Basic Information | |
---|---|
Family ID | F044224 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 155 |
Average Sequence Length | 42 residues |
Representative Sequence | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERIIIKHSI |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 155 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 1.29 % |
% of genes near scaffold ends (potentially truncated) | 24.52 % |
% of genes from short scaffolds (< 2000 bps) | 72.26 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | unclassified viruses (50.968 % of family members) |
NCBI Taxonomy ID | 12429 |
Taxonomy | All Organisms → Viruses → unclassified viruses |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (27.742 % of family members) |
Environment Ontology (ENVO) | Unclassified (72.903 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.032 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 155 Family Scaffolds |
---|---|---|
PF00118 | Cpn60_TCP1 | 1.94 |
PF01068 | DNA_ligase_A_M | 1.94 |
PF13385 | Laminin_G_3 | 1.29 |
PF00085 | Thioredoxin | 1.29 |
PF13662 | Toprim_4 | 0.65 |
PF00268 | Ribonuc_red_sm | 0.65 |
PF13442 | Cytochrome_CBB3 | 0.65 |
PF00166 | Cpn10 | 0.65 |
PF02867 | Ribonuc_red_lgC | 0.65 |
PF00521 | DNA_topoisoIV | 0.65 |
PF08299 | Bac_DnaA_C | 0.65 |
COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
---|---|---|---|
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 1.94 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.94 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.94 |
COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.65 |
COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.65 |
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.65 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.65 % |
Unclassified | root | N/A | 39.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2006543006|2006918145 | Not Available | 790 | Open in IMG/M |
2189573027|GS312G0146KB_1113984328965 | Not Available | 896 | Open in IMG/M |
3300000128|SA_S1_NOR08_45mDRAFT_c10025040 | All Organisms → Viruses → Predicted Viral | 2493 | Open in IMG/M |
3300001450|JGI24006J15134_10015241 | Not Available | 3653 | Open in IMG/M |
3300002483|JGI25132J35274_1053216 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 871 | Open in IMG/M |
3300003409|JGI26088J50261_1006423 | Not Available | 4797 | Open in IMG/M |
3300004279|Ga0066605_10024140 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2982 | Open in IMG/M |
3300004461|Ga0066223_1068092 | Not Available | 2645 | Open in IMG/M |
3300005432|Ga0066845_10038871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1736 | Open in IMG/M |
3300005747|Ga0076924_1049729 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 866 | Open in IMG/M |
3300005837|Ga0078893_10636791 | Not Available | 832 | Open in IMG/M |
3300006305|Ga0068468_1040828 | Not Available | 2565 | Open in IMG/M |
3300006735|Ga0098038_1008624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 4052 | Open in IMG/M |
3300006735|Ga0098038_1099870 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1002 | Open in IMG/M |
3300006735|Ga0098038_1108042 | Not Available | 955 | Open in IMG/M |
3300006735|Ga0098038_1111153 | Not Available | 938 | Open in IMG/M |
3300006735|Ga0098038_1188130 | Not Available | 673 | Open in IMG/M |
3300006737|Ga0098037_1278468 | Not Available | 531 | Open in IMG/M |
3300006749|Ga0098042_1045557 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1203 | Open in IMG/M |
3300006749|Ga0098042_1057246 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1044 | Open in IMG/M |
3300006749|Ga0098042_1059259 | Not Available | 1022 | Open in IMG/M |
3300006752|Ga0098048_1106029 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 848 | Open in IMG/M |
3300006752|Ga0098048_1116956 | Not Available | 801 | Open in IMG/M |
3300006793|Ga0098055_1091352 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1193 | Open in IMG/M |
3300006802|Ga0070749_10345201 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 828 | Open in IMG/M |
3300006922|Ga0098045_1039633 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1191 | Open in IMG/M |
3300006922|Ga0098045_1080355 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 780 | Open in IMG/M |
3300006922|Ga0098045_1151705 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 533 | Open in IMG/M |
3300006924|Ga0098051_1073557 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 927 | Open in IMG/M |
3300007539|Ga0099849_1053287 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1679 | Open in IMG/M |
3300007540|Ga0099847_1063061 | Not Available | 1154 | Open in IMG/M |
3300007623|Ga0102948_1272235 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 517 | Open in IMG/M |
3300007778|Ga0102954_1097337 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 826 | Open in IMG/M |
3300007863|Ga0105744_1004946 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3569 | Open in IMG/M |
3300007960|Ga0099850_1165421 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 884 | Open in IMG/M |
3300009001|Ga0102963_1152864 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 930 | Open in IMG/M |
3300009593|Ga0115011_10110154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1956 | Open in IMG/M |
3300009593|Ga0115011_11175196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 660 | Open in IMG/M |
3300009705|Ga0115000_10232756 | Not Available | 1207 | Open in IMG/M |
3300009785|Ga0115001_10167977 | Not Available | 1427 | Open in IMG/M |
3300009790|Ga0115012_10138703 | Not Available | 1741 | Open in IMG/M |
3300010148|Ga0098043_1049139 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1293 | Open in IMG/M |
3300010148|Ga0098043_1054281 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
3300010297|Ga0129345_1220551 | Not Available | 668 | Open in IMG/M |
3300010318|Ga0136656_1043994 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1613 | Open in IMG/M |
3300012919|Ga0160422_10006118 | Not Available | 7348 | Open in IMG/M |
3300012919|Ga0160422_10033520 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2975 | Open in IMG/M |
3300012919|Ga0160422_10164467 | Not Available | 1333 | Open in IMG/M |
3300012919|Ga0160422_10658607 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 666 | Open in IMG/M |
3300012920|Ga0160423_10414201 | Not Available | 920 | Open in IMG/M |
3300012920|Ga0160423_10548376 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 785 | Open in IMG/M |
3300012920|Ga0160423_10583073 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 758 | Open in IMG/M |
3300012920|Ga0160423_10650001 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 713 | Open in IMG/M |
3300012952|Ga0163180_10431778 | Not Available | 970 | Open in IMG/M |
3300017708|Ga0181369_1020325 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1619 | Open in IMG/M |
3300017710|Ga0181403_1011789 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1882 | Open in IMG/M |
3300017717|Ga0181404_1082376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 794 | Open in IMG/M |
3300017720|Ga0181383_1022404 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1699 | Open in IMG/M |
3300017728|Ga0181419_1015909 | Not Available | 2148 | Open in IMG/M |
3300017732|Ga0181415_1001024 | Not Available | 7586 | Open in IMG/M |
3300017732|Ga0181415_1126758 | Not Available | 574 | Open in IMG/M |
3300017735|Ga0181431_1046586 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 983 | Open in IMG/M |
3300017739|Ga0181433_1050266 | Not Available | 1062 | Open in IMG/M |
3300017740|Ga0181418_1002208 | Not Available | 5969 | Open in IMG/M |
3300017745|Ga0181427_1004267 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3585 | Open in IMG/M |
3300017746|Ga0181389_1032054 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1596 | Open in IMG/M |
3300017748|Ga0181393_1028835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1582 | Open in IMG/M |
3300017752|Ga0181400_1125051 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 741 | Open in IMG/M |
3300017755|Ga0181411_1181623 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 596 | Open in IMG/M |
3300017756|Ga0181382_1025866 | Not Available | 1809 | Open in IMG/M |
3300017767|Ga0181406_1021953 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2015 | Open in IMG/M |
3300017768|Ga0187220_1002647 | Not Available | 5599 | Open in IMG/M |
3300017768|Ga0187220_1145667 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 716 | Open in IMG/M |
3300017769|Ga0187221_1035776 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1651 | Open in IMG/M |
3300017773|Ga0181386_1202243 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 596 | Open in IMG/M |
3300017776|Ga0181394_1108728 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 881 | Open in IMG/M |
3300017782|Ga0181380_1010905 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3499 | Open in IMG/M |
3300017782|Ga0181380_1019587 | Not Available | 2529 | Open in IMG/M |
3300017783|Ga0181379_1040442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1817 | Open in IMG/M |
3300017818|Ga0181565_10548852 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 746 | Open in IMG/M |
3300017824|Ga0181552_10106365 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1547 | Open in IMG/M |
3300017824|Ga0181552_10228074 | Not Available | 948 | Open in IMG/M |
3300017824|Ga0181552_10261943 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 866 | Open in IMG/M |
3300017957|Ga0181571_10231280 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1186 | Open in IMG/M |
3300018036|Ga0181600_10429767 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 636 | Open in IMG/M |
3300018413|Ga0181560_10025838 | Not Available | 4032 | Open in IMG/M |
3300018415|Ga0181559_10331139 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 845 | Open in IMG/M |
3300018421|Ga0181592_10731540 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 658 | Open in IMG/M |
3300018603|Ga0192881_1017990 | Not Available | 681 | Open in IMG/M |
3300018876|Ga0181564_10422520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 723 | Open in IMG/M |
3300020052|Ga0181554_1054214 | Not Available | 2142 | Open in IMG/M |
3300020184|Ga0181573_10351163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 701 | Open in IMG/M |
3300020267|Ga0211648_1010331 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2215 | Open in IMG/M |
3300020282|Ga0211667_1000016 | Not Available | 64289 | Open in IMG/M |
3300020306|Ga0211616_1001054 | Not Available | 4613 | Open in IMG/M |
3300020377|Ga0211647_10009475 | Not Available | 4233 | Open in IMG/M |
3300020377|Ga0211647_10064335 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1316 | Open in IMG/M |
3300020385|Ga0211677_10012733 | Not Available | 4499 | Open in IMG/M |
3300020401|Ga0211617_10450962 | Not Available | 530 | Open in IMG/M |
3300020408|Ga0211651_10010129 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 4961 | Open in IMG/M |
3300020420|Ga0211580_10015896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 3324 | Open in IMG/M |
3300020438|Ga0211576_10000677 | Not Available | 28146 | Open in IMG/M |
3300020438|Ga0211576_10248476 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 935 | Open in IMG/M |
3300020440|Ga0211518_10305315 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 752 | Open in IMG/M |
3300020446|Ga0211574_10174035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 938 | Open in IMG/M |
3300020446|Ga0211574_10313238 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 678 | Open in IMG/M |
3300020450|Ga0211641_10272690 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 830 | Open in IMG/M |
3300020450|Ga0211641_10451478 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 617 | Open in IMG/M |
3300020470|Ga0211543_10355887 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 706 | Open in IMG/M |
3300021185|Ga0206682_10006845 | Not Available | 8645 | Open in IMG/M |
3300021368|Ga0213860_10287605 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 719 | Open in IMG/M |
3300021425|Ga0213866_10255243 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 892 | Open in IMG/M |
3300021959|Ga0222716_10456068 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 729 | Open in IMG/M |
3300022905|Ga0255756_1186203 | Not Available | 770 | Open in IMG/M |
3300022909|Ga0255755_1282846 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 586 | Open in IMG/M |
3300022934|Ga0255781_10269317 | Not Available | 789 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10055001 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2480 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10105068 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1188 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10482440 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 560 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10061993 | Not Available | 1436 | Open in IMG/M |
(restricted) 3300024255|Ga0233438_10134552 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1080 | Open in IMG/M |
(restricted) 3300024340|Ga0255042_10342990 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 503 | Open in IMG/M |
3300025070|Ga0208667_1001110 | Not Available | 10359 | Open in IMG/M |
3300025070|Ga0208667_1010982 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2058 | Open in IMG/M |
3300025083|Ga0208791_1015727 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1638 | Open in IMG/M |
3300025084|Ga0208298_1028621 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1179 | Open in IMG/M |
3300025086|Ga0208157_1040202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1302 | Open in IMG/M |
3300025086|Ga0208157_1127143 | Not Available | 585 | Open in IMG/M |
3300025101|Ga0208159_1013873 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2081 | Open in IMG/M |
3300025101|Ga0208159_1043950 | Not Available | 953 | Open in IMG/M |
3300025101|Ga0208159_1045428 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 930 | Open in IMG/M |
3300025102|Ga0208666_1136106 | Not Available | 564 | Open in IMG/M |
3300025120|Ga0209535_1015478 | Not Available | 4053 | Open in IMG/M |
3300025120|Ga0209535_1050182 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1785 | Open in IMG/M |
3300025151|Ga0209645_1001083 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 13819 | Open in IMG/M |
3300025543|Ga0208303_1030122 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1449 | Open in IMG/M |
3300025674|Ga0208162_1022854 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2380 | Open in IMG/M |
3300025705|Ga0209374_1181904 | Not Available | 569 | Open in IMG/M |
3300025870|Ga0209666_1120833 | Not Available | 1236 | Open in IMG/M |
3300026138|Ga0209951_1000027 | Not Available | 36049 | Open in IMG/M |
3300026258|Ga0208130_1000132 | Not Available | 39466 | Open in IMG/M |
3300027780|Ga0209502_10048539 | Not Available | 2349 | Open in IMG/M |
3300027906|Ga0209404_10000183 | Not Available | 53662 | Open in IMG/M |
3300028115|Ga0233450_10162521 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1090 | Open in IMG/M |
3300028287|Ga0257126_1099457 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1049 | Open in IMG/M |
3300028287|Ga0257126_1104811 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1009 | Open in IMG/M |
3300029309|Ga0183683_1020835 | Not Available | 1336 | Open in IMG/M |
3300029318|Ga0185543_1038192 | Not Available | 1060 | Open in IMG/M |
3300029448|Ga0183755_1017418 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2499 | Open in IMG/M |
3300031519|Ga0307488_10022592 | Not Available | 5060 | Open in IMG/M |
3300031774|Ga0315331_10193648 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1512 | Open in IMG/M |
3300031785|Ga0310343_10057701 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2372 | Open in IMG/M |
3300032047|Ga0315330_10650599 | Not Available | 620 | Open in IMG/M |
3300032073|Ga0315315_10542909 | Not Available | 1075 | Open in IMG/M |
3300032254|Ga0316208_1133710 | Not Available | 575 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 27.74% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.77% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 14.84% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.32% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.87% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.58% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 2.58% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.58% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.58% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.94% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.29% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.29% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.29% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.29% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.29% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.65% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.65% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.65% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.65% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.65% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.65% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.65% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.65% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.65% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.65% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.65% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2006543006 | Marine microbial communities from anoxic basin of Saanich Inlet - SI040908_100 | Environmental | Open in IMG/M |
2189573027 | Estuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmax | Environmental | Open in IMG/M |
3300000128 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m | Environmental | Open in IMG/M |
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
3300003409 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA | Environmental | Open in IMG/M |
3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018603 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906) | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020052 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020184 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020267 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108) | Environmental | Open in IMG/M |
3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
3300020306 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX556014-ERR599098) | Environmental | Open in IMG/M |
3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300022905 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG | Environmental | Open in IMG/M |
3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025705 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes) | Environmental | Open in IMG/M |
3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2007068243 | 2006543006 | Marine | MQLNKIIQSYKNSNMNKDLLSHKLKRYYNLTESERIIVKNNV |
GS312G0146KB_00209920 | 2189573027 | Marine Estuarine | MKNLNKILESYKGSNMNKVRLSYKLKSYYNLNENERIYLNNNL |
SA_S1_NOR08_45mDRAFT_1002504011 | 3300000128 | Marine | MNLKVNKIVQSYKNSNMNKELLSYKLKSYYNLNENERKHILYYI* |
JGI24006J15134_100152411 | 3300001450 | Marine | MKINKIIKSYKNSNMNKELLSYKLKKYYNLNEEERIHILYYI* |
JGI25132J35274_10532164 | 3300002483 | Marine | MKLNKIIQSYKNSNMNKELLSHKLKKYYNLTESERIIIKDYV* |
JGI26088J50261_10064232 | 3300003409 | Marine | MKNLNKILESYKGSNMNKVRLSYKLKSYYNLNENERIYLNNNL* |
Ga0066605_1002414014 | 3300004279 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKNYYNLSENERIIIKYSI* |
Ga0066223_10680924 | 3300004461 | Marine | MKLNKIIQSYKNSNMNKTLLSYKLKSYYNLSEDERIHILYWIQ* |
Ga0066845_100388711 | 3300005432 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKNYYNLNENERLIIKNSL* |
Ga0076924_10497291 | 3300005747 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKSYYNLNENERLIIKNSL* |
Ga0078893_106367911 | 3300005837 | Marine Surface Water | MKNLNKILESYKGSNMNKVRLSYKLKSYYNLNENERMFLESNL* |
Ga0068468_10408286 | 3300006305 | Marine | MKLNKIIQSYNNSNMNKELLSYKLKKYYNLSEQERIILKYNL* |
Ga0098038_100862416 | 3300006735 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKKYYNLSESQRLIIKHSI* |
Ga0098038_10998703 | 3300006735 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKKYYNLNENERLIIKNSL* |
Ga0098038_11080422 | 3300006735 | Marine | MKLNKIIQSYKNSNMNKELLSYKIKKYYNLNENERLIIKNSL* |
Ga0098038_11111534 | 3300006735 | Marine | MELNKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIIKNNV* |
Ga0098038_11881301 | 3300006735 | Marine | NKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIVKNNV* |
Ga0098037_12784683 | 3300006737 | Marine | MKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIVKNN |
Ga0098042_10455574 | 3300006749 | Marine | MKLNKIIQSYKNSNMNKELLSHKLKRYYNLNENERLIIKNTI* |
Ga0098042_10572461 | 3300006749 | Marine | IQSYKNSNMNKDLLSHKLKRYYNLTEFERIIIKNNV* |
Ga0098042_10592593 | 3300006749 | Marine | MKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIVKNNV* |
Ga0098048_11060292 | 3300006752 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKRYYNLNENERIIIKHSI* |
Ga0098048_11169562 | 3300006752 | Marine | MKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIIKNNV* |
Ga0098055_10913521 | 3300006793 | Marine | LNKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIIKHSI* |
Ga0070749_103452012 | 3300006802 | Aqueous | MKLNKIIQSYKNTNMNKELLSYKLKRYYNLSENERLIIKHSL* |
Ga0098045_10396332 | 3300006922 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIIKHSI* |
Ga0098045_10803551 | 3300006922 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLNENERIIIKHSI* |
Ga0098045_11517051 | 3300006922 | Marine | IIKYNNMKLNKIIQSYKNTNMNKELLSYKLKRYYNLNENERIIIKHSI* |
Ga0098051_10735572 | 3300006924 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIIK |
Ga0099849_10532878 | 3300007539 | Aqueous | MKLNKIIQSYKNTTMNTELLSYKLKRYYNLSENERLIIKHSL* |
Ga0099847_10630614 | 3300007540 | Aqueous | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERIIIKNNV* |
Ga0102948_12722351 | 3300007623 | Water | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLSENERLIVKHSL* |
Ga0102954_10973375 | 3300007778 | Water | MKLNKIMKLNKIIQSYKNSNMNKELLSYKLKSYYNLSENERLII |
Ga0105744_10049469 | 3300007863 | Estuary Water | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLSENERIIIKNSI* |
Ga0099850_11654214 | 3300007960 | Aqueous | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERLIIKHSL* |
Ga0102963_11528642 | 3300009001 | Pond Water | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERLIIKNSL* |
Ga0115011_101101544 | 3300009593 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKKYYNLNENERIIIKNSL* |
Ga0115011_111751961 | 3300009593 | Marine | KMKLNKIIQSYKNSNMNKELLSYKLKYYYNLSENERLIIKNSL* |
Ga0115000_102327561 | 3300009705 | Marine | MLNLNQIIKTYKNSNMNKELLSYKLKDYYNLNENDRIHILYYI* |
Ga0115001_101679775 | 3300009785 | Marine | MNVKVNKIIESYKDSNMNKKLLSFKLKSYYNLNENERKHILYWIA* |
Ga0115012_101387031 | 3300009790 | Marine | IIKYNKMKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIVKNNV* |
Ga0098043_10491392 | 3300010148 | Marine | MKLNKIIESYKNTNMNKELLSYKLKRYYNLSENERLIIKHSI* |
Ga0098043_10542811 | 3300010148 | Marine | MKLNKIIQSYKNSNMNKELLSHKLKRYYNLNENERLIIKNNI* |
Ga0129345_12205513 | 3300010297 | Freshwater To Marine Saline Gradient | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERL |
Ga0136656_10439947 | 3300010318 | Freshwater To Marine Saline Gradient | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERLVIKHSL* |
Ga0160422_100061182 | 3300012919 | Seawater | MILQNKNMKLNKIIESYKNTNMNKELLSYKLKRYYNLSENERLIIKHSL* |
Ga0160422_100335204 | 3300012919 | Seawater | MKLNKIIESYKNSNMNKELLSYKLKKYYNLSENERLIIKHSI* |
Ga0160422_101644672 | 3300012919 | Seawater | MKLNKIIQSYKNSNMNKELLSYKLKKYYNLSENERLIIKHSL* |
Ga0160422_106586071 | 3300012919 | Seawater | MKLNKIIQSYKNSNMNKELLSYKLKKYYNLSENERLIIKNSL* |
Ga0160423_104142013 | 3300012920 | Surface Seawater | MKLNKIIQSYKNSNMNKELLSHKLKRYYNLTEFERIIVKNNV* |
Ga0160423_105483763 | 3300012920 | Surface Seawater | MKLNKIIQSYKNTNMNKELLSYKLKRYYNLSENERIIIKQSI* |
Ga0160423_105830733 | 3300012920 | Surface Seawater | MKLNKIIQSYKNSNMNKELLSYKLKNYYNLSENERLIIKHSL* |
Ga0160423_106500013 | 3300012920 | Surface Seawater | MKLNKIIESYKNSNMNKELLSYKLKRYYNLSENERIIIKQSI* |
Ga0163180_104317781 | 3300012952 | Seawater | MKNLNKILESYKGSNMNRVRLSYKLKSYYNLNENERMILESNL* |
Ga0181369_10203253 | 3300017708 | Marine | MKLNKIIQSYKNSNMNKELLSYKIKKYYNLNENERLIIKNSL |
Ga0181403_10117895 | 3300017710 | Seawater | MRLNKIIQSYKNTNMNKELLSYKLKKYYNLNENERIIIKHSI |
Ga0181404_10823762 | 3300017717 | Seawater | MKLNKIIQSYKNSNMNKELLSYKLKKYYNLNENERIIIKHSL |
Ga0181383_10224047 | 3300017720 | Seawater | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIVKNNM |
Ga0181419_10159091 | 3300017728 | Seawater | MKINKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIVKNNM |
Ga0181415_100102415 | 3300017732 | Seawater | MKINKIIQSYKNTNMNKELLSYKLKKYYNLNENERIIIKHSI |
Ga0181415_11267581 | 3300017732 | Seawater | MKLDKIIQSYNNSNMNKELLSYKLKKYYNLSEQDRIILKNNL |
Ga0181431_10465861 | 3300017735 | Seawater | KNKNMKINKIIQSYKNTNMNKELLSYKLKKYYNLNENERIIIKHSI |
Ga0181433_10502665 | 3300017739 | Seawater | MKLNKIIQSYKNSNMNKELLSYKLKKYYNLNENERLIIKYNI |
Ga0181418_10022085 | 3300017740 | Seawater | MKINKIIQSYKNTNMNKELLSYKLKNYYNLNENERIIIKHSI |
Ga0181427_10042671 | 3300017745 | Seawater | KNKNMKINKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIIKHNI |
Ga0181389_10320546 | 3300017746 | Seawater | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLSENERLIIKHSI |
Ga0181393_10288354 | 3300017748 | Seawater | MKLNKIIQSYNNSNMNKELLSYKLKKYYNLSEQERLIIRHSI |
Ga0181400_11250514 | 3300017752 | Seawater | MKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTESERIIVK |
Ga0181411_11816231 | 3300017755 | Seawater | QSYKNTNMNKELLSYKLKKYYNLNENERLIIKHNI |
Ga0181382_10258661 | 3300017756 | Seawater | MKLNKIIQSYNNSNMNKELLSYKLKKYYNLSEQER |
Ga0181406_10219531 | 3300017767 | Seawater | KIIQSYKNTNMNKELLSYKLKKYYNLNENERIIIKHSI |
Ga0187220_100264716 | 3300017768 | Seawater | MKDLNKILESYKGSNMNKVRLSYKLKNYYNLNENERIYLNNNL |
Ga0187220_11456672 | 3300017768 | Seawater | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERLIIKHNI |
Ga0187221_10357761 | 3300017769 | Seawater | MKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTESERIIIKNNV |
Ga0181386_12022433 | 3300017773 | Seawater | KIIQSYKNTNMNKELLSYKLKNYYNLNENERIIIKHSI |
Ga0181394_11087281 | 3300017776 | Seawater | IIQSYKNTNMNKELLSYKLKKYYNLNENERIIIKHSI |
Ga0181380_10109051 | 3300017782 | Seawater | NLKINNMKLNKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIIKHNI |
Ga0181380_10195877 | 3300017782 | Seawater | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLNENER |
Ga0181379_10404421 | 3300017783 | Seawater | MKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTESERIIVKNNM |
Ga0181565_105488523 | 3300017818 | Salt Marsh | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERLIIKSSL |
Ga0181552_101063653 | 3300017824 | Salt Marsh | MKLNKIMKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERLIIKHSL |
Ga0181552_102280741 | 3300017824 | Salt Marsh | MKLNKIIQSYKNSNMNKDLLSYKLKRYYNLNENERLIIKNSL |
Ga0181552_102619432 | 3300017824 | Salt Marsh | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERIIIKNNV |
Ga0181571_102312803 | 3300017957 | Salt Marsh | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERLIIKNSL |
Ga0181600_104297671 | 3300018036 | Salt Marsh | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERLIIKHSL |
Ga0181560_100258389 | 3300018413 | Salt Marsh | MKLNKIMKLNKIIQSYKNSNMNKELLSYKLKSYYNLSENERLIIKHSL |
Ga0181559_103311393 | 3300018415 | Salt Marsh | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERLIVKHSL |
Ga0181592_107315404 | 3300018421 | Salt Marsh | MKLNKIIQSYKNSNMNKDLLSYKLKKYYNLNENERLIIKNSL |
Ga0192881_10179901 | 3300018603 | Marine | MKNLNKILESYKSSNMNKVRLSYKLKSYYNLNENERIFLESNL |
Ga0181564_104225203 | 3300018876 | Salt Marsh | MKLNKFIQSYKNSNMNKDLLSYKLKRYYNLNENERLIIKNSL |
Ga0181554_10542141 | 3300020052 | Salt Marsh | MKLNKIMKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERL |
Ga0181573_103511631 | 3300020184 | Salt Marsh | MKLNKIIQSYKNSNMNKDLLSYKLKRYYNLNENERL |
Ga0211648_10103314 | 3300020267 | Marine | MKLNKIIQSYKNSNMNKELLSHKLKRYYNLTEFERIIVKNNV |
Ga0211667_100001637 | 3300020282 | Marine | MKLNKIIESYKNTNMNKELLSYKLKRYYNLSENERLIIKHSI |
Ga0211616_10010542 | 3300020306 | Marine | MKLNKIIESYKNSNMNKELLSYKLKRYYNLSENERLIIKHSI |
Ga0211647_100094757 | 3300020377 | Marine | MKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIVKNNV |
Ga0211647_100643352 | 3300020377 | Marine | MKLNKIIQSYKNSNMNKELLSHKLKRYYNLNENERLIIKNNI |
Ga0211677_100127332 | 3300020385 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIIKNSL |
Ga0211617_104509621 | 3300020401 | Marine | VSDLIIKYKTMKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIVKNNV |
Ga0211651_1001012917 | 3300020408 | Marine | MKLNKIIESYKNSNMNKELLSYKLKRYYNLSENERIIIKQSI |
Ga0211580_100158968 | 3300020420 | Marine | MKLNKIIQSYNNSNMNKELLSYKLKKYYNLSEQERIILKHNL |
Ga0211576_1000067746 | 3300020438 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIIKHNI |
Ga0211576_102484764 | 3300020438 | Marine | MKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTESERIIVKNNV |
Ga0211518_103053152 | 3300020440 | Marine | MNINKIIQSYKNSNMNKELLSYKLKKYYNLNENERLIIKNNI |
Ga0211574_101740351 | 3300020446 | Marine | IIQSYKNSNMNKELLSYKLKNYYNLNENERLIIKNSL |
Ga0211574_103132381 | 3300020446 | Marine | IIQSYKNSNMNKELLSYKLKNYYNLSENERLIIKHSL |
Ga0211641_102726905 | 3300020450 | Marine | NNNMKLNKIIQSYKNSNMNKDLLSYKLKNYYNLNENERLIIKNSL |
Ga0211641_104514781 | 3300020450 | Marine | MKLNKIIESYKNSNMNKELLSYKLKRYYNLSENERLIIKHSL |
Ga0211543_103558874 | 3300020470 | Marine | KIIESYKNSNMNKELLSYKLKRYYNLSENERIIIKHSI |
Ga0206682_1000684514 | 3300021185 | Seawater | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLSENERIIIKHSL |
Ga0213860_102876053 | 3300021368 | Seawater | MKLNKIIESYKNSNMNKELLSYKLKRYYNLSENERIIIKHSL |
Ga0213866_102552432 | 3300021425 | Seawater | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERLIIKHSI |
Ga0222716_104560681 | 3300021959 | Estuarine Water | MKLNKIIQSYKNTNMNKELLSYKLKRYYNLSENERLIIKHSL |
Ga0255756_11862035 | 3300022905 | Salt Marsh | IIQSYKNSNMNKDLLSYKLKRYYNLNENERLIIKNSL |
Ga0255755_12828462 | 3300022909 | Salt Marsh | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERIIIKNNVXQ |
Ga0255781_102693175 | 3300022934 | Salt Marsh | LNKIIQSYKNSNMNKDLLSYKLKRYYNLNENERLIIKNSL |
(restricted) Ga0233432_100550013 | 3300023109 | Seawater | MKLNKIIQSYKNSNMNKELLSYKLKNYYNLSENERIIIKHSI |
(restricted) Ga0233412_101050681 | 3300023210 | Seawater | KLNKIIQSYKNSNMNKELLSYKLKNYYNLSENERIIIKHSI |
(restricted) Ga0233412_104824402 | 3300023210 | Seawater | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERIIIKHSI |
(restricted) Ga0255039_100619932 | 3300024062 | Seawater | MKNLNRILESYKGSNMNKVRLSYKLKSYYNLNENERIYLNNNL |
(restricted) Ga0233438_101345523 | 3300024255 | Seawater | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERIIIKHSI |
(restricted) Ga0255042_103429901 | 3300024340 | Seawater | KIIQSYKNSNMNKELLSYKLKRYYNLNENERIIIKHSI |
Ga0208667_10011102 | 3300025070 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIIKHSI |
Ga0208667_10109823 | 3300025070 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLNENERIIIKHSI |
Ga0208791_10157277 | 3300025083 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKNYYNLNENERIIIKHSI |
Ga0208298_10286214 | 3300025084 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKRYYNLSENERLIIKHSI |
Ga0208157_10402022 | 3300025086 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKKYYNLSESQRLIIKHSI |
Ga0208157_11271433 | 3300025086 | Marine | MELNKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIIKN |
Ga0208159_10138732 | 3300025101 | Marine | MKLNKIIQSYKNSNMNKDLLSYKLKNYYNLNENERLIIKNSL |
Ga0208159_10439501 | 3300025101 | Marine | MELNKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIVKNNV |
Ga0208159_10454282 | 3300025101 | Marine | MKLNKIIQSYKNSNMNKELLSHKLKRYYNLNENERLIIKNTI |
Ga0208666_11361061 | 3300025102 | Marine | DNIIKYKTMKLNKIIQSYKNSNMNKDLLSHKLKRYYNLTEFERIIVKNNV |
Ga0209535_10154783 | 3300025120 | Marine | MTVNKIIQTYKNSNMNKELLSYKLKDYYNLNEDERIHVLYYI |
Ga0209535_10501824 | 3300025120 | Marine | MKINKIIKSYKNSNMNKELLSYKLKKYYNLNEEERIHILYYI |
Ga0209645_100108315 | 3300025151 | Marine | MKLNKIIQSYKNSNMNKELLSHKLKKYYNLTESERIIIKDYV |
Ga0208303_10301228 | 3300025543 | Aqueous | KSNTNKKIEIMKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERLIIKNSL |
Ga0208162_10228544 | 3300025674 | Aqueous | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERLVIKHSL |
Ga0209374_11819041 | 3300025705 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNEEERIHILYYI |
Ga0209666_11208334 | 3300025870 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKNYYNLNENERIIIKHSI |
Ga0209951_100002741 | 3300026138 | Pond Water | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLSENERLIVKHSL |
Ga0208130_100013249 | 3300026258 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKNYYNLNENERLIIKNSL |
Ga0209502_100485393 | 3300027780 | Marine | MNVKVNKIIESYKDSNMNKKLLSFKLKSYYNLNENERKHILYWIA |
Ga0209404_1000018316 | 3300027906 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKKYYNLNENERIIIKNSL |
Ga0233450_101625211 | 3300028115 | Salt Marsh | MKLNKIMKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERLVIKHSL |
Ga0257126_10994576 | 3300028287 | Marine | MKLNKIIIKYNNMKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERIIIKHSI |
Ga0257126_11048112 | 3300028287 | Marine | MKLNKIIQSYKNTNMNKELLSYKLKKYYNLSENERIIIKNSI |
Ga0183683_10208352 | 3300029309 | Marine | MKLNKIIQSYKNSNMNKKLLSHKLKRYYNLNENERLIIKNNI |
Ga0185543_10381924 | 3300029318 | Marine | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLNENERLII |
Ga0183755_10174181 | 3300029448 | Marine | MKLNKILQSYKNSNMNKELLSYKIKRYYNLNENERLIIKNSLL |
Ga0307488_100225924 | 3300031519 | Sackhole Brine | MNVKVNKIIESYKDSNMNKKLLSFKLKSYYNLNENERKHILYWIE |
Ga0315331_101936484 | 3300031774 | Seawater | MKINKIIESYKNSNMNKELLSYKLKKYYNLNEEERIHILYYI |
Ga0310343_100577015 | 3300031785 | Seawater | MKLNKIIQSYKNSNMNKELLSYKLKRYYNLSENERLIIKNSL |
Ga0315330_106505992 | 3300032047 | Seawater | MKINKIIQSYKNTNMNKELLSYKLKKYYNLNENERLIIKHNI |
Ga0315315_105429091 | 3300032073 | Seawater | YINKNKNMKINKIIQSYKNTNMNKELLSYKLKKYYNLNENERIIIKHSI |
Ga0316208_11337101 | 3300032254 | Microbial Mat | MKDLNKILESYKGSNMNKVRLSYKLKSYYNLNESERIFLNNNL |
⦗Top⦘ |