKAEPKFNNMNDLQKGIAVNKETKSETVSETKSSLTFGK
Ga0193966_103635823300019715SedimentMLDKIKKAFTKKKPSAKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK
Ga0181602_1024703913300020173Salt MarshKKKPAKKKAEPKFNNMNDLQKGIAVNKETKSETISETKSSLTFGK
Ga0181605_1018746533300020188Salt MarshFTKKKPAKKKAEPKFNNMNDLQKGVAVNKETKSETISETKSSLTFGK
Ga0211576_1063067123300020438MarineIKKMKPAAKKAEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0211577_1049460033300020469MarineMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0213867_101231433300021335SeawaterMLDKIKKAFTKKKPAAKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK
Ga0213865_1020162833300021373SeawaterTIKIMKPGKKKTEPKFNNMNDLQKGVAVNRETKSETVSETKSSLTFGK
Ga0213866_1038990233300021425SeawaterMLDKIKKAIKKMKPASKKAEPKFNNMNDLQNGVAVNRESKCETVSET
Ga0222717_1001616673300021957Estuarine WaterMFDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0222717_1005113533300021957Estuarine WaterMLDKIKKAIKKMKPTAKKAEPKFNNMNDLQNGVAVNKESKSETISETKSSLTFGK
Ga0222717_1040305023300021957Estuarine WaterMLGKIKKAIKKIKPAKKKAEPKFNNMNDLQKGIAVNRETKSETISETKSSLTFGK
Ga0222717_1059504533300021957Estuarine WaterMLDKIKKAFTKKKPAAKKAETKFNNMNDLQNGVAVNRETKSETKSETKSSLTFGK
Ga0222718_1021780113300021958Estuarine WaterMLGKIKKAFTKKKPAKKKAEPKFNNMNDLQKGIAVNRETKSETISETKSSLTFGK
Ga0222719_1035463713300021964Estuarine WaterMLGKIKKVFTKKKPAKKKTEPKFNNMNDLQKGVAVNRETKSETISETKSSLTFGK
Ga0224906_1000391253300022074SeawaterMLDKIKKAIKKMKPTAKKEEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0224906_100710243300022074SeawaterMLDKIKKAIKKMKPAEKKAEPKFNNMNDLQNGIAVNKESKSETISETKSSLTFGK
Ga0196891_101198333300022183AqueousFTKKKPAKKKAEPKFNNMNDLQKGVAVNKETKSETVSETKSSLTFGK
Ga0196899_111470233300022187AqueousIKKMKPASKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK
Ga0255765_117875413300022921Salt MarshVFTKKKPAKKKAEPKFNNMNDLQKGVAVNKETKSETISETKSSLTFGK
Ga0255763_127077123300023273Salt MarshIKKKPAKKKAEPKFNNMNDLQKGVAVNKETKSETVSETKSSLTFGK
Ga0228636_110376113300024191SeawaterMLDKIKKAIKKITPAKKKAEPKFNNMNDLQKGIAVNKESKSETISETKSSLTFGK
Ga0228666_107822823300024221SeawaterMLDKIKKAIKKMKPTAKKEEPKFNNMNDLQNGVAVNRESKSETKSDTKSSLTFGK
Ga0228618_106674213300024315SeawaterMLDKIKKAIKKMKPVAKKAEPKFNNINDLQKGIAVNKESKSETISETK
Ga0233398_102070513300024320SeawaterKIKKAIKKMKPAAKKAEPKFNNMNDLQNGVAVNRESKSETKSDTKSSLTFGK
Ga0233398_103281313300024320SeawaterMFDKIKKAIKKMKPVAKKEEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0233398_114049923300024320SeawaterMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQKGIAVNKESKSETISETKSSLTFGK
Ga0233396_105879433300024428SeawaterMLDKIKKAIKKITPAKKKAEPKFNNMNDLQKGIAVNKESKSETISETKSSLT
Ga0208667_100378733300025070MarineMLDKIKKAIKKMTPAKKKAEPKFNNMNDLQNAVAVNRETKSETKSDTKSSLTFGK
Ga0208667_100569563300025070MarineMLEKIKKAIKKMKPAAKKTEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK
Ga0208667_101858613300025070MarineKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK
Ga0208667_102224523300025070MarineMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETVSETKSSLTFGK
Ga0208667_103268523300025070MarineMLDKIKKAIKKMTPAKKKAEPKFNNMNDLQKGVAVNRETKSETISETKSSLTFGK
Ga0208667_105707333300025070MarineMLDKIKKAIKKMTPAKKKAEPKFNNMNDLQNGIAVNRETKSETKTDTKSSLTFGK
Ga0208667_106559923300025070MarineMLDKIKKAIKKIKPAKKAEPKFNNMNDLQKGIAVNKEAKSETISETKSSLTFGK
Ga0208667_106893123300025070MarineAIKKMKPAKKTTEPKFNNMNDLQNGIAVNRETKSETKTDTKSSLTFGK
Ga0208791_101313233300025083MarineMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK
Ga0208791_105375613300025083MarineKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK
Ga0208298_100809313300025084MarineLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK
Ga0208298_102023913300025084MarineLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETVSETKSSLTFGK
Ga0208792_105579913300025085MarineKIKKAIKKMTPAAKKAEPKFNNMNDLQNAVAVNRETKSETKSDTKSSLTFGK
Ga0208792_106798613300025085MarineIKKAIKKMKPAAKKAEPKFNNMNDLQNGIAVNKEAKSETISETKSSLTFGK
Ga0208434_106444423300025098MarineMLDKIKKAIKKMKPIAKKAEPKFNNMNDLQNGIAVNKEAKSETVSETKSSLTFGK
Ga0208434_110597523300025098MarineKKMTPTAKKAEPKFNNMNDLQNAVAVNRETKSETKSDTKSSLTFGK
Ga0208669_104323123300025099MarineMLDKIKKAIKKITPAKKTTEPKFNNMNDLQNGIAVNRETKSETKTDTKSSLTFGK
Ga0208669_107604613300025099MarineMLDKIKKAIKKMTPAKKKSEPKFNNMNDLQNAVAVNRETKSETKSDTKSSLTFGK
Ga0208159_1000073583300025101MarineMLEKIKKAIKKMKPAAKKTEPKFNNMNDLQNAVAVNREVKSETKSETKSSLTFGK
Ga0208159_1001170153300025101MarineMLDKIKKVIKKIKPTAKKAEPKFNNMNDLQKGIAVNKEVKSETVSETKSSLTFGK
Ga0208149_107525833300025610AqueousMLDKIKKAIKKMKPASKKAEPKFNNMNDLQNGVAVNRESKSETKSE
Ga0208149_108222113300025610AqueousKKAIKKMKPASKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK
Ga0208160_100743833300025647AqueousMLEKVKAVIKKIKPAKKKIEPKFNNMNDLQNGVAVNRECKSETKSETKSSLTFGK
Ga0208898_107291723300025671AqueousMLEKIKKVFKKKPANKKAEPKFNNMNDLQKGVAVNKEAKSETISETKSSLTFGK
Ga0208898_110615413300025671AqueousKKKPAKKKAEPKFNNMNDLQKGIAVNRETKSETVSETKSSLTFGK
Ga0208425_110444113300025803AqueousKKMKPASKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK
Ga0208645_106055913300025853AqueousKAFTKKKPAAKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK
Ga0209962_102869233300026125WaterMLGKIKKVFTKKKPAKKKAEPKFNNMNDLQKGVAVNRETKSETISETKSSLTFGK
(restricted) Ga0233415_1029579323300027861SeawaterNMFDKIKKAIKKMKPAAKKAEPKFNNMNDLQNAVAVNRESKSETKSETKSSLTFGK
(restricted) Ga0233415_1039299523300027861SeawaterMLDKIKKAIKKMKPAAKKAEPKFNNMNDLQNGVAVNRESKSETKSDTKSSLTFGK
(restricted) Ga0233415_1068637923300027861SeawaterMLDKIKKAIKKITPEKKKAEPKFNNMNDLQKGIAVNREAKSETVSETKSSLTFGK
Ga0233401_110993413300028127SeawaterKKAIKKMKPTAKKEEPKFNNMNDLQNGIAVNRESKSETKSDTKSSLTFGK
Ga0257114_114644313300028196MarineMFDKIKKAIKKIKPATKKAEPKFNNMNDLQNGVAVNRESKSETKSETKSSLTFGK
Ga0316209_111179933300032255Microbial MatMLEKIKKAIKKMKPANKKAEPKFNNMNDLQNGVAVNRESKSETKSE
Ga0348335_129843_259_4263300034374AqueousMLEKIKKAIKKMKPAKEKAEPKFNNMNDLQKGIAVNKELKSETVSETKSSLTFGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.