NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043606

Metagenome / Metatranscriptome Family F043606

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043606
Family Type Metagenome / Metatranscriptome
Number of Sequences 156
Average Sequence Length 45 residues
Representative Sequence DLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR
Number of Associated Samples 140
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.28 %
% of genes near scaffold ends (potentially truncated) 96.79 %
% of genes from short scaffolds (< 2000 bps) 91.03 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.718 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.590 % of family members)
Environment Ontology (ENVO) Unclassified
(34.615 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.154 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 75.00%    β-sheet: 0.00%    Coil/Unstructured: 25.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF03576Peptidase_S58 35.26
PF13177DNA_pol3_delta2 2.56
PF07617DUF1579 1.28
PF05960DUF885 0.64
PF12169DNA_pol3_gamma3 0.64
PF02403Seryl_tRNA_N 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG3191L-aminopeptidase/D-esteraseAmino acid transport and metabolism [E] 70.51
COG0172Seryl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.64
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.64

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.72 %
UnclassifiedrootN/A1.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886012|MBSR1b_contig_3176604All Organisms → cellular organisms → Bacteria803Open in IMG/M
2170459005|F1BAP7Q02IBSU6All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium522Open in IMG/M
3300000579|AP72_2010_repI_A01DRAFT_1019653All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300000891|JGI10214J12806_11380776All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300004479|Ga0062595_100851181All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300005159|Ga0066808_1037565All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005175|Ga0066673_10011540All Organisms → cellular organisms → Bacteria3807Open in IMG/M
3300005186|Ga0066676_10558612All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300005289|Ga0065704_10311654All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300005294|Ga0065705_10024713All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300005295|Ga0065707_11013748All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005328|Ga0070676_10606582All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300005332|Ga0066388_100016298All Organisms → cellular organisms → Bacteria6209Open in IMG/M
3300005337|Ga0070682_100054681All Organisms → cellular organisms → Bacteria2506Open in IMG/M
3300005440|Ga0070705_100286617All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300005467|Ga0070706_101031361All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005536|Ga0070697_102137405All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005539|Ga0068853_101630762All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300005552|Ga0066701_10704280All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005554|Ga0066661_10551237All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300005564|Ga0070664_100410941All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300005569|Ga0066705_10113439All Organisms → cellular organisms → Bacteria1627Open in IMG/M
3300005576|Ga0066708_11011764All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005577|Ga0068857_101300117All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300005587|Ga0066654_10719527All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005598|Ga0066706_10944308All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300005764|Ga0066903_103273160All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300005764|Ga0066903_106624909All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005937|Ga0081455_10781419All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005937|Ga0081455_10783546All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300006169|Ga0082029_1162099All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300009101|Ga0105247_10768710All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300009177|Ga0105248_13336390All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300010043|Ga0126380_11153517All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300010046|Ga0126384_10448224All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300010046|Ga0126384_10808443All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300010046|Ga0126384_10934123All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300010320|Ga0134109_10047787All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300010325|Ga0134064_10264777All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300010326|Ga0134065_10039483Not Available1418Open in IMG/M
3300010326|Ga0134065_10411790All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010360|Ga0126372_12049756All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300010364|Ga0134066_10237474All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300010366|Ga0126379_13377244All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300010397|Ga0134124_10416665All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300010397|Ga0134124_12615086All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300010401|Ga0134121_12829336All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300011000|Ga0138513_100059620All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012096|Ga0137389_11691465All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300012201|Ga0137365_10040035All Organisms → cellular organisms → Bacteria3579Open in IMG/M
3300012202|Ga0137363_10398486All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300012202|Ga0137363_11339666All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300012207|Ga0137381_10974328All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300012208|Ga0137376_10620523All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300012211|Ga0137377_11329314All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300012212|Ga0150985_117313590All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300012285|Ga0137370_10414162All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300012350|Ga0137372_10124472All Organisms → cellular organisms → Bacteria2133Open in IMG/M
3300012350|Ga0137372_10147167All Organisms → cellular organisms → Bacteria1927Open in IMG/M
3300012359|Ga0137385_11241733All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300012360|Ga0137375_10614067All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300012361|Ga0137360_10858120All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300012363|Ga0137390_11836484All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012519|Ga0157352_1095581All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300012532|Ga0137373_10481740All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300012685|Ga0137397_10705663All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300012882|Ga0157304_1110148All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300012923|Ga0137359_10060662All Organisms → cellular organisms → Bacteria3297Open in IMG/M
3300012927|Ga0137416_11085828All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300012930|Ga0137407_10696196All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300012930|Ga0137407_11478293All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300012948|Ga0126375_11786851All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012960|Ga0164301_10541400All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300012960|Ga0164301_11375236All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300012961|Ga0164302_11874314All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300012971|Ga0126369_10862422All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300012971|Ga0126369_10973675All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300012977|Ga0134087_10373317All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300012986|Ga0164304_10688203All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300012988|Ga0164306_10518025All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300013296|Ga0157374_10640343All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300013306|Ga0163162_11704565All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300014326|Ga0157380_12745945All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300015051|Ga0137414_1018321All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300015054|Ga0137420_1227745All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300015357|Ga0134072_10287838All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300015358|Ga0134089_10190227All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300015371|Ga0132258_10987838All Organisms → cellular organisms → Bacteria2127Open in IMG/M
3300015372|Ga0132256_101728455All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300015374|Ga0132255_100683668All Organisms → cellular organisms → Bacteria1523Open in IMG/M
3300016357|Ga0182032_11072457All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300016371|Ga0182034_10801009All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300016422|Ga0182039_12235446All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300018072|Ga0184635_10237595All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300018433|Ga0066667_11878030All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300019361|Ga0173482_10743487All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300019870|Ga0193746_1025928All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300019875|Ga0193701_1047137All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300019879|Ga0193723_1041232All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300019887|Ga0193729_1046756All Organisms → cellular organisms → Bacteria1770Open in IMG/M
3300019890|Ga0193728_1255530All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300020000|Ga0193692_1071011All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300020004|Ga0193755_1102869All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300020012|Ga0193732_1002111All Organisms → cellular organisms → Bacteria3586Open in IMG/M
3300021073|Ga0210378_10350886All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300021344|Ga0193719_10002854All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae6967Open in IMG/M
3300021344|Ga0193719_10279439All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300021510|Ga0222621_1053784All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300021560|Ga0126371_12263672All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300022534|Ga0224452_1175084All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300022694|Ga0222623_10018086All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2619Open in IMG/M
3300022883|Ga0247786_1129403All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300025905|Ga0207685_10755142All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300025907|Ga0207645_10401763All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300025910|Ga0207684_11115344All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300025915|Ga0207693_10231267All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300025930|Ga0207701_10975097All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300025935|Ga0207709_10916056All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300025960|Ga0207651_10847949All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300026067|Ga0207678_11788112All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300026305|Ga0209688_1029371All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300026314|Ga0209268_1142406All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium590Open in IMG/M
3300026317|Ga0209154_1008958All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4953Open in IMG/M
3300026323|Ga0209472_1238885All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300026324|Ga0209470_1001797All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia15533Open in IMG/M
3300026324|Ga0209470_1223594All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300026330|Ga0209473_1308935All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300026334|Ga0209377_1045623All Organisms → cellular organisms → Bacteria1989Open in IMG/M
3300026343|Ga0209159_1279536All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300026530|Ga0209807_1052684All Organisms → cellular organisms → Bacteria1871Open in IMG/M
3300026537|Ga0209157_1325145All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300026555|Ga0179593_1234478Not Available6506Open in IMG/M
3300026785|Ga0207496_105510All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300027018|Ga0208475_1010493All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300027502|Ga0209622_1029132All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300028711|Ga0307293_10160785All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300028768|Ga0307280_10342325All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300028787|Ga0307323_10121549All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300028791|Ga0307290_10235552All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300028807|Ga0307305_10422676All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300028814|Ga0307302_10648372All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300028828|Ga0307312_10785031All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300028885|Ga0307304_10359220All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300031093|Ga0308197_10297261All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300031128|Ga0170823_13784960All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300031231|Ga0170824_105413546All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300031231|Ga0170824_121515052All Organisms → cellular organisms → Bacteria1588Open in IMG/M
3300031231|Ga0170824_123921410All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300031446|Ga0170820_12985173All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300031720|Ga0307469_12287881All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300031942|Ga0310916_10970295All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300031996|Ga0308176_11326281All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300032013|Ga0310906_11329359All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300033412|Ga0310810_10030127All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus6602Open in IMG/M
3300033412|Ga0310810_10953842All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300033475|Ga0310811_11489870All Organisms → cellular organisms → Bacteria505Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.59%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.18%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.41%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.13%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.28%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.28%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.28%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.28%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.28%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.64%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.64%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.64%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.64%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.64%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.64%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000579Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01EnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005159Soil and rhizosphere microbial communities from Laval, Canada - mgLPBEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019870Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026785Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027018Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MBSR1b_0217.000037202162886012Miscanthus RhizosphereRRPVLVDLKAQFDADAAHLKSKASHGKITPALASEMKKDVNKTYDHALGR
E41_048042202170459005Grass SoilGPVLVNLKGQFDADAAHLQSKASRGKITPALATEMKNDINKTYDHALGR
AP72_2010_repI_A01DRAFT_101965313300000579Forest SoilPVLVNLKGQFDADAAHLRSKASRSKITPALATEMKNDINKTYDHALGR*
JGI10214J12806_1138077613300000891SoilFTARRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR*
Ga0062595_10085118113300004479SoilVDLKAQFDADAAHIKSKASHGKITPALASEMKKDVNKVYDHALGR*
Ga0066808_103756513300005159SoilGQFDADAAHLQSKASRGKITPALATEMKSDVNKTYDHALGR*
Ga0066673_1001154013300005175SoilKAQFDADAAHLRSKASHGKVTSALASEMKKDINKIYDHALGR*
Ga0066676_1055861213300005186SoilIDLKAQFDADAAHLRSKASHGKVTSALASEMKKDINKIYDHALGR*
Ga0065704_1031165413300005289Switchgrass RhizosphereVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR*
Ga0065705_1002471313300005294Switchgrass RhizospherePVLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR*
Ga0065707_1101374813300005295Switchgrass RhizosphereRRPVLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR*
Ga0070676_1060658213300005328Miscanthus RhizosphereDKFTARRPVFVDLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR*
Ga0066388_10001629813300005332Tropical Forest SoilEKFTARRPVLVNLKGQFDADAAHLRSKSSRGKITPALATEMKNDINKTYDHALGR*
Ga0070682_10005468143300005337Corn RhizosphereRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR*
Ga0070705_10028661713300005440Corn, Switchgrass And Miscanthus RhizosphereARRPVFVDLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR*
Ga0070706_10103136113300005467Corn, Switchgrass And Miscanthus RhizosphereFDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR*
Ga0070697_10213740523300005536Corn, Switchgrass And Miscanthus RhizosphereIDLKAQFDADATHLRSKASRGKVTPALAAEMKKDVNKIYDHALGR*
Ga0068853_10163076223300005539Corn RhizosphereARRPVLVDLKAQFDADAAHLKSKASHGKITPALASEMKKDVNKTYDHALGR*
Ga0066701_1070428023300005552SoilDADAAHLRSKASHGKVTPALASEMKKDINKIYDHALGR*
Ga0066661_1055123713300005554SoilFTARRPVLIDLKAQFDADATHLRSKASRGKITPALASEMKKDVNKIYDHALGR*
Ga0070664_10041094133300005564Corn RhizospherePVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR*
Ga0066705_1011343933300005569SoilKFTARRPVFVDLKAQFDADAAHIKSKATRGKITPALASEMKKDVNKIYDHALGR*
Ga0066708_1101176423300005576SoilPVFVDLKAQFDADAAHIKSKATRGKISPALASEMKKDVNKIYDHALGR*
Ga0068857_10130011733300005577Corn RhizosphereRPVFVDLKAQFDADAAHLKSKATRGKITPALASEMKKDVNKIYDHALGR*
Ga0066654_1071952713300005587SoilVLIDLKAQFDADAAHLRSKASRGKITPALANEMKKDVNKVYNHALGR*
Ga0066706_1094430823300005598SoilKAQFDADAAHLRSKASHGKVTPALATEMKKDVNKIYDHALGR*
Ga0066903_10327316033300005764Tropical Forest SoilVFVDLKAQFDADAAHIKSKASRGKITPALASEMKKDVNKTYDHALGR*
Ga0066903_10662490923300005764Tropical Forest SoilDEKFTARRPVLVDLKAQFDADAAHLKSKASHGKITPALASEMKKDVNKIYNHALGQ*
Ga0081455_1078141913300005937Tabebuia Heterophylla RhizosphereDLKAQFDADAAHIKSKATRGKITPVLASEMKKDVNKTYDHALGR*
Ga0081455_1078354613300005937Tabebuia Heterophylla RhizosphereDADAAHIKSKASRGKVTPALASEMKKDVNKIYDHALGR*
Ga0082029_116209923300006169Termite NestVNLKGQFDADAAHLRSKASRGKITPALATEMKNDINKTYDHALGR*
Ga0105247_1076871013300009101Switchgrass RhizosphereDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR*
Ga0105248_1333639023300009177Switchgrass RhizosphereDAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR*
Ga0126380_1115351713300010043Tropical Forest SoilMTGCDLMGQFDEDATHLRSKASQGKITPALLVEMKKDVNTMYDHALGR*
Ga0126384_1044822413300010046Tropical Forest SoilKGQFDADAAHLRRKASQGKVTPALASEMKKDVNKIYDHALGR*
Ga0126384_1080844313300010046Tropical Forest SoilQFKADAAHLQSKASRGKVTPALAIEMKKDINKIYHHALGR*
Ga0126384_1093412313300010046Tropical Forest SoilTARRPVLVDLKGQFDADATHLRSKASRGKVTPALASEMKKDVNKIYDHALGR*
Ga0134109_1004778713300010320Grasslands SoilVLVDLKGQFDADAAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR*
Ga0134064_1026477723300010325Grasslands SoilAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR*
Ga0134065_1003948323300010326Grasslands SoilNLKGQFDADAAHLRSKASRGKITPALGTEMKNDINKT*
Ga0134065_1041179013300010326Grasslands SoilTARRPVLVDLKGQFDADAAHLRSKASRGKITPALPAEMKKDVNKIYDHALGRQT*
Ga0126372_1204975613300010360Tropical Forest SoilDLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR*
Ga0134066_1023747413300010364Grasslands SoilDLKAQFDADAAHLRSKASRGKITPALANEMKKDVNKVYNHALGR*
Ga0126379_1337724413300010366Tropical Forest SoilAHIKSKASRGKITPALASEMKKDVNKAYDHALGR*
Ga0134124_1041666513300010397Terrestrial SoilARRPVLVDLKAQFDADAAHLKSKASKGKVTPALASEMKKDVNKTYDHALGR*
Ga0134124_1261508613300010397Terrestrial SoilFDADAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR*
Ga0134121_1282933623300010401Terrestrial SoilFDADATHLRSKASRGKVTPGLATEMKKDVNKIYDHALGR*
Ga0138513_10005962013300011000SoilLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR*
Ga0137389_1169146513300012096Vadose Zone SoilQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR*
Ga0137365_1004003513300012201Vadose Zone SoilDAAHLKSKASRGKITPALATEMKNDINKTYDHALGR*
Ga0137363_1039848623300012202Vadose Zone SoilLLRVCLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR*
Ga0137363_1133966623300012202Vadose Zone SoilDADAAHLRSKASRGKITPALATEMKKDVNKIYDHALGR*
Ga0137381_1097432833300012207Vadose Zone SoilDAAHLRSKASRGKVTPELATEMKKDVNKIYDHALGR*
Ga0137376_1062052333300012208Vadose Zone SoilDEKFTARRPVLVNLKGQFDADAAHLRSKASRGKITPALATEMKNDINKTYDHALGR*
Ga0137377_1132931413300012211Vadose Zone SoilRRPVLIDLKAQFDADAAHIRSKASRGKITPALATEMKKDVNKIYDHALGR*
Ga0150985_11731359023300012212Avena Fatua RhizosphereARRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR*
Ga0137370_1041416233300012285Vadose Zone SoilLKAQFDADAAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR*
Ga0137372_1012447243300012350Vadose Zone SoilRPVLVDLKAQFDADAAHLRSKASRGKITPALPAEMKKDVNKIYDHALGR*
Ga0137372_1014716713300012350Vadose Zone SoilAQFKADAAHLRSKASRGKVTPALASEMKKDTNKIYDHALGR*
Ga0137385_1124173313300012359Vadose Zone SoilDAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR*
Ga0137375_1061406713300012360Vadose Zone SoilEKFTARRPVLVDLKGQFDADAAHLRSKASRGKITPALATEMKNDINKTYDHALGR*
Ga0137360_1085812013300012361Vadose Zone SoilDADAAHLRSKASRGKVTPALPSEMKKDVNKIYDHALAR*
Ga0137390_1183648423300012363Vadose Zone SoilDADAAHLKSKASHGKITPALASEMKKDVNKIYDHALGR*
Ga0157352_109558123300012519Unplanted SoilRRPVLVDLKAQFDADAAHLKSKASRGKITPALASEMKNDVNKTYDHALGR*
Ga0137373_1048174013300012532Vadose Zone SoilIADEKFTARRPVLVDLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR*
Ga0137397_1070566333300012685Vadose Zone SoilFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR*
Ga0157304_111014823300012882SoilVDLKAQFDADAAHLRSKASGGKITPALASEMKKDVNKIYDHALGR*
Ga0137359_1006066213300012923Vadose Zone SoilATHLRSKATRGKITPALATEMKKDVNKIYDHALGRQT*
Ga0137416_1108582833300012927Vadose Zone SoilPVLIDLKAQFDADAAHLRSKASRGKITPALATEMKKDVNKIYDHALGR*
Ga0137407_1069619613300012930Vadose Zone SoilTARRPVLIDLKSQFDADAAHLRSKASRGKITPALATEMKKDVHKIYDHALGR*
Ga0137407_1147829313300012930Vadose Zone SoilALADEKFTARRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR*
Ga0126375_1178685123300012948Tropical Forest SoilDAAHIKSKASHGKITPALASEMKKDVNKIYNHALGR*
Ga0164301_1054140033300012960SoilDAAHLKSKASHGKVTPALASEMKKDVNKIYDHALRR*
Ga0164301_1137523613300012960SoilARRPVLVDLKAQFDADAAHLKSKASKGKVTPALASEMKKDVNKIYDHALGR*
Ga0164302_1187431413300012961SoilADAAHLKSKASKGKVTPALASEMKKDVNKIYDHALGR*
Ga0126369_1086242213300012971Tropical Forest SoilFDADAAHLKSKASRGKVTPALASEMKKDVNKIYDHALGR*
Ga0126369_1097367533300012971Tropical Forest SoilDADATHLRSKASRGKVTPALASEMKKDVNKIYDHALGR*
Ga0134087_1037331713300012977Grasslands SoilIDLKAQFDADAAHLRSKASHGKVTPALATEMKKDVNKIYDHALGR*
Ga0164304_1068820333300012986SoilDLKAQFDADAAHLKSKASKGKVTPALASEMKKDVNKIYDHALGR*
Ga0164306_1051802513300012988SoilDADAAHLKSKASKGKVTPALATEMKKDVNKIYDHALGR*
Ga0157374_1064034313300013296Miscanthus RhizosphereADATHLRSKASRGKVTPALASEMKKDVNKVYDHALGR*
Ga0163162_1170456533300013306Switchgrass RhizosphereLIDLKGQFDADATHLRSKASRGKVTPALASEMKKDVNKVYDHALGR*
Ga0157380_1274594533300014326Switchgrass RhizosphereDAAHLQSKASRGKITPALATEMKNDVNKTYDHALGR*
Ga0137414_101832143300015051Vadose Zone SoilAIADEKFTARRPVLVDLKAQFDADVAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR*
Ga0137420_122774523300015054Vadose Zone SoilLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR*
Ga0134072_1028783813300015357Grasslands SoilAAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR*
Ga0134089_1019022713300015358Grasslands SoilVLIDLKAQFDADAAHIRSKASRGKITPALATEMKKDVNKIYDHALGR*
Ga0132258_1098783813300015371Arabidopsis RhizosphereEKFTARRPVLVNLKGQFDADAAHLQSKASRGKITPALATEMKNDVNKTYDHALGR*
Ga0132256_10172845513300015372Arabidopsis RhizosphereAHLKSKASRGKVTPALASEMKKDVNKIYDHALGR*
Ga0132255_10068366813300015374Arabidopsis RhizosphereTARRPVFVDLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR*
Ga0182032_1107245733300016357SoilVNLKGQFDADAAHLRSKASRGKITPALATEMKNDINKTYDHALGR
Ga0182034_1080100913300016371SoilGQFDADAAHLRSKASRGKITPALATEMKNDINKTYDHALGR
Ga0182039_1223544623300016422SoilPVFVDLKAQFDADAAHIKSKASRGEVTPALASEMKKDVNKIYDHALGR
Ga0184635_1023759513300018072Groundwater SedimentPVLVDLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKTYDHALGR
Ga0066667_1187803023300018433Grasslands SoilVLIDLKAQFDADAAHLRSKASRGKITPALANEMKKDVNKVYDHALGR
Ga0173482_1074348723300019361SoilVDLKAQFDADAAHLRSKASGGKITPALASEMKKDVNKIYDHALGR
Ga0193746_102592823300019870SoilKFTARRPVLVNLKGQFDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR
Ga0193701_104713733300019875SoilFTARRPVLVDLKGQFDADAAHLRSKASRGKVTPALASEMKKDVNKVYDHALGR
Ga0193723_104123233300019879SoilTARRPVLVDLKSQFDADATHLRSKASRGKVTPALAAEMKKDVNKIYDHALGQQT
Ga0193729_104675613300019887SoilRRPVLIDLKAQFDADATHLRSKAGRGKVTPALAAEMKKDVNKIYDHALGRQT
Ga0193728_125553033300019890SoilVDLKGQFDADATHLRSKASRGKVTPGLATEMKKDLNKIYDHALGR
Ga0193692_107101113300020000SoilDAAHLKSKASHGKVTPALASHMKKDVNKIYDHALGR
Ga0193755_110286933300020004SoilDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR
Ga0193732_100211113300020012SoilDAGATHLRSKASRGKVTPALASEMKKDVNKVYDHALGR
Ga0210378_1035088623300021073Groundwater SedimentLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR
Ga0193719_1000285413300021344SoilKGQFDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR
Ga0193719_1027943913300021344SoilQFDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR
Ga0222621_105378433300021510Groundwater SedimentDEKFTARRPVLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR
Ga0126371_1226367223300021560Tropical Forest SoilAAHLKSKAGRGKVTPAPASEMKKDVNKIYDHALGR
Ga0224452_117508433300022534Groundwater SedimentADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR
Ga0222623_1001808613300022694Groundwater SedimentNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR
Ga0247786_112940323300022883SoilDADAAHLKSKASKGKVTPALASEMKKDVNKIYDHALGR
Ga0207685_1075514223300025905Corn, Switchgrass And Miscanthus RhizosphereQFDADAAHIKSKASRGKITPALATDMKKDINKTYDHALGR
Ga0207645_1040176333300025907Miscanthus RhizosphereDKFTARRPVFVDLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR
Ga0207684_1111534413300025910Corn, Switchgrass And Miscanthus RhizospherePVLVDLKGQFDADAAHLRSKASRGKVTPALATEMKKDVNKIYDHALGR
Ga0207693_1023126713300025915Corn, Switchgrass And Miscanthus RhizosphereEKFTARRPVLVNLKGQFDADAAHLQSKASRGKITPALATEMKNDVNKTYDHALGR
Ga0207701_1097509733300025930Corn, Switchgrass And Miscanthus RhizosphereVFVDLKAQFDADAAHLKSKATRGKVTPALASEMKKDVNKIYDHALGR
Ga0207709_1091605613300025935Miscanthus RhizosphereLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR
Ga0207651_1084794933300025960Switchgrass RhizosphereDLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR
Ga0207678_1178811223300026067Corn RhizosphereAAHLQSKASRGKITPALATEMKNDVNKTYDHALGR
Ga0209688_102937123300026305SoilVLVDLKGQFDADAAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR
Ga0209268_114240613300026314SoilEKFTARRPVLGNLKGQFDADAAHLRSKASRGKITPALGTEMKNDINKTYDHALGR
Ga0209154_100895873300026317SoilTARRPVLIDLKAQFDADAAHIRSKASRAKITPALATEMKKDVNKIYDHALGR
Ga0209472_123888523300026323SoilFTARRPVLIDLKAQFDADAAHLRSKGSHGKVTSALASEMKKDVNKIYDHALGR
Ga0209470_1001797193300026324SoilQFDADAAHLRSKASRGKITPALATEMKKDVNKIYDHALGRQT
Ga0209470_122359433300026324SoilIDLKAQFDADAAHLRSKASHGKVTSALASEMKKDINKIYDHALGR
Ga0209473_130893523300026330SoilARRPVLIDLKAQFDADAAHLRSKASHGKVTPALATEMKKDVNKIYDHALGR
Ga0209377_104562313300026334SoilTARRPVLIDLKAQFDADAAHLRSKASRGKITPALATEMKKDVNKIYDHALGR
Ga0209159_127953613300026343SoilDLKAQFDADAAHIRSKASRGKITPALATEMKKDVNKIYDHALGR
Ga0209807_105268413300026530SoilVDLKGQFDADAAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR
Ga0209157_132514513300026537SoilVLVDLKGQFDADAAHLRSKATRGKVTPALASEMKKDVNKIYDHALGR
Ga0179593_123447823300026555Vadose Zone SoilMRKFTARRPVLVDLKGQFDADATHLRSKASRGKVTPGLATEMKKDVNKIYDHALGR
Ga0207496_10551013300026785SoilIVNLKGQFDADAAHLQIKASRGKITPALATEMKNDVNKTYDHALGR
Ga0208475_101049313300027018SoilGQFDADAAHLRSKASRGKVTSALASEMKKDTNKIYDHALGR
Ga0209622_102913213300027502Forest SoilRPVLVDLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKTYDHALGR
Ga0307293_1016078533300028711SoilKFTARRPVLVDLKGQFDADATHLRSKASRGKVTPALASEMKKDVNKVYDHALGR
Ga0307280_1034232513300028768SoilPVLVDLKTQFDADAAHLKSKASHGKITPALASEMKKDVNKIYDHALGR
Ga0307323_1012154913300028787SoilVLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR
Ga0307290_1023555233300028791SoilADAAHLRSKASRGKVTPALASEMKKDTNKIYDHALGR
Ga0307305_1042267633300028807SoilDADATHLRSKASRGKVTPALAGEMKKDVNKVYDHALGR
Ga0307302_1064837223300028814SoilPVLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR
Ga0307312_1078503113300028828SoilKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR
Ga0307304_1035922033300028885SoilEEKFTARRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR
Ga0308197_1029726123300031093SoilGQFDADAAHLQSKASRGKITPALATEMKNDVNKTYDHALGR
Ga0170823_1378496013300031128Forest SoilIDLKGQFDSDAAHLRSKASRGKVTPALANEMKKDVNKIYDHALCR
Ga0170824_10541354633300031231Forest SoilDADAAHLKSKASHGKITPALASEMKKDVNKIYDHALGR
Ga0170824_12151505223300031231Forest SoilVINHLAAQFKADTAHLRSKAGRGKVTPALASEMKKDINKIYDHASGR
Ga0170824_12392141013300031231Forest SoilPVLIDLKQKFDNDATHLRSKASQGKVTPALAAEMKKSVNKIYDHALGRQT
Ga0170820_1298517313300031446Forest SoilPVLIDLKAQFDADATHLRSKASRGKVTPALASEMKKDVNKIYDHALGR
Ga0307469_1228788113300031720Hardwood Forest SoilQFDADAAHLQSKASRGKITPALATEMKNDINKTYDHALGR
Ga0310916_1097029523300031942SoilLKGQFDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR
Ga0308176_1132628133300031996SoilDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR
Ga0310906_1132935923300032013SoilDADAAHLKSKASHGKITPALASEMKKDVNKTYDHALGR
Ga0310810_1003012713300033412SoilVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR
Ga0310810_1095384213300033412SoilRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR
Ga0310811_1148987023300033475SoilEKFTARRPVVVDLKAQFDADAAHLKSKASHGKITPALASEMKKDVNKIYDHAIGR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.