NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045329

Metagenome / Metatranscriptome Family F045329

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045329
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 43 residues
Representative Sequence MNKKFIIAWIVLFVAWFMGSFVVHGVLLHSDYMQLTSLFRAE
Number of Associated Samples 139
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.74 %
% of genes near scaffold ends (potentially truncated) 85.62 %
% of genes from short scaffolds (< 2000 bps) 79.74 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.856 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.686 % of family members)
Environment Ontology (ENVO) Unclassified
(32.680 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.294 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 42.86%    β-sheet: 0.00%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF04828GFA 6.54
PF10604Polyketide_cyc2 3.92
PF12697Abhydrolase_6 2.61
PF02900LigB 1.96
PF13207AAA_17 1.96
PF12804NTP_transf_3 1.96
PF09996DUF2237 1.96
PF02687FtsX 1.96
PF00756Esterase 1.31
PF01569PAP2 1.31
PF00903Glyoxalase 1.31
PF01850PIN 1.31
PF00563EAL 1.31
PF00990GGDEF 1.31
PF14534DUF4440 1.31
PF13520AA_permease_2 1.31
PF07298NnrU 1.31
PF07883Cupin_2 1.31
PF13676TIR_2 1.31
PF01425Amidase 1.31
PF03401TctC 0.65
PF13561adh_short_C2 0.65
PF01979Amidohydro_1 0.65
PF04273BLH_phosphatase 0.65
PF08281Sigma70_r4_2 0.65
PF12695Abhydrolase_5 0.65
PF12680SnoaL_2 0.65
PF01596Methyltransf_3 0.65
PF11578DUF3237 0.65
PF00155Aminotran_1_2 0.65
PF10370DUF2437 0.65
PF01546Peptidase_M20 0.65
PF01738DLH 0.65
PF00156Pribosyltran 0.65
PF03060NMO 0.65
PF02633Creatininase 0.65
PF13302Acetyltransf_3 0.65
PF04972BON 0.65
PF08327AHSA1 0.65
PF00208ELFV_dehydrog 0.65
PF02630SCO1-SenC 0.65
PF00589Phage_integrase 0.65
PF07969Amidohydro_3 0.65
PF01594AI-2E_transport 0.65
PF13751DDE_Tnp_1_6 0.65
PF01726LexA_DNA_bind 0.65
PF13469Sulfotransfer_3 0.65
PF07804HipA_C 0.65
PF01625PMSR 0.65
PF02574S-methyl_trans 0.65
PF04116FA_hydroxylase 0.65
PF00361Proton_antipo_M 0.65
PF00724Oxidored_FMN 0.65
PF05960DUF885 0.65
PF01592NifU_N 0.65
PF08530PepX_C 0.65
PF01810LysE 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG3791Uncharacterized conserved proteinFunction unknown [S] 6.54
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.31
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 1.31
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 1.31
COG4094Uncharacterized membrane proteinFunction unknown [S] 1.31
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 1.31
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 1.31
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.65
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.65
COG0334Glutamate dehydrogenase/leucine dehydrogenaseAmino acid transport and metabolism [E] 0.65
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.65
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.65
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.65
COG0822Fe-S cluster assembly scaffold protein IscU, NifU familyPosttranslational modification, protein turnover, chaperones [O] 0.65
COG1225PeroxiredoxinPosttranslational modification, protein turnover, chaperones [O] 0.65
COG1402Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)Coenzyme transport and metabolism [H] 0.65
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 0.65
COG1999Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC familyPosttranslational modification, protein turnover, chaperones [O] 0.65
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.65
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.65
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.65
COG2902NAD-specific glutamate dehydrogenaseAmino acid transport and metabolism [E] 0.65
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.65
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.65
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.65
COG3453Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 familyGeneral function prediction only [R] 0.65
COG3550Serine/threonine protein kinase HipA, toxin component of the HipAB toxin-antitoxin moduleSignal transduction mechanisms [T] 0.65
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.65
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.65
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.86 %
UnclassifiedrootN/A26.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0747113All Organisms → cellular organisms → Bacteria → Proteobacteria37915Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104329974All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300000546|LJNas_1013674All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria865Open in IMG/M
3300003369|JGI24140J50213_10109567All Organisms → cellular organisms → Bacteria → Proteobacteria908Open in IMG/M
3300003885|Ga0063294_10869512All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria524Open in IMG/M
3300005437|Ga0070710_10865196All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae650Open in IMG/M
3300005447|Ga0066689_10625613All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium678Open in IMG/M
3300005454|Ga0066687_10623888All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005471|Ga0070698_100218107All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales1842Open in IMG/M
3300005530|Ga0070679_100861398All Organisms → cellular organisms → Bacteria → Proteobacteria849Open in IMG/M
3300005543|Ga0070672_101973805All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Luteimonas → Luteimonas mephitis525Open in IMG/M
3300005554|Ga0066661_10261614All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1070Open in IMG/M
3300005556|Ga0066707_10539275All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005556|Ga0066707_10993139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria512Open in IMG/M
3300005564|Ga0070664_100917474All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300005574|Ga0066694_10623187All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005598|Ga0066706_10356635All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300005598|Ga0066706_10371911All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300006050|Ga0075028_100761806All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria587Open in IMG/M
3300006903|Ga0075426_10805901All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300007076|Ga0075435_101122107Not Available687Open in IMG/M
3300009029|Ga0066793_10066304All Organisms → cellular organisms → Bacteria2062Open in IMG/M
3300009789|Ga0126307_10774980All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium774Open in IMG/M
3300009804|Ga0105063_1045365All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300010333|Ga0134080_10377315All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium651Open in IMG/M
3300010361|Ga0126378_12736569All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300010362|Ga0126377_12981758Not Available546Open in IMG/M
3300010400|Ga0134122_11270689Not Available742Open in IMG/M
3300011270|Ga0137391_10274833All Organisms → cellular organisms → Bacteria → Proteobacteria1457Open in IMG/M
3300011271|Ga0137393_11790581All Organisms → cellular organisms → Bacteria → Proteobacteria502Open in IMG/M
3300012185|Ga0136619_10332939All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria576Open in IMG/M
3300012203|Ga0137399_11084766All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300012204|Ga0137374_11304157All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012210|Ga0137378_10319756All Organisms → cellular organisms → Bacteria → Proteobacteria1443Open in IMG/M
3300012211|Ga0137377_10069166All Organisms → cellular organisms → Bacteria → Proteobacteria3304Open in IMG/M
3300012211|Ga0137377_10852074All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium844Open in IMG/M
3300012350|Ga0137372_10281185All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. A 2881296Open in IMG/M
3300012350|Ga0137372_10868640All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium643Open in IMG/M
3300012363|Ga0137390_11285502All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium678Open in IMG/M
3300012582|Ga0137358_10538864All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300012685|Ga0137397_10023805All Organisms → cellular organisms → Bacteria → Proteobacteria4327Open in IMG/M
3300012917|Ga0137395_10853938All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium659Open in IMG/M
3300012922|Ga0137394_11583305All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012922|Ga0137394_11628787All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012927|Ga0137416_11816846All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium557Open in IMG/M
3300012929|Ga0137404_10054513All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3078Open in IMG/M
3300012944|Ga0137410_11180499All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300013296|Ga0157374_10835573All Organisms → cellular organisms → Bacteria → Proteobacteria938Open in IMG/M
3300014166|Ga0134079_10446449All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria612Open in IMG/M
3300014326|Ga0157380_10449664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Caldovatus → Caldovatus aquaticus1237Open in IMG/M
3300014501|Ga0182024_11602803All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300014866|Ga0180090_1061873All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris656Open in IMG/M
3300015264|Ga0137403_10479058All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300015357|Ga0134072_10318808All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium586Open in IMG/M
3300015373|Ga0132257_103775663Not Available551Open in IMG/M
3300015374|Ga0132255_104905946Not Available567Open in IMG/M
3300017792|Ga0163161_10203101All Organisms → cellular organisms → Bacteria1528Open in IMG/M
3300017947|Ga0187785_10172757All Organisms → cellular organisms → Bacteria → Proteobacteria923Open in IMG/M
3300017975|Ga0187782_11163463Not Available603Open in IMG/M
3300018079|Ga0184627_10146639Not Available1251Open in IMG/M
3300020170|Ga0179594_10191553All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300020582|Ga0210395_11258979All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300021180|Ga0210396_10300469All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1421Open in IMG/M
3300021181|Ga0210388_10568943All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium992Open in IMG/M
3300021401|Ga0210393_10335301All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300021406|Ga0210386_10753570Not Available838Open in IMG/M
3300021413|Ga0193750_1057923All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium791Open in IMG/M
3300021432|Ga0210384_10086345All Organisms → cellular organisms → Bacteria2820Open in IMG/M
3300021478|Ga0210402_10952610Not Available785Open in IMG/M
3300021560|Ga0126371_11960059All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300021560|Ga0126371_13471210Not Available532Open in IMG/M
3300022553|Ga0212124_10262599All Organisms → cellular organisms → Bacteria → Proteobacteria923Open in IMG/M
3300023261|Ga0247796_1103684All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300025899|Ga0207642_11127639All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300025903|Ga0207680_10406938Not Available962Open in IMG/M
3300025906|Ga0207699_10015781All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3933Open in IMG/M
3300025916|Ga0207663_10438292All Organisms → cellular organisms → Bacteria → Proteobacteria1006Open in IMG/M
3300025926|Ga0207659_11216027All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300025928|Ga0207700_10783732All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae852Open in IMG/M
3300025938|Ga0207704_10590366Not Available908Open in IMG/M
3300025972|Ga0207668_10784906All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300026118|Ga0207675_100703608All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300026315|Ga0209686_1226451All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300026529|Ga0209806_1342868All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300026538|Ga0209056_10413249All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. A 288815Open in IMG/M
3300026557|Ga0179587_10920678All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300027548|Ga0209523_1071956All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300027648|Ga0209420_1030715All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300027667|Ga0209009_1152551All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300027831|Ga0209797_10128606All Organisms → cellular organisms → Bacteria → Proteobacteria1096Open in IMG/M
3300027846|Ga0209180_10312574All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300027879|Ga0209169_10609427All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium570Open in IMG/M
3300027880|Ga0209481_10089629All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300028145|Ga0247663_1108558All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → unclassified Gallionellaceae → Gallionellaceae bacterium511Open in IMG/M
3300028536|Ga0137415_10282718All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E101464Open in IMG/M
3300028600|Ga0265303_10627186All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium873Open in IMG/M
3300028747|Ga0302219_10328712Not Available596Open in IMG/M
3300028775|Ga0302231_10032860All Organisms → cellular organisms → Bacteria → Proteobacteria2224Open in IMG/M
3300029910|Ga0311369_11522716All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300029951|Ga0311371_11014596All Organisms → cellular organisms → Bacteria → Proteobacteria985Open in IMG/M
3300029997|Ga0302302_1150124All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300029999|Ga0311339_10814099All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300030740|Ga0265460_12469939All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium553Open in IMG/M
3300030743|Ga0265461_12225096All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300030841|Ga0075384_11233044All Organisms → cellular organisms → Bacteria → Proteobacteria642Open in IMG/M
3300031128|Ga0170823_15365811All Organisms → cellular organisms → Bacteria → Proteobacteria687Open in IMG/M
3300031234|Ga0302325_10662283All Organisms → cellular organisms → Bacteria1516Open in IMG/M
3300031234|Ga0302325_12451480All Organisms → cellular organisms → Bacteria → Proteobacteria624Open in IMG/M
3300031236|Ga0302324_101340060All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300031236|Ga0302324_102731368All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300031344|Ga0265316_10770125Not Available676Open in IMG/M
3300031712|Ga0265342_10655454All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300031715|Ga0307476_10994543All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300031716|Ga0310813_10173819All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1749Open in IMG/M
3300031719|Ga0306917_10117473Not Available1933Open in IMG/M
3300031740|Ga0307468_100056619Not Available2088Open in IMG/M
3300031769|Ga0318526_10420126All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031772|Ga0315288_11229932Not Available643Open in IMG/M
3300031823|Ga0307478_11442328All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium571Open in IMG/M
3300031997|Ga0315278_10673364Not Available1054Open in IMG/M
3300032001|Ga0306922_12298347All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium517Open in IMG/M
3300032052|Ga0318506_10408057All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium602Open in IMG/M
3300032174|Ga0307470_10002616All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales6872Open in IMG/M
3300032180|Ga0307471_100028520All Organisms → cellular organisms → Bacteria → Proteobacteria4250Open in IMG/M
3300032180|Ga0307471_100597987All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1262Open in IMG/M
3300032180|Ga0307471_102367864All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300032205|Ga0307472_100711353All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300032205|Ga0307472_101247992All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300032261|Ga0306920_100881565All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300032828|Ga0335080_11288971All Organisms → cellular organisms → Bacteria → Proteobacteria730Open in IMG/M
3300032897|Ga0335071_10366558Not Available1394Open in IMG/M
3300033480|Ga0316620_12604375Not Available503Open in IMG/M
3300034163|Ga0370515_0095081All Organisms → cellular organisms → Bacteria → Proteobacteria1287Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.19%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.19%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.96%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.31%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.31%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.31%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.31%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.31%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.31%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.31%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.31%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.65%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.65%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.65%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents0.65%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.65%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.65%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.65%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.65%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.65%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.65%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.65%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.65%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.65%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.65%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.65%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000546Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300003369Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22AEnvironmentalOpen in IMG/M
3300003885Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012185Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06)EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022553Powell_combined assemblyEnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300024521 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
NODE_0747113173300000156Sugar Cane Bagasse Incubating BioreactorMSKRFFLAWLVLFIAWFIGSFVVHGVLLHADYAQLSNLFRKESE
INPhiseqgaiiFebDRAFT_10432997423300000364SoilMNKRLFIAWLVIFVVWFAGSFVVHGTLLHDDYAKLTGLFRTERE
LJNas_101367413300000546Quercus RhizosphereMGKKFIIAWIVLFVTWFLGDFVVHAVLLRSDYMQLTNLFRTEGDEQK
P5cmW16_104685013300001664PermafrostMSRKFFIAWIVIFIAWIDGSYVVHGFLLNDDYIKSSGLFRSEAEAHPYFPIMVLAHVI
JGI24140J50213_1010956713300003369Arctic Peat SoilMSKKFFIAWVVIFIVWFAGSFVVHGVLLHDDYAKSASLFRTEADSQSY
Ga0063294_1086951213300003885Hydrothermal VentsMNKKFFISWAIVFVAWMAGSFVVHGVLLADGYASLQNLFRSEENSQ
Ga0055466_1013435623300003997Natural And Restored WetlandsVNRKFFIAWIVVFIAYMAGGFVVHHALLSQDYMALPSLFRAEADAKPIFYLM
Ga0070682_10029565113300005337Corn RhizosphereMNKTFFIAWVVIFVAWFAGSFVVHGTLLHDDYMKLSGLFRPAAEAQPYFPLMV
Ga0070710_1086519623300005437Corn, Switchgrass And Miscanthus RhizosphereMNKKFFIAWIVLFIAWFLGSFVVHGVLLHDDYARLTNLFRPEAEAQHY
Ga0066689_1062561323300005447SoilMNKNLIIAWIVLFFAWFIGSFVVHGVLLHSDYLQLTSLFRA
Ga0066687_1062388813300005454SoilMNRSFVIAWVVLFVAWYIGSFVVHGVLLHADYARLARLFRSPEEAT
Ga0070698_10021810743300005471Corn, Switchgrass And Miscanthus RhizosphereMNKKFFIAWIVLFIAWFLGSFVVHGVLLHDDYARLTNLFRPEAE
Ga0070679_10086139823300005530Corn RhizosphereMDKKFFIAWVAIFVAWMAGSFVVHGMLLHDDYAKLSGLFRPEA
Ga0070672_10197380513300005543Miscanthus RhizosphereMDKKFIIAWIVIFVACFLGGFIVHGLLLHSDYMQIANLFRPETDQA
Ga0066661_1026161413300005554SoilMNKKFFIAWIVLFIAWFIGSFVVHGVLLHDDYARLTNLFRPEAEAQHYF
Ga0066707_1053927533300005556SoilMNKKFFIAWIVIFIAWMAGSFVVHATLLHDDYAKLTNLFRSE
Ga0066707_1099313923300005556SoilMDKKFIIAWIVIFIVWFAGSFVVHGVLLHDDYSKLTNLFR
Ga0068855_10097378833300005563Corn RhizosphereMNKKFFIAWVAIFVAWMAGSFVVHGMLLHDDYAKLSGLFRPEAEAQSYFPL
Ga0070664_10091747423300005564Corn RhizosphereMNKKFFIAWVAIFVAWMAGSFVVHGMLLHDDYAKLSG
Ga0066694_1062318723300005574SoilMNKRFALAWLILFVAWFLGSFVVHGVLLHGDYMQLKNLFRTEAESQNFFP
Ga0066706_1035663533300005598SoilMDKKFIIAWIVIFIVWFAGSFVVHGVLLHDDYSKLTNLFRSEADAQKYMPL
Ga0066706_1037191133300005598SoilMNKRFALAWLVLFVAWFLGSFVVHGVLLHGDYMQLKNLFRT
Ga0075028_10076180613300006050WatershedsMNKKFLIAWAVLFVAWFIGSFIVHGVLLRADYMQLTSLF
Ga0075018_1077734623300006172WatershedsMDRKTLFAWIAVFVLWMVGSFVVHGVVLHEDYMRLQNLFRPEAEAGKFFPLMI
Ga0075426_1080590123300006903Populus RhizosphereMNKRFLLAWLVLFVAWFIGSFIVHGLLLHADYAQLSNLFRKEA
Ga0075435_10112210713300007076Populus RhizosphereMNKRFLIAWLVLFIAWFCGSFVVHDVLLHADYAAMPNLMRKEADMQYFFP
Ga0066710_10287567823300009012Grasslands SoilMNKKLIIAWIVIFVACLCGSFVVHGVLLYDEFVRLSNLFRPVAVAQQYFPLLIIDVVIIAGDLDW
Ga0066793_1006630413300009029Prmafrost SoilMNKKFFIAWIVVFVAWMAGSFVVHGVLLHDDYLRLPN
Ga0105248_1235930223300009177Switchgrass RhizosphereMNKTFFIAWIVIFVAWFAGSFVVHGTLLHDDYMKLSGLFRPAAEAQPYF
Ga0105237_1001815913300009545Corn RhizosphereMNKTFFIAWVVIFFAWFAGSFVVHGTLLHDDYMKLSGLFRPAAEAQPYFPLMVLAHII
Ga0126307_1077498023300009789Serpentine SoilMSIQFFIAWASTFVAWMAGSFVVHGVLLQEDYAKLQNLFRSPEEAKHYFAF
Ga0105063_104536513300009804Groundwater SandMNKRFLAAWLIVFIAWMVGSFIVHGTLLHNDYAALPKLFRSEANAQRF
Ga0134080_1037731523300010333Grasslands SoilMNKKFIIAWIVLFVAWFVGSFVVHGVLLRSDYTQLTSLF
Ga0126378_1273656913300010361Tropical Forest SoilMSKKFFIAWIVIFVAWFAGSFVVHGQLLHDDYSKL
Ga0126377_1298175813300010362Tropical Forest SoilMNKKFVLAWVVVFLVWFFGSFVVHGLLLRADYMQLTSLF
Ga0134122_1127068913300010400Terrestrial SoilVNKKFFIAWIVMFIAYMAGGFIVHHVLLGQDYMALPNL
Ga0137391_1027483313300011270Vadose Zone SoilMNKKFFIAWIVLFIAWFLGSFVVHGVLLHDDYARLTNLFRPEAEAQ
Ga0137393_1179058113300011271Vadose Zone SoilMNKKLIIAWIVLFVAWFMGSFVVHGVLLHSDYLQLTNLFRAEDDQRKYF
Ga0137437_104126943300011442SoilMNKKFLIAWIVVFVAWMAGSFVVHGVLLHGDYAKLPGLFRPEAEAQAYF
Ga0136619_1033293913300012185Polar Desert SandMNKKFLIAWVVLFIASMAGDFLVHGVLLKPDYLQL
Ga0137399_1108476613300012203Vadose Zone SoilMNKRFALAWLVIFVAWFLGSFLVHAVLLHADYLAARDL
Ga0137374_1130415723300012204Vadose Zone SoilMNKKFFIAWIVIFVAWMAGSFVVHAVLLHDDYAKLSGLFRSEADAQTY
Ga0137378_1031975613300012210Vadose Zone SoilMSLWKETMSKQFIIAWIVVFVVWFAGSYVVHGVLLHEDYAK
Ga0137377_1006916643300012211Vadose Zone SoilMNKKFIITWIVLFVAWFVGSFVVHGVLLRSDYMQLTKLFRAEGDQQK
Ga0137377_1085207423300012211Vadose Zone SoilMNKKFFIAWIVVFIAWMAGSFVVHGVLLHDDYLSLPNLFRTE
Ga0137372_1028118543300012350Vadose Zone SoilMNKKFVIAWIVIFIAWMAGSFVVHATLLHDDYAKLTNLFRS
Ga0137372_1086864023300012350Vadose Zone SoilMNKQYIIAWIVVFVVWFAGSYVVHGVLLHDDYSKLQGLFRPEAEARQ
Ga0137390_1128550223300012363Vadose Zone SoilMNKKFIIAWIAIFIVWFAGSFVVHGVLLHDDYAKLTNLF
Ga0150984_11891904313300012469Avena Fatua RhizosphereMNRRFLLTWIVVFVLWMAGSFLVHALLLHDDYAGLPNVFRPEAEAQKYF
Ga0137358_1053886413300012582Vadose Zone SoilMNKKLIIAWIVLFIAWFIGSFVVHGVLLHSDYMQLTSLFR
Ga0136614_1120874213300012684Polar Desert SandMGKRFFINWIILFVLWMLGSFVVHGLLLHDDYARLPNLFR
Ga0137397_1002380513300012685Vadose Zone SoilMNKRFFLAWLVLFIAWFIGSFIVHGVLLHADYAALSNLFRKESEAQNF
Ga0137395_1085393823300012917Vadose Zone SoilMNKKFFIAWIVLFIAWFVGSFVVHGVLLHDDYARLTNLFRPEAEAQ
Ga0137394_1158330523300012922Vadose Zone SoilMNKRFLMAWLVVFIAWFIGSFVVHGVLLHDDYMAAK
Ga0137394_1162878713300012922Vadose Zone SoilMNKKLIIAWIVLFIAWFIGSFVVHGVLLHSDYMQLTNLFRAEGD
Ga0137416_1181684613300012927Vadose Zone SoilMNKKLIIAWIVLFFAWFIGSFVVHGVLLHSDYLQLTSLFRAEQDQQKY
Ga0137404_1005451343300012929Vadose Zone SoilMNKKFVIAWIVLLIAWFVGSFVVHGVLLRSYSMQLTN
Ga0137410_1118049913300012944Vadose Zone SoilMNKKLIIAWIVLFVAWFMGSFVVHGVLLHSGYMQLT
Ga0157374_1083557333300013296Miscanthus RhizosphereMDKKFFIAWVAIFVAWMAGSFVVHGMLLHDDYAKLSGLFRPEAEAQ
Ga0134079_1044644923300014166Grasslands SoilMNKRFIIAWMVLFVAWFVGSFVVHGVLLRSDYVQLTSLFRAAGDQQKYF
Ga0157380_1044966413300014326Switchgrass RhizosphereMNKRFFIAWIVLFVAWFAGSFVVHGLLLGGDYKAL
Ga0157380_1341684813300014326Switchgrass RhizosphereMNKTFFIAWIVIFVAWFAGSFVVHGTLLHDDYMKLSGLFRPAAEAQPYFPLMVL
Ga0182024_1160280323300014501PermafrostMNRKLIVAWVVVFIAWFMGSFVVHGVLLHADYMQVPTLFRMNDDA
Ga0180090_106187313300014866SoilMDRRFFIAWVVLFVAWMAGSFLVHGTLLHTDYSQL
Ga0137403_1047905823300015264Vadose Zone SoilMNKKFIIAWIGLFVAWLLGDFVVHAVLLHSDYMQLPNLYRT*
Ga0137403_1149433013300015264Vadose Zone SoilMNKKFIIAWIVIFVAWFAGSFVVHGVLLHDDYSKLSNLFRTEAESQQYFPLMV
Ga0134072_1031880823300015357Grasslands SoilMSKKFLVAWIVLFVAWFIGSFIVHGVLLHADYAQLSNLFRKE
Ga0132257_10377566323300015373Arabidopsis RhizosphereMNKRFLLAWLIVFVLWMIGSFLIHGLALHADYEAVQNLFRTPAE
Ga0132255_10490594623300015374Arabidopsis RhizosphereMNKRFFIGWLVIFIAWFIGSFVVHGLLLHNDYAALGNLF
Ga0163161_1020310113300017792Switchgrass RhizosphereMNKTFFIAWIVIFVAWFAGSFVVHGTLLHDDYMKLFGLFRPA
Ga0187785_1017275713300017947Tropical PeatlandMDKRFFIAWIVIFVAWFAGSFVVHGVLLHDDYAKLTSLFRSEAESQPF
Ga0187782_1116346323300017975Tropical PeatlandMNKKFGIAWIVVFIVWFLGDFIVHGVLLSADYMQLSSLYRPASDAQR
Ga0184627_1014663913300018079Groundwater SedimentMNKKFIISWLVVFVAWMVGSFVVHGVLLHDDYAKLPGLFRPETEAQQ
Ga0193733_115245023300020022SoilMNKKFFIAWIVVFVAWMAGSFVVHGVLLHDDYLRLSNLFRTEADAQRYF
Ga0179594_1019155323300020170Vadose Zone SoilMNKKFVIAWIVLLIAWFAGSFVVHGVLLRSDYMQLTNLFRV
Ga0210395_1125897923300020582SoilMNKKFIIAWIVLFVAWFMGSFVVHGVLLQPDYMQL
Ga0210396_1030046923300021180SoilMNKKFLIAWVVLFIAWFIGSFVVHGVLLSADYMQLTS
Ga0210388_1056894323300021181SoilMNKKFLIAWVVLFIAWFIGSFVVHGVLLSADYMQLTSL
Ga0210393_1033530133300021401SoilMNKKFLFAWIVLFVAWFLGSFVVHGVLLRSDYMQLTNLFR
Ga0210386_1075357013300021406SoilMNKKLIIAWIVLFVAWFMGSFVVHGVLLRPDYMQLTNLFRTEGDEQQH
Ga0193750_105792313300021413SoilMNKKFFIAWIVLFIAWFLGSFVVHGVLLHDDYARLTN
Ga0210384_1008634533300021432SoilVNRKFFIAWIVLFVAWFIGSFIVHGVLLHSDYLQLTGLFRT
Ga0210402_1095261013300021478SoilMNKKFVIGWVVIFIAWFLGSFVVHGMLLHSDYMQVHT
Ga0126371_1196005913300021560Tropical Forest SoilMNKFLLAWIVIFICWFAGSYVVHGVLLHDDYAKLTNLFRAP
Ga0126371_1347121013300021560Tropical Forest SoilVNKQFFIAWVVLFIAWFLGSYVVHGVLLHDDYSRLNNLFRSESESQVFF
Ga0212124_1026259933300022553FreshwaterMNKKFFIAWAVIFVAWMMGSFVVHATLLAADYAKLT
Ga0247796_110368423300023261SoilMNRKFFIAWIVLFVAWFAGSFVVHGLLLGGDYKALQGT
(restricted) Ga0255056_1026784323300024521SeawaterVNKKFLISWAVIFVAWMAGSFVVHGVLLQAGYAGLPNLFRPEEDAQKYFHLMLIAHVL
Ga0209584_1017911413300025878Arctic Peat SoilMSKKFFIAWVVIFIVWFAGSFVVHGVLLHDDYAKSASLFRTEADSQSYF
Ga0207642_1112763913300025899Miscanthus RhizosphereMNKTFFIAWVVIFVAWFAGSFVVHGTLLHDDYMKLSGLFRP
Ga0207680_1040693823300025903Switchgrass RhizosphereMDKKFIIAWIVIFVACFLGGFIVHGLLLHSDYMQI
Ga0207699_1001578193300025906Corn, Switchgrass And Miscanthus RhizosphereMDKKFFIAWVAIFVAWMAGSFVVHGMLLHDDYAKLSG
Ga0207663_1043829213300025916Corn, Switchgrass And Miscanthus RhizosphereMNKKFVIAWIVLFVAWFMGSFIVHGLLLHSAYMQLTDLFRPE
Ga0207659_1121602723300025926Miscanthus RhizosphereMNRRFFIAWIVLFVAWFAGSFVVHGLLLGGDYKALQGTLFRTEEDS
Ga0207700_1078373233300025928Corn, Switchgrass And Miscanthus RhizosphereMDKKFFIAWVVIFVAWMAGSFVVHGVLLHDDYTKLSGLFR
Ga0207704_1059036623300025938Miscanthus RhizosphereMNKKFLIAWLVMFVLYFAFGFIVHGVLLHDDYVAT
Ga0207668_1078490633300025972Switchgrass RhizosphereMNRRFFIAWIVLFVAWFAGSFVVHGMLLGNDYKALQGQLFRTE
Ga0207675_10070360833300026118Switchgrass RhizosphereMNKRFFIAWIVLFVAWFAGSFVVHGLLLGGDYKPLQGTLFRTEAD
Ga0209686_122645113300026315SoilMSKRFFLAWLVVFIAWFIGSFIVHGVLLHADYSQLSTLF
Ga0209806_134286823300026529SoilMSKRFFLAWLVVFIAWFIGSFIVHGVLLHADYAQLSNLFRKE
Ga0209056_1041324913300026538SoilMNKKLIIAWIVIFVAWMCGSFVVHGVLLHDEYARLTNLFRPEADAQKY
Ga0179587_1092067813300026557Vadose Zone SoilMSKKFIIAWIVLFVAWLLGDFVVHGVLLRSDYMQLTNLF
Ga0209523_107195623300027548Forest SoilVNKKLIIAWIVIFVAWFLGSFLVHGVLLNADYTRLGGTLFRTPA
Ga0209420_103071533300027648Forest SoilMNKKLIIAWIVLFIAWFVGSFVVHGMLLRTDYMQL
Ga0209009_115255113300027667Forest SoilMNKKFIVAWLVLFVAWFMGSFVVHGLLLRSDYMQLPNLFRAEGEE
Ga0209797_1012860623300027831Wetland SedimentMDKKFFIAWAVVFVTWMLGSFLVHGVLLHDDYAKLQ
Ga0209180_1031257423300027846Vadose Zone SoilMNKKLIIAWIVLFIAWFIGSFVVHGVLLHSDYMQLTNLFRAE
Ga0209169_1060942723300027879SoilVNRKFIIAWIVILVAWFLGSFLVHGVLLGADYKALGALFRT
Ga0209481_1008962913300027880Populus RhizosphereMDRRFFIAWVVLFVAWMAGSFVVHELLLHADYTQLSSLFRPE
Ga0247663_110855813300028145SoilMNKKLIIAWIVIFVAWLMGSFVIHGVLLRPDYMQLTGLFRSD
Ga0268264_1023045713300028381Switchgrass RhizosphereMNKTFFIAWVVIFFAWFAGSFVVHGTLLHDDYMKLSGLFRPAAEAQPYFPLMVLA
Ga0137415_1028271833300028536Vadose Zone SoilMNNKLIVAWLVVFVAWFIGSFIVHGVLLHSDYLQLTSLFRTEADE
Ga0247820_1003600273300028597SoilMSRKFFIAWVVLFVAWMAGSVVVHGMLLHTDYAKLTATIMRPEA
Ga0265303_1062718613300028600SedimentMNKGFFLSWVVVFIVWMAGSFVVHGVWLNDAYAQLPDLFRTETETQEK
Ga0302219_1032871213300028747PalsaMNKKFILAWVVLFVAWFMGSFVVHGLLLHSDYMLLTSLFRTESDAHSYF
Ga0302231_1003286013300028775PalsaMNKKFVVAWIVLLVAWFLGSFVVHGVLLHSDYMQLPNLFRAEDVA
Ga0311369_1152271613300029910PalsaMNKKFIIAWIVLFVVWFLGSFVVHGVLLRSDYMQLTNLFRTEG
Ga0311371_1101459613300029951PalsaMNKKFIIAWIVVLVAWFLGSFVVHAVLLRADYMQLTTLFRAEGD
Ga0302302_115012423300029997PalsaMNRKLIVAWVVVFIAWFMGSFVVHGVLLHADYMQVPTLF
Ga0311339_1081409913300029999PalsaMNKRFLFAWIGVFIVWFIGSFVVHGVLLHDDYMQLP
Ga0265460_1246993923300030740SoilMNKKFLIAWLVLFVAWFLGSFVVHGVLLHSDYMQMSQLFRPESDQT
Ga0265461_1222509613300030743SoilMNKKLIIAWAVLFVAWLMGSFVVHGVLLRSDYMQLTNLF
Ga0075384_1123304413300030841SoilMNKKFVMAWIVLFVAWFMGSFIVHGLLLRSAYMQLTDLFRPEGE
Ga0170823_1536581113300031128Forest SoilMNKKFVIAWIVLFVAWFMGSFIVHGLLLHSAYMQLTDLFR
Ga0302325_1066228313300031234PalsaMNKKFVVAWIVLFVAWFLGSFVVHGVLLHSDYMQLPNLFRAEDVARKYFP
Ga0302325_1245148023300031234PalsaMNKKFAVAWLVLFVAWFLGSFAVHGILLRSDYMQLTNLFR
Ga0302324_10134006023300031236PalsaMNKKFIIAWVVLFVAWFVGSFVVHGVLLHGDYMQLTNLFRPESEQQTYFP
Ga0302324_10273136823300031236PalsaMNKKFIIAWIVLFIAWFTGSFVVHGVLLSSDYMQLT
Ga0265316_1077012513300031344RhizosphereMNKKFFLAWLVVFIVWFLGSFVVHGVLLDADYMKLTSLFRTKA
Ga0265342_1065545413300031712RhizosphereMNKKLMIAWIVLFVAWFLGSFVVHGLLLRSDYMQLTS
Ga0307476_1099454323300031715Hardwood Forest SoilMNKKFLVAWVVLFVAWFIGSFVVHGVLLRADYMQLTNLF
Ga0310813_1017381923300031716SoilMNKTLGLAWLAVFVVWFIGSFVVHGLLLHADYMQLQGLFR
Ga0306917_1011747313300031719SoilMNKFLMAWIVIFICWFAGSYAVHGVLLQDDYAKLTN
Ga0307468_10005661913300031740Hardwood Forest SoilMNKKFFIAWVVIFIVWFAGSFVVHGVLLHDDYAKLQATGLFRTEAESQQFFPI
Ga0318526_1042012613300031769SoilMSKKFLIAWIVIFVAWFAGSFVVHGQLLHDDYSRLTNLFR
Ga0315288_1122993213300031772SedimentMSKKFIVAWVITFVAWMFGSFVVHGLLLGADYARLSN
Ga0307478_1144232813300031823Hardwood Forest SoilLNKKFFIAWIVLFVAWFIGSFIVHGVLLGPDYMHLNNLFR
Ga0307479_1085547923300031962Hardwood Forest SoilMDRKMIIAWIVLFFAWFVGSFVVHGVLLHSDYSQLTNLFRPEAEAQQYFP
Ga0315278_1067336413300031997SedimentMKGKFFLGWVVVFVVWMAGSFVVHEKLLHADYAGLP
Ga0306922_1229834723300032001SoilMNKFLMAWIVIFICWFAGSYAVHGVLLQDDYAKLTNLFR
Ga0318506_1040805713300032052SoilMNKFLLAWIVVFVCWFAGSYVVHGVLLNDDYAKLTNLF
Ga0307470_1000261613300032174Hardwood Forest SoilMNKKFIIAWIVLFVAWFMGSFVVHGVLLHSDYMQLTSLFRAE
Ga0307471_10002852073300032180Hardwood Forest SoilVNKKLIIAWIVIFVAWFLGSFVVHGVLLNADYTRLGGT
Ga0307471_10059798713300032180Hardwood Forest SoilMNKRFALAWLAIFIAWFIGSYVVHQVLLHEDYMAAKTLFRPEAE
Ga0307471_10236786423300032180Hardwood Forest SoilMNKKLIIAWIVIFIAWFAGSFVVHGVLLHDDYMKLPTLFRPEADAQ
Ga0307472_10060686133300032205Hardwood Forest SoilMNRKFFVAWVVIFIVWFLGSYVVHGLLLHDDYMKLQSLFRPQDEAHQLFPLMILAHLLLSGSFV
Ga0307472_10071135313300032205Hardwood Forest SoilMNRKFVIAWIVIFVAWFLGSFVVHGVLLSADYTRLGGLFRAPADS
Ga0307472_10124799213300032205Hardwood Forest SoilMNKKFLIAWLVIFVLWMIGGFVVHGTLLSADYEAMGN
Ga0306920_10088156533300032261SoilMSKKFLIAWIVIFVAWFAGSFVVHGQLLHDDYSRLTNLFRKEADSQQFFP
Ga0335080_1128897113300032828SoilMNTKFLAAWIVLFVAWFLGSFVVHGVLLGPDYARLSNLF
Ga0335071_1036655833300032897SoilMNRRFFTGWVVVFVAWMMGSFVVHGVLLREDYAQL
Ga0316620_1260437513300033480SoilMIRKFAIAWVLVFVVWMAGSFVVHATLLHDDYARLQTMFRT
Ga0370515_0095081_2_1123300034163Untreated Peat SoilMNKKFIIAWIVLFVAWFLGSFVVHGVLLQPDYMQLTN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.