NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F043207

Metatranscriptome Family F043207

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043207
Family Type Metatranscriptome
Number of Sequences 156
Average Sequence Length 84 residues
Representative Sequence MDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Number of Associated Samples 107
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 48.08 %
% of genes from short scaffolds (< 2000 bps) 98.72 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.718 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(94.231 % of family members)
Environment Ontology (ENVO) Unclassified
(95.513 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(98.718 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.83%    β-sheet: 0.00%    Coil/Unstructured: 71.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF17135Ribosomal_L18 0.64
PF01781Ribosomal_L38e 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.72 %
UnclassifiedrootN/A1.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008834|Ga0103882_10087727All Organisms → cellular organisms → Eukaryota525Open in IMG/M
3300018521|Ga0193171_107041All Organisms → cellular organisms → Eukaryota517Open in IMG/M
3300018533|Ga0193523_112479All Organisms → cellular organisms → Eukaryota563Open in IMG/M
3300018534|Ga0193486_108835All Organisms → cellular organisms → Eukaryota569Open in IMG/M
3300018566|Ga0193331_1006778All Organisms → cellular organisms → Eukaryota554Open in IMG/M
3300018580|Ga0193510_1013520All Organisms → cellular organisms → Eukaryota552Open in IMG/M
3300018582|Ga0193454_1017008All Organisms → cellular organisms → Eukaryota531Open in IMG/M
3300018590|Ga0193114_1022474All Organisms → cellular organisms → Eukaryota621Open in IMG/M
3300018591|Ga0193398_1005506All Organisms → cellular organisms → Eukaryota554Open in IMG/M
3300018605|Ga0193339_1020255All Organisms → cellular organisms → Eukaryota644Open in IMG/M
3300018617|Ga0193133_1024250All Organisms → cellular organisms → Eukaryota526Open in IMG/M
3300018631|Ga0192890_1052914All Organisms → cellular organisms → Eukaryota501Open in IMG/M
3300018639|Ga0192864_1051359All Organisms → cellular organisms → Eukaryota602Open in IMG/M
3300018645|Ga0193071_1014923All Organisms → cellular organisms → Eukaryota570Open in IMG/M
3300018645|Ga0193071_1019641All Organisms → cellular organisms → Eukaryota504Open in IMG/M
3300018656|Ga0193269_1051640All Organisms → cellular organisms → Eukaryota560Open in IMG/M
3300018658|Ga0192906_1042877All Organisms → cellular organisms → Eukaryota501Open in IMG/M
3300018666|Ga0193159_1044516All Organisms → cellular organisms → Eukaryota571Open in IMG/M
3300018676|Ga0193137_1045551All Organisms → cellular organisms → Eukaryota627Open in IMG/M
3300018676|Ga0193137_1051658All Organisms → cellular organisms → Eukaryota590Open in IMG/M
3300018680|Ga0193263_1056705All Organisms → cellular organisms → Eukaryota501Open in IMG/M
3300018686|Ga0192840_1046386All Organisms → cellular organisms → Eukaryota540Open in IMG/M
3300018686|Ga0192840_1050440All Organisms → cellular organisms → Eukaryota517Open in IMG/M
3300018688|Ga0193481_1077269All Organisms → cellular organisms → Eukaryota508Open in IMG/M
3300018688|Ga0193481_1077458All Organisms → cellular organisms → Eukaryota507Open in IMG/M
3300018691|Ga0193294_1035827All Organisms → cellular organisms → Eukaryota568Open in IMG/M
3300018693|Ga0193264_1058378All Organisms → cellular organisms → Eukaryota556Open in IMG/M
3300018693|Ga0193264_1060284All Organisms → cellular organisms → Eukaryota543Open in IMG/M
3300018701|Ga0193405_1044888All Organisms → cellular organisms → Eukaryota514Open in IMG/M
3300018703|Ga0193274_1029005All Organisms → cellular organisms → Eukaryota581Open in IMG/M
3300018706|Ga0193539_1066867All Organisms → cellular organisms → Eukaryota560Open in IMG/M
3300018712|Ga0192893_1081975All Organisms → cellular organisms → Eukaryota535Open in IMG/M
3300018712|Ga0192893_1086360All Organisms → cellular organisms → Eukaryota514Open in IMG/M
3300018713|Ga0192887_1044780All Organisms → cellular organisms → Eukaryota591Open in IMG/M
3300018713|Ga0192887_1057667All Organisms → cellular organisms → Eukaryota517Open in IMG/M
3300018715|Ga0193537_1093617All Organisms → cellular organisms → Eukaryota560Open in IMG/M
3300018720|Ga0192866_1070929All Organisms → cellular organisms → Eukaryota523Open in IMG/M
3300018720|Ga0192866_1072945All Organisms → cellular organisms → Eukaryota513Open in IMG/M
3300018721|Ga0192904_1062763All Organisms → cellular organisms → Eukaryota556Open in IMG/M
3300018731|Ga0193529_1082935All Organisms → cellular organisms → Eukaryota550Open in IMG/M
3300018741|Ga0193534_1045575All Organisms → cellular organisms → Eukaryota672Open in IMG/M
3300018741|Ga0193534_1067930All Organisms → cellular organisms → Eukaryota523Open in IMG/M
3300018741|Ga0193534_1069892All Organisms → cellular organisms → Eukaryota513Open in IMG/M
3300018751|Ga0192938_1094964All Organisms → cellular organisms → Eukaryota546Open in IMG/M
3300018769|Ga0193478_1040967All Organisms → cellular organisms → Eukaryota747Open in IMG/M
3300018769|Ga0193478_1074613All Organisms → cellular organisms → Eukaryota538Open in IMG/M
3300018770|Ga0193530_1077001All Organisms → cellular organisms → Eukaryota630Open in IMG/M
3300018770|Ga0193530_1099540All Organisms → cellular organisms → Eukaryota528Open in IMG/M
3300018782|Ga0192832_1054593All Organisms → cellular organisms → Eukaryota552Open in IMG/M
3300018783|Ga0193197_1051144All Organisms → cellular organisms → Eukaryota619Open in IMG/M
3300018783|Ga0193197_1070685All Organisms → cellular organisms → Eukaryota515Open in IMG/M
3300018785|Ga0193095_1102306All Organisms → cellular organisms → Eukaryota500Open in IMG/M
3300018798|Ga0193283_1075032All Organisms → cellular organisms → Eukaryota517Open in IMG/M
3300018801|Ga0192824_1027700All Organisms → cellular organisms → Eukaryota1226Open in IMG/M
3300018803|Ga0193281_1099387All Organisms → cellular organisms → Eukaryota545Open in IMG/M
3300018829|Ga0193238_1118762All Organisms → cellular organisms → Eukaryota523Open in IMG/M
3300018856|Ga0193120_1151463All Organisms → cellular organisms → Eukaryota520Open in IMG/M
3300018857|Ga0193363_1116627All Organisms → cellular organisms → Eukaryota529Open in IMG/M
3300018861|Ga0193072_1109588All Organisms → cellular organisms → Eukaryota522Open in IMG/M
3300018865|Ga0193359_1092420All Organisms → cellular organisms → Eukaryota570Open in IMG/M
3300018867|Ga0192859_1071936All Organisms → cellular organisms → Eukaryota569Open in IMG/M
3300018870|Ga0193533_1129240All Organisms → cellular organisms → Eukaryota513Open in IMG/M
3300018872|Ga0193162_1110377All Organisms → cellular organisms → Eukaryota516Open in IMG/M
3300018879|Ga0193027_1102904All Organisms → cellular organisms → Eukaryota561Open in IMG/M
3300018879|Ga0193027_1123625All Organisms → cellular organisms → Eukaryota502Open in IMG/M
3300018883|Ga0193276_1123937All Organisms → cellular organisms → Eukaryota517Open in IMG/M
3300018883|Ga0193276_1124321All Organisms → cellular organisms → Eukaryota516Open in IMG/M
3300018898|Ga0193268_1181401All Organisms → cellular organisms → Eukaryota577Open in IMG/M
3300018901|Ga0193203_10291227All Organisms → cellular organisms → Eukaryota503Open in IMG/M
3300018905|Ga0193028_1116213All Organisms → cellular organisms → Eukaryota514Open in IMG/M
3300018912|Ga0193176_10195827All Organisms → cellular organisms → Eukaryota573Open in IMG/M
3300018921|Ga0193536_1211484All Organisms → cellular organisms → Eukaryota710Open in IMG/M
3300018921|Ga0193536_1234584All Organisms → cellular organisms → Eukaryota649Open in IMG/M
3300018921|Ga0193536_1254895All Organisms → cellular organisms → Eukaryota602Open in IMG/M
3300018923|Ga0193262_10114599All Organisms → cellular organisms → Eukaryota531Open in IMG/M
3300018935|Ga0193466_1151432All Organisms → cellular organisms → Eukaryota556Open in IMG/M
3300018937|Ga0193448_1148373All Organisms → cellular organisms → Eukaryota509Open in IMG/M
3300018940|Ga0192818_10193660All Organisms → cellular organisms → Eukaryota569Open in IMG/M
3300018941|Ga0193265_10228015All Organisms → cellular organisms → Eukaryota567Open in IMG/M
3300018950|Ga0192892_10263006All Organisms → cellular organisms → Eukaryota529Open in IMG/M
3300018953|Ga0193567_10062759All Organisms → cellular organisms → Eukaryota1227Open in IMG/M
3300018953|Ga0193567_10208804All Organisms → cellular organisms → Eukaryota599Open in IMG/M
3300018953|Ga0193567_10223609All Organisms → cellular organisms → Eukaryota569Open in IMG/M
3300018959|Ga0193480_10215119All Organisms → cellular organisms → Eukaryota556Open in IMG/M
3300018965|Ga0193562_10180864All Organisms → cellular organisms → Eukaryota593Open in IMG/M
3300018965|Ga0193562_10185309All Organisms → cellular organisms → Eukaryota584Open in IMG/M
3300018965|Ga0193562_10186296All Organisms → cellular organisms → Eukaryota582Open in IMG/M
3300018967|Ga0193178_10077058All Organisms → cellular organisms → Eukaryota526Open in IMG/M
3300018968|Ga0192894_10300386All Organisms → cellular organisms → Eukaryota538Open in IMG/M
3300018969|Ga0193143_10184094All Organisms → cellular organisms → Eukaryota608Open in IMG/M
3300018974|Ga0192873_10385158All Organisms → cellular organisms → Eukaryota569Open in IMG/M
3300018979|Ga0193540_10201604All Organisms → cellular organisms → Eukaryota547Open in IMG/M
3300018979|Ga0193540_10201605All Organisms → cellular organisms → Eukaryota547Open in IMG/M
3300018979|Ga0193540_10202839All Organisms → cellular organisms → Eukaryota545Open in IMG/M
3300018979|Ga0193540_10215468All Organisms → cellular organisms → Eukaryota524Open in IMG/M
3300018980|Ga0192961_10220957All Organisms → cellular organisms → Eukaryota563Open in IMG/M
3300018985|Ga0193136_10204846All Organisms → cellular organisms → Eukaryota588Open in IMG/M
3300018985|Ga0193136_10204848All Organisms → cellular organisms → Eukaryota588Open in IMG/M
3300018985|Ga0193136_10206861All Organisms → cellular organisms → Eukaryota585Open in IMG/M
3300018986|Ga0193554_10309953All Organisms → cellular organisms → Eukaryota597Open in IMG/M
3300018986|Ga0193554_10384753All Organisms → cellular organisms → Eukaryota527Open in IMG/M
3300018986|Ga0193554_10386626All Organisms → cellular organisms → Eukaryota525Open in IMG/M
3300018988|Ga0193275_10228730All Organisms → cellular organisms → Eukaryota582Open in IMG/M
3300018988|Ga0193275_10229529All Organisms → cellular organisms → Eukaryota581Open in IMG/M
3300018989|Ga0193030_10232788All Organisms → cellular organisms → Eukaryota605Open in IMG/M
3300018991|Ga0192932_10330944All Organisms → cellular organisms → Eukaryota551Open in IMG/M
3300018991|Ga0192932_10340880All Organisms → cellular organisms → Eukaryota539Open in IMG/M
3300018992|Ga0193518_10316882All Organisms → cellular organisms → Eukaryota553Open in IMG/M
3300018992|Ga0193518_10318319All Organisms → cellular organisms → Eukaryota551Open in IMG/M
3300018994|Ga0193280_10319659All Organisms → cellular organisms → Eukaryota562Open in IMG/M
3300018998|Ga0193444_10112935All Organisms → cellular organisms → Eukaryota719Open in IMG/M
3300019001|Ga0193034_10178590All Organisms → cellular organisms → Eukaryota526Open in IMG/M
3300019001|Ga0193034_10186409All Organisms → cellular organisms → Eukaryota517Open in IMG/M
3300019003|Ga0193033_10208317All Organisms → cellular organisms → Eukaryota542Open in IMG/M
3300019003|Ga0193033_10233542All Organisms → cellular organisms → Eukaryota502Open in IMG/M
3300019006|Ga0193154_10253120All Organisms → cellular organisms → Eukaryota601Open in IMG/M
3300019006|Ga0193154_10253160All Organisms → cellular organisms → Eukaryota601Open in IMG/M
3300019006|Ga0193154_10255397All Organisms → cellular organisms → Eukaryota597Open in IMG/M
3300019006|Ga0193154_10259713All Organisms → cellular organisms → Eukaryota590Open in IMG/M
3300019012|Ga0193043_10350555All Organisms → cellular organisms → Eukaryota515Open in IMG/M
3300019014|Ga0193299_10350436All Organisms → cellular organisms → Eukaryota541Open in IMG/M
3300019016|Ga0193094_10256923All Organisms → cellular organisms → Eukaryota568Open in IMG/M
3300019018|Ga0192860_10310098All Organisms → cellular organisms → Eukaryota566Open in IMG/M
3300019018|Ga0192860_10311744All Organisms → cellular organisms → Eukaryota564Open in IMG/M
3300019023|Ga0193561_10142546All Organisms → cellular organisms → Eukaryota969Open in IMG/M
3300019023|Ga0193561_10343648All Organisms → cellular organisms → Eukaryota512Open in IMG/M
3300019024|Ga0193535_10229624All Organisms → cellular organisms → Eukaryota581Open in IMG/M
3300019024|Ga0193535_10229626All Organisms → cellular organisms → Eukaryota581Open in IMG/M
3300019024|Ga0193535_10229632All Organisms → cellular organisms → Eukaryota581Open in IMG/M
3300019026|Ga0193565_10269407All Organisms → cellular organisms → Eukaryota577Open in IMG/M
3300019030|Ga0192905_10192782All Organisms → cellular organisms → Eukaryota562Open in IMG/M
3300019030|Ga0192905_10196357All Organisms → cellular organisms → Eukaryota555Open in IMG/M
3300019037|Ga0192886_10213765All Organisms → cellular organisms → Eukaryota622Open in IMG/M
3300019037|Ga0192886_10275696All Organisms → cellular organisms → Eukaryota554Open in IMG/M
3300019038|Ga0193558_10089228All Organisms → cellular organisms → Eukaryota1235Open in IMG/M
3300019040|Ga0192857_10295038All Organisms → cellular organisms → Eukaryota552Open in IMG/M
3300019040|Ga0192857_10370266All Organisms → cellular organisms → Eukaryota501Open in IMG/M
3300019053|Ga0193356_10263712All Organisms → cellular organisms → Eukaryota607Open in IMG/M
3300019053|Ga0193356_10311628All Organisms → cellular organisms → Eukaryota552Open in IMG/M
3300019053|Ga0193356_10336469All Organisms → cellular organisms → Eukaryota528Open in IMG/M
3300019067|Ga0193459_104061All Organisms → cellular organisms → Eukaryota518Open in IMG/M
3300019111|Ga0193541_1064726All Organisms → cellular organisms → Eukaryota644Open in IMG/M
3300019111|Ga0193541_1064729All Organisms → cellular organisms → Eukaryota644Open in IMG/M
3300019111|Ga0193541_1091138All Organisms → cellular organisms → Eukaryota523Open in IMG/M
3300019129|Ga0193436_1067907All Organisms → cellular organisms → Eukaryota540Open in IMG/M
3300019148|Ga0193239_10319880All Organisms → cellular organisms → Eukaryota529Open in IMG/M
3300021872|Ga0063132_100477All Organisms → cellular organisms → Eukaryota525Open in IMG/M
3300021893|Ga0063142_1003186All Organisms → cellular organisms → Eukaryota545Open in IMG/M
3300021904|Ga0063131_1022667All Organisms → cellular organisms → Eukaryota500Open in IMG/M
3300021912|Ga0063133_1005065All Organisms → cellular organisms → Eukaryota509Open in IMG/M
3300021935|Ga0063138_1018581All Organisms → cellular organisms → Eukaryota554Open in IMG/M
3300021935|Ga0063138_1039361All Organisms → cellular organisms → Eukaryota509Open in IMG/M
3300031738|Ga0307384_10546913All Organisms → cellular organisms → Eukaryota551Open in IMG/M
3300031743|Ga0307382_10502374All Organisms → cellular organisms → Eukaryota555Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine94.23%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.13%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300018521Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000311 (ERX1782300-ERR1712011)EnvironmentalOpen in IMG/M
3300018533Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_147 - TARA_N000002107 (ERX1789415-ERR1719338)EnvironmentalOpen in IMG/M
3300018534Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789412-ERR1719179)EnvironmentalOpen in IMG/M
3300018566Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001742 (ERX1789486-ERR1719286)EnvironmentalOpen in IMG/M
3300018580Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003039 (ERX1789370-ERR1719227)EnvironmentalOpen in IMG/M
3300018582Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789727-ERR1719292)EnvironmentalOpen in IMG/M
3300018590Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782335-ERR1712116)EnvironmentalOpen in IMG/M
3300018591Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002039 (ERX1782350-ERR1711882)EnvironmentalOpen in IMG/M
3300018605Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177)EnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018631Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000709 (ERX1789487-ERR1719508)EnvironmentalOpen in IMG/M
3300018639Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782310-ERR1712181)EnvironmentalOpen in IMG/M
3300018645Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002739 (ERX1789677-ERR1719371)EnvironmentalOpen in IMG/M
3300018656Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789469-ERR1719513)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018676Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913)EnvironmentalOpen in IMG/M
3300018680Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001123 (ERX1789497-ERR1719250)EnvironmentalOpen in IMG/M
3300018686Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000593 (ERX1789430-ERR1719415)EnvironmentalOpen in IMG/M
3300018688Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789672-ERR1719470)EnvironmentalOpen in IMG/M
3300018691Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001616 (ERX1782222-ERR1712214)EnvironmentalOpen in IMG/M
3300018693Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001288 (ERX1789601-ERR1719212)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018703Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782405-ERR1712108)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018712Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000711 (ERX1789456-ERR1719466)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018715Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789494-ERR1719339)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018721Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789483-ERR1719260)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018751Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001514 (ERX1789607-ERR1719173)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018785Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789545-ERR1719351)EnvironmentalOpen in IMG/M
3300018798Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001604 (ERX1789622-ERR1719156)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018803Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789721-ERR1719184)EnvironmentalOpen in IMG/M
3300018829Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001477 (ERX1789429-ERR1719435)EnvironmentalOpen in IMG/M
3300018856Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782473-ERR1712200)EnvironmentalOpen in IMG/M
3300018857Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001828 (ERX1789640-ERR1719290)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018865Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001824 (ERX1789688-ERR1719211)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018898Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789568-ERR1719317)EnvironmentalOpen in IMG/M
3300018901Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782459-ERR1712126)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018912Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782195-ERR1712243)EnvironmentalOpen in IMG/M
3300018921Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789458-ERR1719341)EnvironmentalOpen in IMG/M
3300018923Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001123 (ERX1789560-ERR1719496)EnvironmentalOpen in IMG/M
3300018935Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002175 (ERX1789599-ERR1719494)EnvironmentalOpen in IMG/M
3300018937Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002364 (ERX1789592-ERR1719202)EnvironmentalOpen in IMG/M
3300018940Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105)EnvironmentalOpen in IMG/M
3300018941Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001288 (ERX1789482-ERR1719320)EnvironmentalOpen in IMG/M
3300018950Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000711 (ERX1789413-ERR1719427)EnvironmentalOpen in IMG/M
3300018953Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753EnvironmentalOpen in IMG/M
3300018959Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789530-ERR1719318)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018991Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000884 (ERX1789359-ERR1719369)EnvironmentalOpen in IMG/M
3300018992Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_146 - TARA_N000003240 (ERX1789485-ERR1719233)EnvironmentalOpen in IMG/M
3300018994Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789578-ERR1719368)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019014Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789400-ERR1719204)EnvironmentalOpen in IMG/M
3300019016Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789509-ERR1719322)EnvironmentalOpen in IMG/M
3300019018Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000981 (ERX1789537-ERR1719348)EnvironmentalOpen in IMG/M
3300019023Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_145 - TARA_N000003231EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019026Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002719EnvironmentalOpen in IMG/M
3300019030Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789399-ERR1719153)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019038Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003141EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019067Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002412 (ERX1782229-ERR1712040)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019148Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001477 (ERX1789676-ERR1719431)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021904Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103882_1008772713300008834Surface Ocean WaterVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHNVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAPMVP
Ga0193171_10704113300018521MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILGDGLGAVGAAHILDMTPAVLVAA
Ga0193523_11247913300018533MarineVDGAGHAVVELGIQLRQLVAGVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSTVVATLGGHPLASDFSLVEVNQAIKA
Ga0193486_10883513300018534MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLL
Ga0193331_100677813300018566MarineVDGAGDAVVELGIQLGQLVAGVDAGLRDVPDGGRLHNVPDHKLPDRLVLGDALGAVGAADVLDVAPAVLVPSVVPPLRRHLLLRSVIKLCK
Ga0193510_101352023300018580MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLLRSVIKLCKL
Ga0193454_101700813300018582MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLLRSVIKLESL
Ga0193114_102247413300018590MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHNVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAHGSSSSRSS
Ga0193398_100550623300018591MarineVDGARDAVVKLGIQLGQLVAGVNAGLRDVPDSRSLHDVPDHELTNRLILRDSLGAVSAAHILDVAPAVLVAAMVPP
Ga0193339_102025513300018605MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLFN
Ga0193133_102425013300018617MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHNVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAM
Ga0192890_105291413300018631MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0192864_105135913300018639MarineVDSAGHAVVELRIQFGKLVARVDASLRDIPDSSSLHNVPDHELPDRLVLGDTLGAVGATDILDVAPAMLVTSVVPPLRSHLLL
Ga0193071_101492313300018645MarineVDGAGHAVVELGIQLRQLVAGVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSPVVATLGGHPVASDFSLVEVNQAIKA
Ga0193071_101964113300018645MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLNDVPDHELTDRLILRDGLGAVSAAHILDVAPAVLVSAMVPPLRGHLLLRSVIKLE
Ga0193269_105164013300018656MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSRSLHDVPDHELADRLILRDGLRAVSAAHILDVAPAVLVAAMVPPLRGHLLLRSVIKLCKLG
Ga0192906_104287713300018658MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVP
Ga0193159_104451613300018666MarineMDRAGDAVVEFGVQLGQLVAGVDARLGDVPDSSGLHNVPDNELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193137_104555113300018676MarineVDGARDAVVKLGIQLRQLVAGVDAGLRDVPDSSSLHNVPDHELTDRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLKFFTQPLLSARVLYTPH
Ga0193137_105165813300018676MarineVNSARHAVVELSIQLGQLVAGVDTGLRDVSDSGRLHNVPDYELPDRLVLGDALGAVGAADVLDVAPAVLVTSVVPPLRRHLLL
Ga0193263_105670513300018680MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSGSLHNVPDNELPDRLVLRDTLGAVGAADVLDVTPTVLVASVVPPFEVIFS
Ga0192840_104638613300018686MarineVDGAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSTVVATLRGHPVASDFSLVEVNQAIKA
Ga0192840_105044013300018686MarineVNSAGHAVVELSIQLGQLVASVDTGLRDVSDSGRLHNVPDHELPDRLVLGDALGAVGAANILDVTSAVLVSTVVATLRGHPVASDFSLVEVNQAIKA
Ga0193481_107726913300018688MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSSSLNNVPDDELPDRLILGDTLGAVGAANVLDVAPAVLVASVVPPLRSHLLLRSVIKLFKL
Ga0193481_107745813300018688MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSGSLHNVPDNELPDRLVLRDTLGAVSAADVLDVTPTVLVASVVPPLRSHLLL
Ga0193294_103582713300018691MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVSDHELTDCLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGH
Ga0193264_105837813300018693MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLLRSVIKLESKAW
Ga0193264_106028413300018693MarineMDSAGHAVVELRIQFGKLVARVDASLRDIPDSSSLHNVPDHKLPDRLVLGDTLGAVGATDILDVAPAVLVTSVVPPLRSHLLL
Ga0193405_104488813300018701MarineVDSAGDAVVELSVQLGQLVAGVDARLGDIPDSSSLNNVPDDELPDRLVLGDTLRAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193274_102900513300018703MarineVNSAGHAVVELSIQLGQLVAGVDTGLRDVPDSGRLHNVPDHELPDRLVLGDALGAVGAADVLDVAPAMLVTSVVPPLRRHLLL
Ga0193539_106686713300018706MarineMDRAGDAVVEFGIQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0192893_108197513300018712MarineVDSAGDAVVELSVQLGQLVAGVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0192893_108636013300018712MarineMDRAGDAVVEFGIQLGQLVAGVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0192887_104478013300018713MarineMDRAGDAVVEFGIQLGQLVAGVDARLRDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0192887_105766713300018713MarineVDSAGDAVVELSVQLGQLVAGVDARLGDIPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193537_109361713300018715MarineMDRAGDAVVEFGIQLGQLVAGVDARLGDVPDSGGLHNVPDHELPDRLVLGDTLGAVSATDVLDMAPAMLVASVVPPLGCHLLL
Ga0192866_107092913300018720MarineVDSAGHAVVELRIQLGKLVARVDASLRDIPDSSSLHNVPDHKLPDRLVLGDTLGAVGATDILDVAPAMLVTSVVPPLRSHLLL
Ga0192866_107294513300018720MarineMDRAGDAVVEFGIQLGQLVAGVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAADILDVAPAVLVPSVVPSLRSHLLL
Ga0192904_106276313300018721MarineVNSAGHAVVELSIQLGQLVASVDAGLRDVPDSGRLHNVPDHKLPDRLVLGDALGAVGAADVLDVAPAVLVTSVVPPLRRHLLLRSVIRNIVEAQTYLT
Ga0193529_108293513300018731MarineVDCAGHAVVELGIQLRQLVAGVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAADILDVAPAVLVASVVPPLGRH
Ga0193534_104557513300018741MarineMDRAGDAVVEFGIELGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPP
Ga0193534_106793013300018741MarineVDGAGHAVVELGIQLRQLVAGVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSTVVATLRGHPLASDFSLVEVNQAIK
Ga0193534_106989213300018741MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPP
Ga0192938_109496413300018751MarineVDSAGHAVVKLGIQLGQLVAGVDASLRDVPDSGRLHNVPDHKLPDRLVLGDALGAVGAADVLDVAPAMLVTSVVPPLGRSSSLVEVNQAIK
Ga0193478_104096713300018769MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSRSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLL
Ga0193478_107461313300018769MarineMNGAGDAVVEFGIQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLRDTLGAVGAADVLDVAPTVLVASVVPPLRSHLLL
Ga0193530_107700123300018770MarineVDGAGHAVVELGIQLRQLVAGVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAADILDVAPAVLVASVVPPLRSHLLL
Ga0193530_109954013300018770MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSGGLHNVPDNELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0192832_105459313300018782MarineVDGARDAVVELGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLR
Ga0193197_105114413300018783MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHL
Ga0193197_107068513300018783MarineMNKHLRVDGAGDAVVELGIELGKLVAGVNAGLRDVPNSSSFHNVPDHKLADGLILGNSLGAVSAAYILDVPPM
Ga0193095_110230613300018785MarineVDGAGDAIVELGVQLGQLVAGVDARLGDVPDGGGLHNVPDHELPDRLVLGDALGAVGAPDVLDVPPAVLVPSMVPPLGSHLLL
Ga0193283_107503223300018798MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLLRSVIKLE
Ga0192824_102770023300018801MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPL
Ga0193281_109938713300018803MarineVDCAGDAVVELGVQLGQLVARVDARLGDVPDSSSLNNVPDDELLDGLILGDALGTVSATHGLHMAPSVLITAVVAALGCHSLVEVNQAILAW
Ga0193238_111876213300018829MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSRGLNDVPDHELTDRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRSHLLLRSVIKLESL
Ga0193120_115146313300018856MarineVDSAGDAVVELSVQLGQLVAGVDARLGDIPDSSSLNNVPDDELPDRLVLGDTLGAVGAAAKLDVAPAVLVASVVPPCT
Ga0193363_111662713300018857MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLQPSSTLVEVNQAIKA
Ga0193072_110958813300018861MarineVDGAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSTVVATLGGHPVASDYSLVEVNQAIK
Ga0193359_109242013300018865MarineVDGAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSPVVATLGGHPVASDFSLVEVNQAIKA
Ga0192859_107193613300018867MarineVDGAGHAVVELGIQLRQLVAGVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSTVVATLRGHPVASDFSLVEVNQAIKA
Ga0193533_112924013300018870MarineMDRAGDAVVEFGIELGQLVASVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193162_111037713300018872MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADILDVAPAVLVASVVPPLRSHLLL
Ga0193027_110290413300018879MarineMDRAGDAVVEFGIQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGATDILDVAPAMLVASVVPPLGCHLLL
Ga0193027_112362513300018879MarineVDSAGDAVVELSVQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVAPVVPPLRSHLLL
Ga0193276_112393713300018883MarineVDCAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSTVVATLRGHPLASDFSLVEVNQAI
Ga0193276_112432113300018883MarineVDSAGDAVVELSVQLGQLVAGVDARLRDVPDSSSLNNVPDDKLPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLGRHLLL
Ga0193268_118140113300018898MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLLRSVIKLCKLG
Ga0193203_1029122713300018901MarineVDSAGDAVVELSIQLGQLIAGVDARLRDVPDGGGLHNVPDHELPDRLVLGDTLGAVGAAHVLDVAPF
Ga0193028_111621313300018905MarineMDRAGDAVVEFGIQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADILDVAPAVLVASVVPPLRSHLLL
Ga0193176_1019582713300018912MarineVDSAGDAVVELSIQLGQLIAGVDARLRDVPDGGGLHNVPDHELPDRLVLGDTLGAVGAANVLDVAPAMLVASVVPPF
Ga0193536_121148413300018921MarineMDRAGDAVVEFGIELGQLVASVDARLGNVPHSGGLHNVPDNELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193536_123458413300018921MarineMDGAGDAVVEFGIQLGQLVASVDARLGNVPHSGGLHNVPDNELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPL
Ga0193536_125489513300018921MarineVDSAGHAVVELSIQLGQLVASVDASLRNVPDCSSFHNVPDHELPDGLVLGDTLGAVSATDVLDVAPAMLVASVVPPLGCHLLL
Ga0193262_1011459913300018923MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSGSLHNVPDNELPDRLVLRDTLGAVGAADVLDVAPTVLVASVVPPLRSHLLL
Ga0193466_115143213300018935MarineVDGARDAVVKLSIQLGQLVAGVDAGLRDVPDSSSLHNVSDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLLRSVIKLA
Ga0193448_114837313300018937MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMV
Ga0192818_1019366013300018940MarineVDSAGDAVVELGVQLGQLVAGVDARLGDVPDGGSLHNVPDHKLPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193265_1022801513300018941MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAMLIAAMVPPLRGHILL
Ga0192892_1026300613300018950MarineVDGARDAVVKLGIQLRQLVAGVDAGLRDVPDSRGLNNVPDHELTDRLILRDGLGAVSAAHILDVAPAVLVAPMVPPLRGHLLLRSVIKLESL
Ga0193567_1006275913300018953MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLNDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLL
Ga0193567_1020880413300018953MarineVDSAGHAVVELRIQLGQLVASVDASLRNVPDCSSFHNVPDHELPDGLVLGDTLGAVSATDVLDVAPAMLVASVVPPLGCHLLL
Ga0193567_1022360913300018953MarineVDCTGDAVVELGIQLGQLVARVDARLRDVPDSSSLNNVPDDKLPDRLVLGDTLGAVGAADVLDVAPAVLVTSVVPPLRRHLLL
Ga0193480_1021511913300018959MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSGSLNNVPDDELPDRLILRDTLGAVGAADVLDVAPTVLVASVVPPLRSHLLLRRVIKLFKL
Ga0193562_1018086413300018965MarineVDSAGHAVVELCIQLGQLVASVDASLRNVPDCSSFHNVPDHELPDGLVLGDTLGAVSATDVLDVAPAMLVASVVPPLGSHLLL
Ga0193562_1018530913300018965MarineVDSAGDAVVELSIQLGQLVARVDAGLRNVPDCSSFHNVPDHELPDGLVLGDTLGAVSATDVLDVAPAMLVASVVPPLGCHLLL
Ga0193562_1018629613300018965MarineVDSAGDAVVELSVQLGQLVAGVDARLRDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLLRSVIKPH
Ga0193178_1007705813300018967MarineVDGARDAVVKLGIQLRQLVAGVDAGLRDVPDSSSLHNVPDHELTDRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHL
Ga0192894_1030038623300018968MarineVDSAGHAVVELGIQLGKLVACVDASLRDIPDSSGLHNVPDHELPDRLILGDALGAVGATDILDVAPAVLVTSMVPPLPM
Ga0193143_1018409413300018969MarineVDGARHAVVKLSIQLGQLVAGVDAGLRDVPDSSSLHNVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPL
Ga0192873_1038515813300018974MarineVDSAGHAVVELRIQLGKLVARVDASLRDIPDSSSLHNVPDHKLPDRLVLGDALGAVGATDILDVAPAVLVAAMVPPLRCHLLL
Ga0193540_1020160413300018979MarineMDRAGDAVVEFGIELGQLVAGVDARLGDVPDSGGLHNVPDDELPDGLVLGDTLGAVGAADVLDVAPAVLVASVVPPLR
Ga0193540_1020160513300018979MarineMDRAGDAVVEFGIQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDGLVLGDTLGAVGAADVLDVAPAVLVASVVPPLR
Ga0193540_1020283923300018979MarineVDGAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAADILDVAPAVLVASVVPPLR
Ga0193540_1021546813300018979MarineVDSAGDAVVELSVQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDGLVLGDTLGAVGAADVLDVAPAVLVASVVPPLR
Ga0192961_1022095713300018980MarineMDGTRHAVVEFGVQLGKLVAGVDAGLGDVPDGSSLHNVPDDELADGLILGAAFGAVSTPDILDVSPSMLVPPVVSPLRSHFLFSCRSESSTH
Ga0193136_1020484613300018985MarineVNSARHAVVELSIQLGQLVAGVDTGLRDVSDSGRLHNVPDYELPDRLVLGDALGAVGAADVLDVAPAVLVTSVVPPLRRHLLLRSVFKLCPC
Ga0193136_1020484813300018985MarineVNSAGHAVVELSIQLGQLVTGVDASLRDVPDSGRLHNVPDHELPDRLVLGDALGAVGAADVLDVAPAVLVTSVVPPLRRHLLLRSVFKLCPC
Ga0193136_1020686113300018985MarineVDGAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAADVLDVAPAVLVTSVVPPLRRHLLLRSVFKLCPC
Ga0193554_1030995313300018986MarineVDGAGHAVVELGIQLRQLVAGVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSPVVATLGGHPLASDFSLVEVNQAPM
Ga0193554_1038475313300018986MarineVDCAGDTVVELGVQLGQLVARVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPL
Ga0193554_1038662613300018986MarineVDSAGDAVVELSVQLGQLVAGVDARLGDIPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLFPC
Ga0193275_1022873013300018988MarineVNSAGHAVVELSIQLGQLVAGVDASLRDVPDSGRLHNVPDHELPDRLVLGDALGAVGAADVLDVAPAVLVTSVVPPLGRHLLL
Ga0193275_1022952913300018988MarineVDGAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAADVLDVAPAVLVTSVVPPLGRHLLL
Ga0193030_1023278813300018989MarineVDSAGDAVVELSVQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0192932_1033094413300018991MarineVDSAGDAVVELSVQLGQLVAGVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLLRSVIKLFKL
Ga0192932_1034088013300018991MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHNVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLLRSVIKLESL
Ga0193518_1031688213300018992MarineVDSAGDAVVELSVQLGQLVAGVDARLGDIPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAMLVASVVPPLGCHLLL
Ga0193518_1031831913300018992MarineVDCAGDTVVELGVQLGQLVARVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAMLVASVVPPLGCHLLL
Ga0193280_1031965913300018994MarineVDCAGDAVVELGVQLGQLVARVDARLGDVPDSSSLNNVPDDELLDGLILGDALGTVSATHGLHMAPSVLITAVVAALGCHSEVISCRSESSNISL
Ga0193430_1016384613300018995MarineVDGAGDAIVELGVQLGQLVAGVDARLGDVPDGGGLHNVPDHELPDRLVLGDTLGAVGAPDVLDVPPAVLVPSMVPPLGSHLLL
Ga0193444_1011293513300018998MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLPRSWLT
Ga0193034_1017859013300019001MarineMDRAGDAVVEFGIELGQLVASVDARLGDVPDSGGLHNVPDNELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193034_1018640913300019001MarineVDGARHAVVKLSIQLGQLVAGVDAGLRDVPDSSCLHNVPDHELADRLILRDGLGAVSAAHILDVAPAMLVSAMVPPL
Ga0193033_1020831713300019003MarineVDGAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSTVVATLGGHPVASDFSLVEVNQAIK
Ga0193033_1023354213300019003MarineMDCTGNTVVEFGVQLGKLVAGVDARLGDVPHSSSFDNVPDHELPDRLVLGDALGAVGAANILDVTSAVLVSTVVATLGGHPVASDFSLVEVNQAIK
Ga0193154_1025312013300019006MarineVDSAGDAVVELSVQLGQLVAGVDARLGDIPDSSSLNNVPDDELPDRLVLGDTLGAVGAADILDVAPAVLVASVVPPLGRHLLL
Ga0193154_1025316013300019006MarineVDCAGDAVVELGVQLGQLVARVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADILDVAPAVLVASVVPPLGRHLLL
Ga0193154_1025539723300019006MarineVDGAGHAVVELGIQLRQLVAGVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSPVVATLGGHPLASDFSLVELNQAPM
Ga0193154_1025971313300019006MarineVDSAGHAVVELSIQLRQLVTSVDASLRNVPDSSSFHNVPDHELPDGLVLGDTLGAVSATDVLDVAPAMLVASVVPPLGCHLLL
Ga0193043_1035055513300019012MarineMDSAGDAVVEFGVELGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVAAVVPPLRSHLLL
Ga0193299_1035043613300019014MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLLR
Ga0193094_1025692313300019016MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHNVSDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLL
Ga0192860_1030703213300019018MarineVDGAGDTVVELGVELGQLVGGVDTRLGDVPHSRGLHDVTDHKLADGLVLGASLGAVGAAHVLHVAAAVLVATIVPPLLGHDGYKVSCRSESSNNSL
Ga0192860_1031009813300019018MarineVDSAGDAVVELSVQLGQLVAGVDARLGDVPDSSSLNNVPDDKLPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0192860_1031174413300019018MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSSSLNNVPDDKLPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193561_1014254613300019023MarineVDSAGDAVVELSIQLGQLVASVDASLRNVPDCSSFHNVPDHELPDGLVLGDTLGAVSATDVLDVAPAMLVASVVPPLGCHLLL
Ga0193561_1034364813300019023MarineVNSAGHAVVELSIQLGQLVAGVDTGLRDVSDSGRLHNVPDYELPDRLVLGDALGAVGAADVLDVAPAVLVTSMVPPLRRHLLLRSVFKLCKLG
Ga0193535_1022962413300019024MarineMDRAGDAVVEFGIELGQLVAGVDARLGDVPDSSGLHNVPDDELTDGLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193535_1022962613300019024MarineMDGAGDAVVEFGIQLGQLVAGVDARLRDVPDSGGLHNVPDDELPDGLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193535_1022963213300019024MarineVDCAGDTVVELGVQLGQLIARVDARLRDVPDSSSLNNVPDDKLPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193565_1026940713300019026MarineVDGTRDAVVKLSIQLGQLVAGVDTGLGDVPDSSSLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLL
Ga0192905_1019278213300019030MarineVDGARDAVVKLGIQLGQLVTGVDAGLRDVPDSRSLNNVPDHELADRLVLRDSLGAVSAAHILDVAPAVLIAAMVPPLRGHLLLRSVIKLESL
Ga0192905_1019635713300019030MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDGGSLHNVPDHKLPDRLVLGDTLGAVGAADVLDVAPAVLVTSVVPPLRRHLLL
Ga0192886_1021376513300019037MarineVDSAGDAVVELSIQLGQLVAGVDARLGDVPDSSSLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLQRSSTV
Ga0192886_1027569613300019037MarineVNSAGHAVVELSIQLGQLVAGVDTGLRDVSDSGRLHNVPDHELPDRLVLGDALGAVGTANILDVTSAVLVSTVVATLGGPM
Ga0193558_1008922813300019038MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSRGLHDVPDHELADRLILRDGLGAVSAAHILDVAPAVLVAAMVPPLRGHLLL
Ga0192857_1029503813300019040MarineVDGAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLRDALGAVGAADILDVAPAVLVASVVPPLGRHLLSH
Ga0192857_1037026613300019040MarineVDGAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLRDALGAVGAADILDVAPH
Ga0193356_1026371213300019053MarineVDCAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAANILDVTSAVLVSPVVATLRGHPVASDFSLVEVNQAIKASH
Ga0193356_1031162813300019053MarineVDSAGDAVVELSIQLGQLVAGVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSP
Ga0193356_1033646913300019053MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSP
Ga0193459_10406113300019067MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPDSSSLHDVSDHELTDCLILRDGLGAVSAAHILDVAPAVLVAAMVP
Ga0193541_106472613300019111MarineMDRAGDAVVEFGIELGQLVAGVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193541_106472913300019111MarineVDCAGDAVVELGVQLGQLVARVDARLGDVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0193541_109113813300019111MarineVDSAGDAVVELRIQLGQLVASVDASLRNVPDCSSFHNVPDHELPDGLVLGDTLGAVSATDVLDVAPAMPM
Ga0193436_106790723300019129MarineVDGARDAVVKLGIQLGQLVAGVDAGLRDVPHSRSLHDIPDHELADRLILRDGLGAVTAAHILDVAPAVLVAAMVPPLRG
Ga0193239_1031988013300019148MarineVDSTGHTVVQLSIQLGQLVACVDTGLRDVPDGGSLHDVPDDELADGLVLGTGFGAVGTPDVLHVPTPVLVTPNCSSFSGSF
Ga0063132_10047713300021872MarineVDSAGDAVVELSVQLGQLVAGVDARLGNVPDSSSLNNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0063142_100318613300021893MarineMDRAGDAVVEFGIELGQLVAGVDARLGDVPDSGGLHNVPDNELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0063131_102266713300021904MarineVDGAGHAVVELGIQLRQLVASVDARLGDVPDGGSFNNIPDHELPDRLVLGDALGAVGAADILDVAPAVLVASVVPPLGRHLLL
Ga0063133_100506513300021912MarineMDRAGDAVVEFGIELGQLVASVDARLGDVPDSGGLHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLL
Ga0063138_101858113300021935MarineMDRAGDAVVEFGIELGQLVASVDARLGDIPDSGGLHNVPDNELPDRLVLGDTLGAVGAADILDVAPAVLVASVVPPLRSHLLL
Ga0063138_103936113300021935MarineMDGAGDAVVEFGIQLGQLVAGVDARLGDVPDSGGLHNVPDDELPDGLILGDTLGAVGAADVLDVAPAVLVASVVPPLRSHLLL
Ga0307384_1054691313300031738MarineVDSAGHAVVELRIQLGQLVAGVDASLRDVPDSGRLDNVPDHELPDRLVLGDALGAVGAADILDMAPAVLVPSVVPPLGRHLLL
Ga0307382_1050237413300031743MarineMDSAGDAVVEFGVELGQLIAGVDARLGDVPDSGGFHNVPDDELPDRLVLGDTLGAVGAADVLDVAPAVLVAAVVPPLRSHLLL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.