NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045168

Metagenome / Metatranscriptome Family F045168

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045168
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 40 residues
Representative Sequence IQDYIRRYNTNPQPFQWVASASKIIRKVNKYKETLETGD
Number of Associated Samples 104
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.31 %
% of genes near scaffold ends (potentially truncated) 98.69 %
% of genes from short scaffolds (< 2000 bps) 71.24 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.856 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(17.647 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.405 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.31%    β-sheet: 0.00%    Coil/Unstructured: 62.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF13304AAA_21 3.27
PF13565HTH_32 2.61
PF13358DDE_3 2.61
PF02146SIR2 2.61
PF00005ABC_tran 1.31
PF01382Avidin 1.31
PF00072Response_reg 1.31
PF13620CarboxypepD_reg 1.31
PF13360PQQ_2 1.31
PF06739SBBP 1.31
PF02687FtsX 1.31
PF05402PqqD 1.31
PF04191PEMT 1.31
PF03929PepSY_TM 1.31
PF02627CMD 0.65
PF07635PSCyt1 0.65
PF00122E1-E2_ATPase 0.65
PF01979Amidohydro_1 0.65
PF07275ArdA 0.65
PF02371Transposase_20 0.65
PF13604AAA_30 0.65
PF14559TPR_19 0.65
PF01850PIN 0.65
PF02321OEP 0.65
PF02310B12-binding 0.65
PF07335Glyco_hydro_75 0.65
PF02518HATPase_c 0.65
PF08241Methyltransf_11 0.65
PF01068DNA_ligase_A_M 0.65
PF00561Abhydrolase_1 0.65
PF00550PP-binding 0.65
PF08281Sigma70_r4_2 0.65
PF03050DDE_Tnp_IS66 0.65
PF13579Glyco_trans_4_4 0.65
PF00596Aldolase_II 0.65
PF03544TonB_C 0.65
PF01229Glyco_hydro_39 0.65
PF10531SLBB 0.65
PF13393tRNA-synt_His 0.65
PF04794YdjC 0.65
PF03412Peptidase_C39 0.65
PF10137TIR-like 0.65
PF13683rve_3 0.65
PF12704MacB_PCD 0.65
PF04977DivIC 0.65
PF02899Phage_int_SAM_1 0.65
PF03200Glyco_hydro_63 0.65
PF00903Glyoxalase 0.65
PF00486Trans_reg_C 0.65
PF07992Pyr_redox_2 0.65
PF14849YidC_periplas 0.65
PF04972BON 0.65
PF03992ABM 0.65
PF00563EAL 0.65
PF13204DUF4038 0.65
PF08681DUF1778 0.65
PF01058Oxidored_q6 0.65
PF12969DUF3857 0.65
PF01610DDE_Tnp_ISL3 0.65
PF00753Lactamase_B 0.65
PF00450Peptidase_S10 0.65
PF13442Cytochrome_CBB3 0.65
PF00884Sulfatase 0.65
PF07519Tannase 0.65
PF00923TAL_FSA 0.65
PF05016ParE_toxin 0.65
PF05598DUF772 0.65
PF06742DUF1214 0.65
PF01243Putative_PNPOx 0.65
PF01966HD 0.65
PF00665rve 0.65
PF00589Phage_integrase 0.65
PF01578Cytochrom_C_asm 0.65
PF13551HTH_29 0.65
PF01261AP_endonuc_2 0.65
PF13240zinc_ribbon_2 0.65
PF03109ABC1 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG0846NAD-dependent protein deacetylase, SIR2 familyPosttranslational modification, protein turnover, chaperones [O] 2.61
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.31
COG3182PepSY-associated TM regionFunction unknown [S] 1.31
COG3295Uncharacterized conserved proteinFunction unknown [S] 1.31
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 0.65
COG0377NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductaseEnergy production and conversion [C] 0.65
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.65
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.65
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 0.65
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.65
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.65
COG1740Ni,Fe-hydrogenase I small subunitEnergy production and conversion [C] 0.65
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.65
COG1941Coenzyme F420-reducing hydrogenase, gamma subunitEnergy production and conversion [C] 0.65
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.65
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.65
COG2216K+ transport ATPase, ATPase subunit KdpBInorganic ion transport and metabolism [P] 0.65
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.65
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.65
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.65
COG2919Cell division protein FtsBCell cycle control, cell division, chromosome partitioning [D] 0.65
COG2939Carboxypeptidase C (cathepsin A)Amino acid transport and metabolism [E] 0.65
COG3260Ni,Fe-hydrogenase III small subunitEnergy production and conversion [C] 0.65
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.65
COG3394Chitooligosaccharide deacetylase ChbG, YdjC/CelG familyCarbohydrate transport and metabolism [G] 0.65
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.65
COG3436TransposaseMobilome: prophages, transposons [X] 0.65
COG3464TransposaseMobilome: prophages, transposons [X] 0.65
COG3547TransposaseMobilome: prophages, transposons [X] 0.65
COG3664Beta-xylosidaseCarbohydrate transport and metabolism [G] 0.65
COG4453Uncharacterized conserved protein, DUF1778 familyFunction unknown [S] 0.65
COG4584TransposaseMobilome: prophages, transposons [X] 0.65
COG4734Antirestriction protein ArdADefense mechanisms [V] 0.65
COG4839Cell division protein FtsLCell cycle control, cell division, chromosome partitioning [D] 0.65
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.65
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.65
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.65
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.65
COG5361Uncharacterized conserved proteinMobilome: prophages, transposons [X] 0.65
COG5402Uncharacterized protein, contains DUF1214 domainFunction unknown [S] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.51 %
UnclassifiedrootN/A25.49 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_12968961Not Available1096Open in IMG/M
3300005332|Ga0066388_103218452All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300005366|Ga0070659_101427729Not Available616Open in IMG/M
3300005524|Ga0070737_10001655All Organisms → cellular organisms → Bacteria30508Open in IMG/M
3300005524|Ga0070737_10001815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia28396Open in IMG/M
3300005524|Ga0070737_10008627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8684Open in IMG/M
3300005524|Ga0070737_10009434All Organisms → cellular organisms → Bacteria8131Open in IMG/M
3300005524|Ga0070737_10016948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5280Open in IMG/M
3300005524|Ga0070737_10029277All Organisms → cellular organisms → Bacteria3477Open in IMG/M
3300005524|Ga0070737_10060090Not Available1976Open in IMG/M
3300005534|Ga0070735_10118508All Organisms → cellular organisms → Bacteria → Acidobacteria1656Open in IMG/M
3300005534|Ga0070735_10867087Not Available530Open in IMG/M
3300005537|Ga0070730_10009811All Organisms → cellular organisms → Bacteria7911Open in IMG/M
3300005541|Ga0070733_10227841Not Available1222Open in IMG/M
3300005541|Ga0070733_10317451Not Available1030Open in IMG/M
3300005563|Ga0068855_100127932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2903Open in IMG/M
3300005563|Ga0068855_100515716All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300005563|Ga0068855_100528974All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300005564|Ga0070664_100333530All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300005614|Ga0068856_100637314All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300005764|Ga0066903_102487257All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300005764|Ga0066903_102768852All Organisms → cellular organisms → Bacteria → Proteobacteria951Open in IMG/M
3300006028|Ga0070717_10296585All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300006028|Ga0070717_10701435All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300006028|Ga0070717_10829239All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300006052|Ga0075029_100088728All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300006059|Ga0075017_100261122All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1269Open in IMG/M
3300006059|Ga0075017_101292024All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300006237|Ga0097621_100662676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae958Open in IMG/M
3300006800|Ga0066660_10742954All Organisms → cellular organisms → Bacteria → Proteobacteria801Open in IMG/M
3300006806|Ga0079220_10271257All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300006806|Ga0079220_10716310Not Available739Open in IMG/M
3300006806|Ga0079220_11610862All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300006854|Ga0075425_102431115All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300006893|Ga0073928_10032443All Organisms → cellular organisms → Bacteria4991Open in IMG/M
3300006893|Ga0073928_10052658All Organisms → cellular organisms → Bacteria3658Open in IMG/M
3300006893|Ga0073928_10159549Not Available1810Open in IMG/M
3300006893|Ga0073928_10390381All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300006893|Ga0073928_10975092Not Available578Open in IMG/M
3300009038|Ga0099829_11203080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300009137|Ga0066709_104204081All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300009518|Ga0116128_1000677All Organisms → cellular organisms → Bacteria16739Open in IMG/M
3300009549|Ga0116137_1072538All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1057Open in IMG/M
3300009646|Ga0116132_1001521All Organisms → cellular organisms → Bacteria16733Open in IMG/M
3300009824|Ga0116219_10386801All Organisms → cellular organisms → Bacteria → Acidobacteria781Open in IMG/M
3300009839|Ga0116223_10420375All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300010046|Ga0126384_10604557All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300010361|Ga0126378_10002234All Organisms → cellular organisms → Bacteria → Acidobacteria14318Open in IMG/M
3300010366|Ga0126379_10949026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium964Open in IMG/M
3300010366|Ga0126379_10973904All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300010373|Ga0134128_10103003All Organisms → cellular organisms → Bacteria3246Open in IMG/M
3300010373|Ga0134128_10537301Not Available1303Open in IMG/M
3300010373|Ga0134128_10892032All Organisms → cellular organisms → Bacteria → Proteobacteria984Open in IMG/M
3300010373|Ga0134128_11200559All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea837Open in IMG/M
3300010376|Ga0126381_101576031Not Available949Open in IMG/M
3300010376|Ga0126381_102574531All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300010376|Ga0126381_103277955All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300010376|Ga0126381_103749742Not Available594Open in IMG/M
3300010379|Ga0136449_101632703Not Available977Open in IMG/M
3300011269|Ga0137392_11580837Not Available514Open in IMG/M
3300011271|Ga0137393_10326107All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1310Open in IMG/M
3300011271|Ga0137393_11122958All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1668Open in IMG/M
3300012582|Ga0137358_10279181Not Available1135Open in IMG/M
3300012912|Ga0157306_10021273Not Available1395Open in IMG/M
3300012923|Ga0137359_11773411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia504Open in IMG/M
3300012971|Ga0126369_10081824All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2867Open in IMG/M
3300012971|Ga0126369_10976985All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300012971|Ga0126369_11398949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium790Open in IMG/M
3300014155|Ga0181524_10033085All Organisms → cellular organisms → Bacteria3533Open in IMG/M
3300014162|Ga0181538_10242239Not Available996Open in IMG/M
3300014489|Ga0182018_10547439All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300014501|Ga0182024_10048160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales6816Open in IMG/M
3300014501|Ga0182024_12877572Not Available510Open in IMG/M
3300015371|Ga0132258_10983618All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum2132Open in IMG/M
3300016387|Ga0182040_10123587All Organisms → cellular organisms → Bacteria → Acidobacteria1800Open in IMG/M
3300016445|Ga0182038_10025606All Organisms → cellular organisms → Bacteria3626Open in IMG/M
3300017925|Ga0187856_1001763All Organisms → cellular organisms → Bacteria16739Open in IMG/M
3300017943|Ga0187819_10001903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10885Open in IMG/M
3300017955|Ga0187817_10027105All Organisms → cellular organisms → Bacteria3452Open in IMG/M
3300017955|Ga0187817_10414853All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300018001|Ga0187815_10069021All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300018001|Ga0187815_10287317Not Available697Open in IMG/M
3300018058|Ga0187766_11196490Not Available550Open in IMG/M
3300018090|Ga0187770_10557531Not Available909Open in IMG/M
3300018432|Ga0190275_10016829All Organisms → cellular organisms → Bacteria5573Open in IMG/M
3300018432|Ga0190275_10057666All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales3273Open in IMG/M
3300018469|Ga0190270_11144948Not Available813Open in IMG/M
3300020580|Ga0210403_10786629All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300020583|Ga0210401_10693184All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300021171|Ga0210405_10064746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus2884Open in IMG/M
3300021362|Ga0213882_10266253Not Available712Open in IMG/M
3300021374|Ga0213881_10062584Not Available1584Open in IMG/M
3300021407|Ga0210383_11395780All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300021478|Ga0210402_11770625Not Available544Open in IMG/M
3300022557|Ga0212123_10000963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia85335Open in IMG/M
3300022557|Ga0212123_10453777All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium844Open in IMG/M
3300023250|Ga0224544_1003913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1998Open in IMG/M
3300025432|Ga0208821_1001093All Organisms → cellular organisms → Bacteria16748Open in IMG/M
3300025501|Ga0208563_1001360All Organisms → cellular organisms → Bacteria16739Open in IMG/M
3300025898|Ga0207692_10478398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium787Open in IMG/M
3300025916|Ga0207663_11156903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300025919|Ga0207657_10769036Not Available746Open in IMG/M
3300025921|Ga0207652_10378788Not Available1277Open in IMG/M
3300025945|Ga0207679_10976644Not Available776Open in IMG/M
3300025949|Ga0207667_10155926All Organisms → cellular organisms → Bacteria → Proteobacteria2349Open in IMG/M
3300026041|Ga0207639_10375523All Organisms → cellular organisms → Bacteria → Acidobacteria1275Open in IMG/M
3300026078|Ga0207702_10173768All Organisms → cellular organisms → Bacteria → Acidobacteria1978Open in IMG/M
3300027660|Ga0209736_1205597Not Available510Open in IMG/M
3300027842|Ga0209580_10531263Not Available585Open in IMG/M
3300027879|Ga0209169_10082531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli1661Open in IMG/M
3300027889|Ga0209380_10010989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5252Open in IMG/M
3300027895|Ga0209624_10415648All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300027968|Ga0209061_1001490All Organisms → cellular organisms → Bacteria38300Open in IMG/M
3300027968|Ga0209061_1002185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus26274Open in IMG/M
3300027968|Ga0209061_1025371All Organisms → cellular organisms → Bacteria2932Open in IMG/M
3300027968|Ga0209061_1042706Not Available1955Open in IMG/M
3300027968|Ga0209061_1100693All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1015Open in IMG/M
3300028016|Ga0265354_1025894Not Available563Open in IMG/M
3300028379|Ga0268266_11979305All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300028906|Ga0308309_10556248All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300029913|Ga0311362_10324762Not Available1579Open in IMG/M
3300030007|Ga0311338_10243919All Organisms → cellular organisms → Bacteria2026Open in IMG/M
3300030523|Ga0272436_1082555All Organisms → cellular organisms → Bacteria → Acidobacteria1241Open in IMG/M
3300030523|Ga0272436_1106213All Organisms → cellular organisms → Bacteria → Acidobacteria970Open in IMG/M
3300030523|Ga0272436_1121770Not Available850Open in IMG/M
3300030523|Ga0272436_1166299All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300030706|Ga0310039_10316355Not Available588Open in IMG/M
3300030716|Ga0307920_103653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1419Open in IMG/M
3300031452|Ga0272422_1014881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum6025Open in IMG/M
3300031452|Ga0272422_1030690All Organisms → cellular organisms → Bacteria → Acidobacteria3334Open in IMG/M
3300031452|Ga0272422_1194294All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300031520|Ga0272428_1003931All Organisms → cellular organisms → Bacteria26196Open in IMG/M
3300031520|Ga0272428_1017398All Organisms → cellular organisms → Bacteria7984Open in IMG/M
3300031520|Ga0272428_1024162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6079Open in IMG/M
3300031670|Ga0307374_10001130All Organisms → cellular organisms → Bacteria → Acidobacteria50169Open in IMG/M
3300031670|Ga0307374_10494348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium660Open in IMG/M
3300031681|Ga0318572_10777191Not Available570Open in IMG/M
3300031708|Ga0310686_101468934Not Available3083Open in IMG/M
3300031736|Ga0318501_10540966All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium637Open in IMG/M
3300031754|Ga0307475_11289193All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300031939|Ga0308174_11187987All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300031941|Ga0310912_10078312All Organisms → cellular organisms → Bacteria2395Open in IMG/M
3300031954|Ga0306926_11606557All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300031962|Ga0307479_10083769All Organisms → cellular organisms → Bacteria → Acidobacteria3087Open in IMG/M
3300032059|Ga0318533_10983474Not Available619Open in IMG/M
3300032076|Ga0306924_10186259All Organisms → cellular organisms → Bacteria2382Open in IMG/M
3300032160|Ga0311301_12414997All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300032205|Ga0307472_102141275Not Available563Open in IMG/M
3300032805|Ga0335078_11387206All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300033289|Ga0310914_10211164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1736Open in IMG/M
3300034268|Ga0372943_0247430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1119Open in IMG/M
3300034268|Ga0372943_0587592All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076730Open in IMG/M
3300034268|Ga0372943_1234067All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil11.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.19%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock6.54%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring4.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.27%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.27%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.96%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.31%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.31%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.31%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.31%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock1.31%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.65%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.65%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.65%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027968Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028016Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030523Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstoneEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030716Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031452Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nordEnvironmentalOpen in IMG/M
3300031520Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nordEnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1296896113300000789SoilAIQEYIRENNKSPRPFQWVASANTIVRKVRKYKWTLETGD*
Ga0066388_10321845213300005332Tropical Forest SoilIQDYIRRYNTNPQPFQWVASASKIIRKVNKYKETLETGD*
Ga0070659_10142772913300005366Corn RhizosphereLVKVIRDYIRHYNSDPRPFHWVASTSRILQKVRKYKRTLETGD*
Ga0070737_10001655313300005524Surface SoilIHDYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD*
Ga0070737_1000181513300005524Surface SoilHDYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD*
Ga0070737_10008627123300005524Surface SoilIHDYLKDYNENPRPFRWIASASRIICKVNKYKAISETAD*
Ga0070737_1000943413300005524Surface SoilAIHDYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAG*
Ga0070737_1001694813300005524Surface SoilKDYNENPRPFRWIASASRIIRKVNKYKAISETAD*
Ga0070737_1002927713300005524Surface SoilLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD*
Ga0070737_1006009013300005524Surface SoilDYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD*
Ga0070735_1011850843300005534Surface SoilHDYIRHYNKTPRPFHWVASASRIIRKVSKYKGTSETGD*
Ga0070735_1086708713300005534Surface SoilIHDYIRHYNKTPRPFHWVASASRIIRKVSKYKGTSETGD*
Ga0070730_1000981113300005537Surface SoilIQDYIRLYNKNPRPFQWVASASRIIRKVYKYKGTSETGD*
Ga0070733_1022784113300005541Surface SoilIQDYLRQYNKNPQPFQWVASASRIIRKVNKYKEISETGD*
Ga0070733_1031745123300005541Surface SoilLRQYNKNPQPFQWVASASRIIRKVNKYKEISETGD*
Ga0068855_10012793243300005563Corn RhizosphereIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD*
Ga0068855_10051571613300005563Corn RhizosphereRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD*
Ga0068855_10052897413300005563Corn RhizosphereRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD*
Ga0070664_10033353013300005564Corn RhizosphereDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD*
Ga0068856_10063731423300005614Corn RhizosphereAAIGDYIRTYNENPRPFQWIASASKIIRKVRKYKEISDA*
Ga0066903_10248725733300005764Tropical Forest SoilQDYIRRYNRNPQPFRWVASASKIIRKVNKYKETLETED*
Ga0066903_10276885233300005764Tropical Forest SoilDLTQAIQDYIQRYNRNPQPFRWVASASKIIRKVNKYKETLETED*
Ga0070717_1029658533300006028Corn, Switchgrass And Miscanthus RhizosphereIQDYVRHYNKKPQPFRWVASAAKIIRKVNKYKRTLETGD*
Ga0070717_1070143523300006028Corn, Switchgrass And Miscanthus RhizosphereLIKAISDYVRQYNRNPQPFQWIASASKIIRKVNKYKETLKTGD*
Ga0070717_1082923923300006028Corn, Switchgrass And Miscanthus RhizosphereQDYVRHYNKKPQPFRWVASAAKIIRKVNKYKRTLETGD*
Ga0075029_10008872823300006052WatershedsVRDLVKAIQEYIRENNKSPRPFQWVASANTIVRKVRKYKWSLQTGG*
Ga0075017_10026112243300006059WatershedsYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD*
Ga0075017_10129202423300006059WatershedsIQEYIRENNKSPRPFQWVASANTIVRKVRKYKWTLETGD*
Ga0097621_10066267613300006237Miscanthus RhizosphereIRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD*
Ga0066660_1074295423300006800SoilKDYVRQYNNHPQPFQWIASASKIIRKVNKYKETLETGD*
Ga0079220_1027125723300006806Agricultural SoilRDLIKAIRDYVRQYNKNPQPFQWIASASKIIRKVNKYKET*
Ga0079220_1071631013300006806Agricultural SoilYVRQYNKNPQPFQWIASASKIIRKVNKYKETLETGD*
Ga0079220_1161086213300006806Agricultural SoilAIRDYVRQYNKNPQPFQWIASASKIIRKVNKYKETLETGD*
Ga0075425_10243111523300006854Populus RhizosphereDLIKTIHDYIRLYNKNPRPFQWVASASQIIRKVNKYKGISETGD*
Ga0073928_10032443113300006893Iron-Sulfur Acid SpringIKDYVLHYNKNPQSFQWVATASKIIRKVNKYKETLETGD*
Ga0073928_1005265843300006893Iron-Sulfur Acid SpringAIKDYVLHYNKNPQSFQWVATASKIIRKVNKYKETLETGD*
Ga0073928_1015954913300006893Iron-Sulfur Acid SpringIHEYVQRYNRNPQPFHWVASASKIIRKVNKYKQTLETGD*
Ga0073928_1039038133300006893Iron-Sulfur Acid SpringAIHEYVQRYNRNPQPFHWVASASKIIRKVNKYKQTLETGD*
Ga0073928_1097509233300006893Iron-Sulfur Acid SpringVLHYNKNPQPFQWVASASKIIRKVNIYKETLETGD*
Ga0099829_1120308013300009038Vadose Zone SoilYIRLYNKNPRPFQWVASASRITRKVDKYKGTSETGD*
Ga0066709_10420408113300009137Grasslands SoilIRHYNKNPRPFQWVASASRIIKKVNKYKEILETGD*
Ga0116128_1000677133300009518PeatlandAIQDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD*
Ga0116137_107253813300009549PeatlandIQDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD*
Ga0116132_1001521133300009646PeatlandQDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD*
Ga0116219_1038680123300009824Peatlands SoilDLVHAIQEYIRENNKSPRPFQWVARANTIIRKVRKYKWTLETGD*
Ga0116223_1042037513300009839Peatlands SoilSVRDLVHAIQEYIRENNKSPRPFQWVARANTIIRKVRKYKWTLETGD*
Ga0126384_1060455733300010046Tropical Forest SoilVRHYNRNSQPFQWVASASRIIRKVNKYRQGLETAD*
Ga0126378_1000223413300010361Tropical Forest SoilKAIQDYIQRYNRNPQPFRWIASASKIIRKVNKYKDTLETGD*
Ga0126379_1094902633300010366Tropical Forest SoilQDYIQHYNRNPQPFPWVASASKIIRKVNKYKETLETGD*
Ga0126379_1097390413300010366Tropical Forest SoilMTFKAIQDYIQHYNRNPQPFPWVASASKIIRKVNKYKETL
Ga0134128_1010300343300010373Terrestrial SoilHSVRELIKAIRDYIRHHNSSPRPFQWVASASQIIRKVSKYREILETGD*
Ga0134128_1053730133300010373Terrestrial SoilYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD*
Ga0134128_1089203223300010373Terrestrial SoilRHHNSSPRPFQWVASASQIIRKVSKYKEILETGD*
Ga0134128_1120055913300010373Terrestrial SoilAIRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD*
Ga0126381_10157603113300010376Tropical Forest SoilIQDYIQHYNRNPQPFQWVASASKIIRKVNKYKETLETGD*
Ga0126381_10257453113300010376Tropical Forest SoilSVRHLVHAIQDYIHENNKSPRPFQWVASANTIIRKVRKYKWTLETGD*
Ga0126381_10327795513300010376Tropical Forest SoilDYIRENNKHPRPFQWVASANTIIRKVRKYKWTLETAD*
Ga0126381_10374974213300010376Tropical Forest SoilDGYIQTYNQNPQPFRWVASASRIIRKVRKYKRTSETGH*
Ga0136449_10163270313300010379Peatlands SoilDYIRIYNNNPRPFQWVASASRIIRKVNKYRRTSETPD*
Ga0137392_1158083733300011269Vadose Zone SoilAIQDYIRLYNKNPRPFQWVASASRIIRKVNKYKGTSETGD*
Ga0137393_1032610723300011271Vadose Zone SoilAIHEYVQRYNRNPQPFHWVASASKIIRKVNKYKQTLETGDYGQARIDG*
Ga0137393_1112295823300011271Vadose Zone SoilIKAIHEYVQRYNRNPQPFHWVASASKIIRKVNKYKQTLETED*
Ga0137358_1027918113300012582Vadose Zone SoilLVQAIQEYVRENNKNPRPFQWVASANTIVRKVRKSKWTLETGD*
Ga0157306_1002127333300012912SoilTIHDYIRLYNKNPRRFHWVANASRIIRKVNKHKGISETGD*
Ga0137359_1177341113300012923Vadose Zone SoilVRELIKTIHDYIRLYNNNPQPFQWVASASRIIRKVNKYKETSETGD*
Ga0126369_1008182413300012971Tropical Forest SoilAIQDYIQHYNRNPQPFPWVASASKIIRKVNKYKETLETGD*
Ga0126369_1097698523300012971Tropical Forest SoilDLTKAIQDYIQRYNRNPQPFRWVASASKIIRKVNKYKDTLETGD*
Ga0126369_1139894913300012971Tropical Forest SoilIQDYIQRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD*
Ga0181524_1003308513300014155BogIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD*
Ga0181538_1024223913300014162BogRDLIKTIHDYIRHYNKNPRPFQWVASASRIIRKVSKYKGTSETED*
Ga0182018_1054743913300014489PalsaIHDYVRNYNRNPQPFHWVASASRIIRKVNRYKQTSETGD*
Ga0182024_10048160113300014501PermafrostAIQDYIRLYNKNPQPFQWIASASRIIRKVNKYKGISETGD*
Ga0182024_1287757223300014501PermafrostIQDYIRLYNKNPRPFHWVASASRIIRKVNKYKGISDTGD*
Ga0132258_1098361833300015371Arabidopsis RhizosphereVRDLIKAIRDYVRQYNRNPQPFQWVASASKIIRKINKYKETLETGD*
Ga0182040_1012358733300016387SoilELTKAIQDYIQRYNRNSQPFQWVASASKIIRKVNKYKETLETGD
Ga0182038_1002560613300016445SoilIQDYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETGD
Ga0187856_1001763143300017925PeatlandAIQDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD
Ga0187819_1000190313300017943Freshwater SedimentIHRYNRNPQPFQWIASASKIIRKVNKYKETLETGD
Ga0187817_1002710513300017955Freshwater SedimentIQDYIHRYNRNPQPFQWIASASKIIRKVNKYKETLETGD
Ga0187817_1041485323300017955Freshwater SedimentAIQDYIHRYNRNPQPFQWIASASKIIRKVNKYKETLETGD
Ga0187815_1006902113300018001Freshwater SedimentDYIRLYNKKPRPFQWIASASQIIRKVNKYKDTSETRD
Ga0187815_1028731713300018001Freshwater SedimentYLRQYNKNPQPFQWVASASRIIRKVNKYKEISETGD
Ga0187766_1119649013300018058Tropical PeatlandTKAIHEYIRIYNNKPRPFQWVASASRIIRKVNKYRQTSETAD
Ga0187770_1055753113300018090Tropical PeatlandDYIQRYNRDPQPFQWVASASKIIRKVNKYKETLETGD
Ga0190275_1001682943300018432SoilIKDYVRHYNRNPQPFQWVASASKIIRKVNKYKETLETGD
Ga0190275_1005766613300018432SoilTIKDYVRHYNRNPQPFQWVASASKIIRKVNKYKETLETGD
Ga0190270_1114494823300018469SoilWTIKDYVRHYNRNPQPFQWVASASKIIRKVNKYKETLETGD
Ga0210403_1078662923300020580SoilKAIQDYVQRYNRNPQPFQWVASASKIIRKVNKYKETLETGD
Ga0210401_1069318413300020583SoilLIKTIHDYIRHYNQNPRPFQWVASASRIIRKVRKYKGTSESGH
Ga0210405_1006474643300021171SoilKTIHDYIRLYNKNPRPFQWVASASRIIRKVNKYKETSETGD
Ga0213882_1026625313300021362Exposed RockKAIHDYIRFYNQNPQPFQWVASASRIIRKVRKYKEISDTED
Ga0213881_1006258413300021374Exposed RockTAIHDYIRVYNKNPQPFHWVASASRIIRKVRNYKETSDTGD
Ga0210383_1139578013300021407SoilKAIHDYIRHYNKNPRPFQWVASASRIIRKVSKYKGTSETGD
Ga0210402_1177062513300021478SoilKTIHDYIRLYNKNPRPFQWVASASRIIRKVNKYKGTSETAD
Ga0212123_1000096313300022557Iron-Sulfur Acid SpringIKDYVLHYNKNPQSFQWVATASKIIRKVNKYKETLETGD
Ga0212123_1045377713300022557Iron-Sulfur Acid SpringIHEYVQRYNRNPQPFHWVASASKIIRKVNKYKQTLETGD
Ga0224544_100391333300023250SoilEAIHDYVRNYNRNPQPFHWVASASRIIRKVNRYKQTSETGD
Ga0208821_1001093143300025432PeatlandKAIQDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD
Ga0208563_1001360143300025501PeatlandQDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD
Ga0207692_1047839813300025898Corn, Switchgrass And Miscanthus RhizosphereDLVKAIRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLERED
Ga0207663_1115690333300025916Corn, Switchgrass And Miscanthus RhizosphereMAIQNYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETED
Ga0207657_1076903623300025919Corn RhizosphereDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD
Ga0207652_1037878823300025921Corn RhizosphereKTIQDYIRLYNKNPRPFQWVASASRIIRKVNKYKGTSETGD
Ga0207679_1097664413300025945Corn RhizosphereKAIRDYIRIYNNDPHPFQWFSSASRIIRKVAKYRKSERAD
Ga0207667_1015592653300025949Corn RhizosphereIRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD
Ga0207639_1037552313300026041Corn RhizosphereIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD
Ga0207702_1017376823300026078Corn RhizosphereTAAIGDYIRTYNENPRPFQWIASASKIIRKVRKYKEISDA
Ga0209736_120559713300027660Forest SoilMHDLVRAVYDYVGNYNRKPQPWVASASRIIRKVNRYKETSETED
Ga0209580_1053126323300027842Surface SoilKAIRDYVRQYNKNPQPFQWVASASKIIRKVNKYKETLETGD
Ga0209169_1008253113300027879SoilRSVRNLVHAIHDYVRHYNRNPQPFHWVASASRIVRKVNAYKQTSETAD
Ga0209380_1001098963300027889SoilDYVRHYNRNPRPFHWVASASRIVRKVNAYKQTSETAD
Ga0209624_1041564813300027895Forest SoilIRTYNYNPRPFHWVASASRIIRKINKYRRTSETAD
Ga0209061_100149013300027968Surface SoilIHDYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD
Ga0209061_1002185323300027968Surface SoilHDYLKDYNENPRPFRWIASASQIIRKVNKYKAISETAD
Ga0209061_102537163300027968Surface SoilLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD
Ga0209061_104270613300027968Surface SoilDYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD
Ga0209061_110069313300027968Surface SoilRKDYNENPRPFRWIASASRIICKVNKYKAISETAD
Ga0265354_102589413300028016RhizosphereVRDLVLSIHDYVRNYNRNPRPFHWVASASRIIRKVNRYKDT
Ga0268266_1197930523300028379Switchgrass RhizosphereKAIRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD
Ga0308309_1055624813300028906SoilAIQNYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETED
Ga0311362_1032476213300029913BogATGIRTYNENPKPFQWVASASRIIRKVRKYKRTSESAD
Ga0311338_1024391943300030007PalsaKAIQDYIRLYNKNPQPFQWIASASRIIRKVNKYKGISETGD
Ga0272436_108255523300030523RockRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD
Ga0272436_110621333300030523RockYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD
Ga0272436_112177033300030523RockDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD
Ga0272436_116629913300030523RockIRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD
Ga0310039_1031635513300030706Peatlands SoilKEIHDYIRIYNNNPRPFQWVASASRIIRKVNKYRRTSETPD
Ga0307920_10365313300030716SoilIQDYIQCYNRNPRPFQWVASASKIIRKVNKYKETLETGD
Ga0272422_101488113300031452RockAIRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD
Ga0272422_103069053300031452RockKAIRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD
Ga0272422_119429423300031452RockRVRDLIKAIRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD
Ga0272428_1003931213300031520RockYIRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD
Ga0272428_101739853300031520RockDLIKAIRDYISDHNNSPRPFQWVASASQIIRKVSKYKGILETGD
Ga0272428_102416213300031520RockIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD
Ga0307374_1000113013300031670SoilKAIQDYIQCYNRNPRPFQWVASASKIIRKVNKYKETLETGD
Ga0307374_1049434833300031670SoilAIQDYIQCYNRNPRPFQWVASASKIIRKVNKYKETLETGD
Ga0318572_1077719113300031681SoilKAIQDYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETGD
Ga0310686_10146893413300031708SoilKTIHDYIRLYNKNPRPFQWVASASRIIRKVNKYKDISETGD
Ga0318501_1054096623300031736SoilTKAIQDYIQGYNRNPQPFQWVASASKIIRKVNKYKETLETGD
Ga0307475_1128919313300031754Hardwood Forest SoilAIQNYLQPYNRNPQPFQWVASASKIIRKVNKYKETLETED
Ga0308174_1118798733300031939SoilRELIKAIRDYIRHHNSSPRPFQWVASASQIIRKVSKYKEILETGA
Ga0310912_1007831213300031941SoilAIQDYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETGD
Ga0306926_1160655713300031954SoilTFRSVRELIRAIKDYVRIYTKNPQPFQCVATANQIAWKVNKYKETLEKGD
Ga0307479_1008376913300031962Hardwood Forest SoilMAIQNYLQRYNRNPQPFQWVASASKIIRKVNKYKETLETED
Ga0318533_1098347433300032059SoilIQHYNQNPKPFQWVASASKIIRKVNKYKETLETGD
Ga0306924_1018625913300032076SoilQDYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETGD
Ga0311301_1241499713300032160Peatlands SoilLIQAINDYIRLYNKKPRPFQWIASASQIIRKVNKYKDTSETGD
Ga0307472_10214127513300032205Hardwood Forest SoilKTIHDYIRIYNKNPRPFQWVASASRIIRKVNKYKETSETVD
Ga0335078_1138720613300032805SoilTAIQDYIRLYNKNPRPFQWVASASRIIRKVSKYKGISDTGD
Ga0310914_1021116433300033289SoilDYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETED
Ga0372943_0247430_1003_11193300034268SoilNDYIRHYNKNPRPFHWVASASQIIRKVRKYKEISDTAD
Ga0372943_0587592_1_1263300034268SoilTAIHDYIRLYNKNPQPFRWVASASRIIRKVHKYKEISDTGD
Ga0372943_1234067_380_4993300034268SoilIKDYVRQYNKNPQPFQWIASASKIIRKVNKYKETLETGD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.