NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045629

Metagenome / Metatranscriptome Family F045629

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045629
Family Type Metagenome / Metatranscriptome
Number of Sequences 152
Average Sequence Length 38 residues
Representative Sequence VLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLEKF
Number of Associated Samples 132
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 89.47 %
% of genes near scaffold ends (potentially truncated) 99.34 %
% of genes from short scaffolds (< 2000 bps) 92.11 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.447 % of family members)
Environment Ontology (ENVO) Unclassified
(26.974 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.684 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.38%    β-sheet: 20.31%    Coil/Unstructured: 70.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF00977His_biosynth 82.89
PF00117GATase 9.21
PF00475IGPD 3.29
PF01502PRA-CH 0.66
PF00815Histidinol_dh 0.66
PF15780ASH 0.66
PF08029HisG_C 0.66
PF00213OSCP 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG0131Imidazoleglycerol phosphate dehydratase HisBAmino acid transport and metabolism [E] 3.29
COG0040ATP phosphoribosyltransferaseAmino acid transport and metabolism [E] 0.66
COG0139Phosphoribosyl-AMP cyclohydrolaseAmino acid transport and metabolism [E] 0.66
COG0141Histidinol dehydrogenaseAmino acid transport and metabolism [E] 0.66
COG0712FoF1-type ATP synthase, delta subunitEnergy production and conversion [C] 0.66

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02FQTADAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300000955|JGI1027J12803_109005000All Organisms → cellular organisms → Bacteria1893Open in IMG/M
3300002245|JGIcombinedJ26739_101444995All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300003988|Ga0055475_10036653All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300004091|Ga0062387_100800653All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005332|Ga0066388_100122565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3126Open in IMG/M
3300005340|Ga0070689_101776883All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005434|Ga0070709_10149671All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300005539|Ga0068853_102439003All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005555|Ga0066692_10089645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1803Open in IMG/M
3300005569|Ga0066705_10452828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae804Open in IMG/M
3300005591|Ga0070761_10989503All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005712|Ga0070764_10489327All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300005993|Ga0080027_10356229All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006800|Ga0066660_10202726All Organisms → cellular organisms → Bacteria1515Open in IMG/M
3300006854|Ga0075425_100992246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300006854|Ga0075425_101102076All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300006893|Ga0073928_10771738All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300007258|Ga0099793_10203582All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300009089|Ga0099828_10523727All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300009617|Ga0116123_1022130All Organisms → cellular organisms → Bacteria2014Open in IMG/M
3300010043|Ga0126380_10181915All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300010043|Ga0126380_11056147All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300010043|Ga0126380_12151568All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300010358|Ga0126370_11019901All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300010360|Ga0126372_10121413All Organisms → cellular organisms → Bacteria2020Open in IMG/M
3300010366|Ga0126379_12412647All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300011269|Ga0137392_10865813All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300011270|Ga0137391_10670016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300011271|Ga0137393_10765906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300012096|Ga0137389_10354945All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300012189|Ga0137388_11670675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300012203|Ga0137399_10068882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2647Open in IMG/M
3300012207|Ga0137381_10720989All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium866Open in IMG/M
3300012210|Ga0137378_10954306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300012582|Ga0137358_10141159All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1639Open in IMG/M
3300012683|Ga0137398_10299867All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300012685|Ga0137397_10070515All Organisms → cellular organisms → Bacteria2528Open in IMG/M
3300012917|Ga0137395_11025555All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012923|Ga0137359_10047030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3748Open in IMG/M
3300012944|Ga0137410_11613578All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300012955|Ga0164298_11700516All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300012971|Ga0126369_10208579All Organisms → cellular organisms → Bacteria1890Open in IMG/M
3300015241|Ga0137418_10797110All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula709Open in IMG/M
3300015242|Ga0137412_10152620All Organisms → cellular organisms → Bacteria1862Open in IMG/M
3300016357|Ga0182032_11525619All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300016387|Ga0182040_11078394All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300016730|Ga0181515_1334261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300017942|Ga0187808_10561900All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300017943|Ga0187819_10216052All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300017946|Ga0187879_10749617All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300017955|Ga0187817_10129132All Organisms → cellular organisms → Bacteria1601Open in IMG/M
3300017975|Ga0187782_10538403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300017975|Ga0187782_11661573All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300017999|Ga0187767_10021417All Organisms → cellular organisms → Bacteria1402Open in IMG/M
3300018006|Ga0187804_10316669All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300018006|Ga0187804_10408953All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300018015|Ga0187866_1161776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium860Open in IMG/M
3300018047|Ga0187859_10257616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium938Open in IMG/M
3300018088|Ga0187771_11572743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300019789|Ga0137408_1252065All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300020581|Ga0210399_10253729All Organisms → cellular organisms → Bacteria1467Open in IMG/M
3300020581|Ga0210399_10412764All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300020583|Ga0210401_11426609All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300021046|Ga0215015_10683020All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300021086|Ga0179596_10382109All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300021170|Ga0210400_10022935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4857Open in IMG/M
3300021180|Ga0210396_10276060All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300021180|Ga0210396_10376434All Organisms → cellular organisms → Bacteria → Acidobacteria1250Open in IMG/M
3300021180|Ga0210396_10575641All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300021181|Ga0210388_10531704All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300021181|Ga0210388_11465972All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300021401|Ga0210393_10617189All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300021420|Ga0210394_11613166All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300021479|Ga0210410_10950855All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300021479|Ga0210410_11662380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300024179|Ga0247695_1052074All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300024182|Ga0247669_1018766All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300025898|Ga0207692_11220629All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300025916|Ga0207663_11138074All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300025938|Ga0207704_10211088All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300025939|Ga0207665_11029465All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300025939|Ga0207665_11270739All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300026089|Ga0207648_11850541All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300026296|Ga0209235_1193119All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300026322|Ga0209687_1271021All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300026325|Ga0209152_10166655All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300026328|Ga0209802_1195164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium787Open in IMG/M
3300026333|Ga0209158_1237702All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300026342|Ga0209057_1015914All Organisms → cellular organisms → Bacteria → Acidobacteria4419Open in IMG/M
3300026532|Ga0209160_1138154All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300026557|Ga0179587_10874188All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300026869|Ga0207821_1005109All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300026909|Ga0207858_1016410All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300027000|Ga0207803_1019236All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300027061|Ga0209729_1029970All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300027107|Ga0208367_107462All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300027587|Ga0209220_1122793All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300027587|Ga0209220_1126112All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300027610|Ga0209528_1026622All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300027625|Ga0208044_1011237All Organisms → cellular organisms → Bacteria3421Open in IMG/M
3300027643|Ga0209076_1044230All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300027660|Ga0209736_1089494All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300027662|Ga0208565_1124108All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium765Open in IMG/M
3300027855|Ga0209693_10346247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300027855|Ga0209693_10496076All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300027884|Ga0209275_10111884All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300027903|Ga0209488_10571038All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300027903|Ga0209488_10926895All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300028536|Ga0137415_10169671All Organisms → cellular organisms → Bacteria2012Open in IMG/M
3300028746|Ga0302233_10196167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300028781|Ga0302223_10114880All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300028906|Ga0308309_11063403All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300030043|Ga0302306_10209128All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300030659|Ga0316363_10240541All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300031231|Ga0170824_128359116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300031236|Ga0302324_100060854All Organisms → cellular organisms → Bacteria6694Open in IMG/M
3300031564|Ga0318573_10126233All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300031573|Ga0310915_11135080All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300031708|Ga0310686_101967402All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300031719|Ga0306917_11483860All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300031720|Ga0307469_11588413All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300031740|Ga0307468_101388101All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300031768|Ga0318509_10362760All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300031820|Ga0307473_10380607All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300031823|Ga0307478_10457767All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300031823|Ga0307478_11292793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300031832|Ga0318499_10343019All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300031879|Ga0306919_10675728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium796Open in IMG/M
3300031879|Ga0306919_11156224All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300031942|Ga0310916_10194242All Organisms → cellular organisms → Bacteria1696Open in IMG/M
3300031945|Ga0310913_11282083All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031962|Ga0307479_10709845All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300032001|Ga0306922_11877350All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300032041|Ga0318549_10377598All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300032059|Ga0318533_10129502All Organisms → cellular organisms → Bacteria1772Open in IMG/M
3300032076|Ga0306924_10083256All Organisms → cellular organisms → Bacteria → Acidobacteria3590Open in IMG/M
3300032091|Ga0318577_10099714All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300032091|Ga0318577_10393774All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300032160|Ga0311301_11602335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium792Open in IMG/M
3300032160|Ga0311301_12000602All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300032174|Ga0307470_11170596All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300032180|Ga0307471_100877808All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300032180|Ga0307471_101165552All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium935Open in IMG/M
3300032180|Ga0307471_101314532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium885Open in IMG/M
3300032205|Ga0307472_101430409All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300032892|Ga0335081_10873025All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300032893|Ga0335069_12380062All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300032954|Ga0335083_10384171All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300033405|Ga0326727_10568845All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300033561|Ga0371490_1092787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium811Open in IMG/M
3300033755|Ga0371489_0250837All Organisms → cellular organisms → Bacteria881Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.61%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.95%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.29%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.29%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.63%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.97%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.32%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.32%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.66%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.66%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.66%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.66%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.66%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.66%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.66%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003988Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026869Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes)EnvironmentalOpen in IMG/M
3300026909Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes)EnvironmentalOpen in IMG/M
3300027000Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027107Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF029 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_053733802170459005Grass SoilVLIPCIDLQAGQAVQLVRGRRLELAVADVFAQLEKFKRYPGCTSLISTP
JGI1027J12803_10900500043300000955SoilVLIPCIDLQAGQAVQLVHGRRRELSVADVFAQLEKF
JGIcombinedJ26739_10144499513300002245Forest SoilMMIPCIDLQSGRAVQLVHGRERRLAVDDVLGLLDRF
Ga0055475_1003665313300003988Natural And Restored WetlandsVIVACIDLQDGRAVQLVGGRRRALAVDDVFGLLDRFRRHRMLQ
Ga0062387_10080065313300004091Bog Forest SoilMLIPCIDLQGGQAVQLVHGRKRELVVKDVLGLLERFRGYEWL
Ga0066388_10012256553300005332Tropical Forest SoilVLIPCIDLQGGRAVQLVHGQRRELAVADVMGLLKRFGHHSWLHVI
Ga0070689_10177688313300005340Switchgrass RhizosphereVLIPCIDLQGGQAVQLVHGRRRELAVKDVFGLLDKFQKYDW
Ga0070709_1014967133300005434Corn, Switchgrass And Miscanthus RhizosphereMLIPCIDLQSGHAVQLVHGRRCELAVFDVFAQLEKFRRYKWLHIID
Ga0068853_10243900313300005539Corn RhizosphereVLIPCIDLQGGQAVQLVHGRRRELAVKDVFGLLDKFQKYDWLHI
Ga0066692_1008964543300005555SoilVLIPCIDLQSGQAVQLVRGQKRELAVVNVFGLLKKFK
Ga0066705_1045282823300005569SoilVLIPCIDLQDGQAVQLVRGRKRELAVADVFGLLHEFSKYTW
Ga0070761_1098950323300005591SoilVLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLEKF
Ga0070764_1048932713300005712SoilMIIPCIDLQNGEAVQLVRGRKRALSIHDVLGLLERF
Ga0080027_1035622913300005993Prmafrost SoilMLIPCIDLQGGQAVQLVHGRKRELVVGDVLGLLEKFKGY
Ga0066660_1020272633300006800SoilVLIPCIDLQDGQAVQLVHGRKRELAVADVFGLLKKF
Ga0075425_10099224623300006854Populus RhizosphereVLIPCIDLQSGQAVQLVHGRRRELAVPDVESQLEKFRRY
Ga0075425_10110207613300006854Populus RhizosphereLLIPCIDLQGGQAVQLVHGRKRELAVADVFAQLHKF
Ga0073928_1077173823300006893Iron-Sulfur Acid SpringVLIPCIDLQNGMAVQLIHGRKRELAIIDVLGVLEKFKDY
Ga0099793_1020358213300007258Vadose Zone SoilVLIPCIDLQEGKAVQLVHGRKRELAISDVMSLLLKFQK
Ga0099828_1052372713300009089Vadose Zone SoilMLIPCIDLQRGQAVQLVHGRKRALAVNDVLGLLDRFGHHKWL
Ga0116123_102213013300009617PeatlandMLIPCIDLQDGQAVQLAHGRKRELAVADVLGLLDRFGHY
Ga0126380_1018191513300010043Tropical Forest SoilVLIPCIDLQGGQAVQLVHGRRRELAVADVFGLLERFAKY
Ga0126380_1105614713300010043Tropical Forest SoilMLIPCIDLQAGQAVQLVHGRRRELAVADVFAQLEK
Ga0126380_1215156813300010043Tropical Forest SoilVLIPCIDLQGGQAVQLVHGRRRELAVADVFGLLEKFSAYEWLN
Ga0126370_1101990113300010358Tropical Forest SoilVLIPCIDLQDGQAVQLVHGRKRELAVSDVFGLLQK
Ga0126372_1012141343300010360Tropical Forest SoilVLIPCIDLQGGQAVQLVHGRRRELAVSDVFGLLERFGHHPWLNVI
Ga0126379_1241264713300010366Tropical Forest SoilVLIPCIDLQDGQAVQLVHGRKPELAVADVFGLLRKFAK
Ga0137392_1086581313300011269Vadose Zone SoilMLIPCIDLQSGRAVQLVHGRERRLAVKDVLSLLHRFGG
Ga0137391_1067001613300011270Vadose Zone SoilMLIPCIDLQGGQAVQLVHGRKRELAVSDVFGLLRKFKK
Ga0137393_1076590623300011271Vadose Zone SoilVLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLRK
Ga0137389_1035494513300012096Vadose Zone SoilVLIPCIDLLGGQAVQWVHGRKRELAVADVFGLLRKFK
Ga0137388_1167067523300012189Vadose Zone SoilVLIPCIDLQGGQAVQLVNGRKRELAVADVFGLLKKF
Ga0137399_1006888253300012203Vadose Zone SoilVLIPCIDLQDGQAVQLVHGRKRELAVTDVFGLLKKF
Ga0137381_1072098923300012207Vadose Zone SoilVLIPCIDLQGGQAVQLVHGRKRELAVADVFSLLRK
Ga0137378_1095430623300012210Vadose Zone SoilVLIPCIDLQDGHAVQLVHGQKRELAIANVFGLLGKFK
Ga0137358_1014115943300012582Vadose Zone SoilVLIPCIDLQGGQAVQLVHGKKRELAVADVFGLLEKFKS
Ga0137398_1029986713300012683Vadose Zone SoilVLIPCIDLQGGQAVQLVHGRRRELAVADVFGLLERFK
Ga0137397_1007051553300012685Vadose Zone SoilVLIPCIDVQGGQAVQLVHGRRRELAVSDVFGLLKKFGHHEWL
Ga0137395_1102555513300012917Vadose Zone SoilVLIPCIDLQQGQAVQLVHGRRRELAIADVMSLLLKFKKY
Ga0137359_1004703063300012923Vadose Zone SoilVLIPCIDLQGGQAVQLVHGKKRELAVADVFGLLQKFKS
Ga0137410_1161357823300012944Vadose Zone SoilMLIPCIDLQSGQAVQLVRGRRRELSVSDVNAQLHKF
Ga0164298_1170051613300012955SoilMMIPCIDLQDGRAVQLVHGRERKLAVDDVFGLLDRFGRYP
Ga0126369_1020857913300012971Tropical Forest SoilLQGGQAVQLVHGRKRELAVSDVFGLLRKFAKYPWLH
Ga0137418_1079711033300015241Vadose Zone SoilVLIPCIDLQGGQAVQLVHGRKRELAVADVFGVLEKFRNY
Ga0137412_1015262013300015242Vadose Zone SoilVLIPCIDLQNGQAVQLVHGRRRELAVADVFGLLEKFSHYKW
Ga0182032_1152561923300016357SoilMLIPCIDLQDGQAVQLLHGRKRELAVADVFGLLHKFRKYPW
Ga0182040_1107839423300016387SoilVLIPCIDLQGGQAVQLVRGRKRELAVADVLGLLDRFGRH
Ga0181515_133426113300016730PeatlandMLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDR
Ga0187808_1056190013300017942Freshwater SedimentMLIPCIDLQRGQAVQLVHGRKRELAVADVLGLLERF
Ga0187819_1021605223300017943Freshwater SedimentMMIPCIDLQDGRAVQLVHGRERKLAVDDVLGLLDRFG
Ga0187879_1074961723300017946PeatlandVLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDRFGHYAWLHV
Ga0187817_1012913213300017955Freshwater SedimentLLIPCIDLQRGKAVQLVHGRKRELAVADVLGLLERFS
Ga0187782_1053840313300017975Tropical PeatlandLLIPCIDLQDGQAVQLVRGRKRELAVADVLGLLERFGHYAWLH
Ga0187782_1166157323300017975Tropical PeatlandVLIPCIDLQNGVAVQLVHGRKKALEVEDVMSLLERFGRYSWLHV
Ga0187767_1002141733300017999Tropical PeatlandVLIPCIDLQHGQAVQLVQGRRRALAVADVMGLLDRFSS
Ga0187804_1031666923300018006Freshwater SedimentVLIPCIDLQGGQAVQLVHGRKRELAVVDVLGLLERFSRYE
Ga0187804_1040895323300018006Freshwater SedimentLLIPCIDLQRGKAVQLVHGRKRELAVADVLGLLQRFSQYEWLH
Ga0187866_116177623300018015PeatlandVLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDRFGHY
Ga0187859_1025761613300018047PeatlandVLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDRFSRYA
Ga0187771_1157274323300018088Tropical PeatlandIDLQGGKAVQLVRGRRRALAIDDVLGLLDRFRDYPISK
Ga0137408_125206513300019789Vadose Zone SoilMLIPCIDLQSGQAVQLVHGRRRELSVSDVNAQLHKFRHYK
Ga0210399_1025372913300020581SoilMLIPCIDLQAGQAVQLVHGRKRELAVADVFGLLEKFG
Ga0210399_1041276413300020581SoilVLIPCIDLQQGKAVQLVHGRKRELAIADVMSLLLRFKKYEWLH
Ga0210401_1142660913300020583SoilMLIPCIDLQSGQAVQLVHGRRRELAVSDVFGLLRKFGHN
Ga0215015_1068302013300021046SoilVLIPCIDLQDGQAVQLVHGTRRELDVADVFGLLRK
Ga0179596_1038210923300021086Vadose Zone SoilVLIPCIDLQSGQAVQLVRGQKRELAVVDVFGLLKKFKQY
Ga0210400_1002293513300021170SoilVLIPCIDLQRGKAVQLVHGRKRELAVADVMSLLLKFKKYEW
Ga0210396_1027606013300021180SoilVLIPCIDLQGGQAVQLVHGRRRELAVSDVFGLLEKFGHH
Ga0210396_1037643433300021180SoilMLIACIDLQGGQAVQLVHGRKRELAVKDVFGLLERFRG
Ga0210396_1057564113300021180SoilLIIPCIDLQDGRAVQLVRGRKLRLAVEDVFGLLDR
Ga0210388_1053170433300021181SoilMIIPCIDLQGGKAVQLVRGKRRVLAVDDVLGLLDRF
Ga0210388_1146597213300021181SoilVLIPCIDLQRRQAVQLVHGRKRELAVADVLGLLARFSRYEWLHVI
Ga0210393_1061718923300021401SoilVLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLERFKSYLW
Ga0210394_1161316623300021420SoilVLIPCIDLQGGQAVQLVHGRRRELVVADVFGLLDKFRNYPWLH
Ga0210410_1095085523300021479SoilVLIPCIDLEGGQAVQLVRGRKRELAVADVFGLLEQFQ
Ga0210410_1166238023300021479SoilMLIPCIDLQGGQAVQLVHGRKRELAVADVVGLLKKFK
Ga0247695_105207423300024179SoilVLIPCIDLLDGQAVQLVHGRRCELAVADVFKQLEKFK
Ga0247669_101876633300024182SoilVLIPCIDLQDGQAVQLVHGRRRELAVADVFGLLERF
Ga0207692_1122062923300025898Corn, Switchgrass And Miscanthus RhizosphereVLIPCIDLQGGQSVQLVHGRKRELAVADVFGLLEKF
Ga0207663_1113807413300025916Corn, Switchgrass And Miscanthus RhizosphereVLIPCIDLQNGQAVQLVHGRKRELAVADVFGLLERFK
Ga0207704_1021108833300025938Miscanthus RhizosphereVLIPCIDLQSGQAVQLVHGRRRELAVADVFAQLEKFKHYP
Ga0207665_1102946523300025939Corn, Switchgrass And Miscanthus RhizosphereVLIPCIDLQAGQAVQLVHGRRRELAVADVFGLLEKFREYSWLH
Ga0207665_1127073923300025939Corn, Switchgrass And Miscanthus RhizosphereMIPCIDLQSGRAVQLVHGRERRLAVDDVLGLLDRFGG
Ga0207648_1185054123300026089Miscanthus RhizosphereVLIPCIDLQAGQAVQLVRGRRLELAVADVFALSREV
Ga0209235_119311923300026296Grasslands SoilVIVPCIDLQGGKAVQLVRGRRRRLAVDDVLGLLDRF
Ga0209687_127102123300026322SoilVLIPCIDLQDGQAVQLVRGRKRELAVADVFGLLHEFSKY
Ga0209152_1016665523300026325SoilVIIPCIDLQAGRAVQLIRGRKLRLAVEDVFGLLDRFRDYSLL
Ga0209802_119516413300026328SoilVLIPCIDLQGGQAVQLVRGRKRELAVAAVFGLLRK
Ga0209158_123770213300026333SoilVLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLKKFKK
Ga0209057_101591413300026342SoilVLIPCIDLQGGQAVQLVRGRKRELAVAAVFGLLRKFKR
Ga0209160_113815413300026532SoilLLIPCIDLQSGQAVQLVHGRRRELAVPDVASQLRKFRRYRW
Ga0179587_1087418813300026557Vadose Zone SoilVLIPCIDLQSGEAVQLVRGRRRELAVSDVGAQLHAFRH
Ga0207821_100510913300026869Tropical Forest SoilMLIPCIDLQRGKAVQLVHGRRRELAVDDVMGLLDRFSGYEWLH
Ga0207858_101641023300026909Tropical Forest SoilMLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLDRFGQHRWLH
Ga0207803_101923623300027000Tropical Forest SoilMLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLDH
Ga0209729_102997023300027061Forest SoilMLIPCIDLQSGQAVQLVHGRRRELAVSDVNAQLHKFRRYQWLH
Ga0208367_10746213300027107Forest SoilVLIPCIDLQGGQAVQLVHGRRRELAVTDVFGLLKKFGHH
Ga0209220_112279323300027587Forest SoilVLIPCIDLQGGQAVQLVHGRKRELAVADVFGLLKK
Ga0209220_112611213300027587Forest SoilVLIPCIDLQQGKAVQLVHGKKRELAIADVMSLLLK
Ga0209528_102662233300027610Forest SoilVLIPCIDLQQGRAVQLVHGRKRELAIADVMSLLLRF
Ga0208044_101123713300027625Peatlands SoilVLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDRF
Ga0209076_104423013300027643Vadose Zone SoilVLIPCIDLQDGQAVQLVHGRKRELAVADVFGLLKKFKKYPWL
Ga0209736_108949423300027660Forest SoilMLIPCIDLQNGMAVQLIHGRKRELAISDVLGVLEKFKNYEW
Ga0208565_112410813300027662Peatlands SoilMLIPCIDLQDGQAVQLVHGRKREFAVADVLGLLDRFGHYAWL
Ga0209693_1034624713300027855SoilVLIPCIDLQGGQAVQLVQGHKLELAVADVFGLLRKFK
Ga0209693_1049607623300027855SoilVLIPCIDLQDGQAVQLVHGRRRELAVADVFGLLEKFS
Ga0209275_1011188413300027884SoilVLIPCIDLQRGQAVQLVHGRKRELAVADVFGLLEKFKS
Ga0209488_1057103813300027903Vadose Zone SoilVLIPCIDLQQGQAVQLVHGRRRELAIADVMSVLLKFKK
Ga0209488_1092689513300027903Vadose Zone SoilVLIPCIDLQQGQAVQLVHGRRRELAIADVMSLLLK
Ga0137415_1016967143300028536Vadose Zone SoilVLIPCIDLQDGQAVQLVHGRKRELAVADVFGLLEKFKK
Ga0302233_1019616723300028746PalsaVLIPCIDLQNSRAVQLIHGRRKALEVEDVTGLLHKFRRYSW
Ga0302223_1011488023300028781PalsaMLVPCIDLQDGRAVQLVHGRKRRLAVDDVLGLVARFSVY
Ga0308309_1106340323300028906SoilMLIPCIDLQDGRAVQLVHGRERKLAVEDVFGLLDRF
Ga0302306_1020912823300030043PalsaVLIPCIDLQNSRAVQLIHGRRKALEVEDVTGLLHKFRR
Ga0316363_1024054123300030659Peatlands SoilMMIPCIDLQDGRAVQLVHGRERKLAVDDVFGLLDRFG
Ga0170824_12835911623300031231Forest SoilMMIPCIDLQDGRAVQLIHGRERKLAVDDVFGLLDRFG
Ga0302324_10006085413300031236PalsaVIVPCIDLQGGRAVQLVRGQRLALSVDDVLGLLER
Ga0318573_1012623333300031564SoilVLIPCIDLQDGQAVQLVHGRRRELAVGDVFGQLHK
Ga0310915_1113508013300031573SoilMLIPCIDLQRGQAVQLVHGRRRELAVADVLGLHRRFSHYRWLH
Ga0310686_10196740213300031708SoilMLIPCIDLQDGRAVQLVHGRERKLAVDDVFGLLDRFGGY
Ga0306917_1148386023300031719SoilMLIPCIDLQGGQAVQLVHGRKRELAVTDVLGLLDRFGHHRWLHV
Ga0307469_1158841323300031720Hardwood Forest SoilVIIPCIDLQGGRAVQLVHGRKLRLAVEDVFGLLDRFR
Ga0307468_10138810123300031740Hardwood Forest SoilVLIPCIDLQGGQAVQLIHGRRRELAVSDVFGLLNKFGHHEWLHVI
Ga0318509_1036276013300031768SoilVLIPCIDLQGGQAVQLVRGRKRELAVADVLGLLDRFGRHHWLH
Ga0307473_1038060713300031820Hardwood Forest SoilLLIPCIDLQSGQAVQLVHGRRRELAVSDVASQLEKF
Ga0307478_1045776723300031823Hardwood Forest SoilVLIPCIDLQGGQAVQLVHGRRRELAVSDVFGLLKKFGRHEWLHVI
Ga0307478_1129279313300031823Hardwood Forest SoilVLIPCIDLQGGQAVQLVHGRKRELAVADVFGQLEKFKSYEW
Ga0318499_1034301923300031832SoilVLIPCIDLQGGQAVQLVRGRKRELAVADVLGLLDRFGRHRWLHVI
Ga0306919_1067572813300031879SoilMLIPCIDLQSGQVVQLVRGRRRELALPDVFAQLDR
Ga0306919_1115622423300031879SoilMLIPCIDLQDGQAVQLLHGRKPELAVADVFGLLHKFRKYPWL
Ga0310916_1019424243300031942SoilVLIPCIDLQGGRAVQLVHGRKRELAVADVFGLLDRFGRYGWL
Ga0310913_1128208313300031945SoilVLIPCIDLQRGQAVQLVHGRRRELAVSDVMGLVKRF
Ga0307479_1070984523300031962Hardwood Forest SoilMMIPCIDLQDGRAVQLVHGRERKLAVDDVIGLLDRFGR
Ga0306922_1187735023300032001SoilVLIPCIDLQGGQAVQLVHGRKRELAVADVLGLLGR
Ga0318549_1037759813300032041SoilLLIPCIDLQSGQAVQLVRGRRRELAVPDVFAQLDK
Ga0318533_1012950213300032059SoilMLIPCIDLQRGQAVQLVHGRRRELAVADVLGLLRRFSHYRW
Ga0306924_1008325613300032076SoilMLIPCIDLQGGQAVQLVHGRKRELAVTDVLGLLDRFGH
Ga0318577_1009971433300032091SoilVLIPCIDLQDGQAVQLVHGRRRELAVGDVFGLLHKVRSYP
Ga0318577_1039377423300032091SoilVLIPCIDLQSGQAVQLVHGRRCELAVADVFAQLERFKSY
Ga0311301_1160233513300032160Peatlands SoilVLIPCIDLQDGQAVQLVHGRKRELAVADVLGLLDRFG
Ga0311301_1200060223300032160Peatlands SoilVLIPCIDLQGGQAVQLVNGRRRELAVADVFGLLQRFEG
Ga0307470_1117059623300032174Hardwood Forest SoilVLIPCIDLQGGQAVQLVHGRRRELAVSDVFGLLKKFGHHKWL
Ga0307471_10087780833300032180Hardwood Forest SoilMLIPCIDLQSGQAVQLVHGRRRELAVSDVNAQLHKFRRYKWL
Ga0307471_10116555213300032180Hardwood Forest SoilMLIPCIDLQGGQAVQLVHGKKRELAVSDVFGLLRKFR
Ga0307471_10131453213300032180Hardwood Forest SoilVLIPCIDLQGGQAVQLVHGRRRELAVSDVFGLLEKFRSYPW
Ga0307472_10143040913300032205Hardwood Forest SoilVLIPCIDLQGGQAVQLVHGRRRELAVKDVFGLLDKFQIYKWLHII
Ga0335081_1087302513300032892SoilMLIPCIDLQSSQAVQLVHGRKRELAVSDVFSLLERF
Ga0335069_1238006213300032893SoilVLIPCIDLQDGQAVQLVHGRRRELAVADVMGLLERF
Ga0335083_1038417113300032954SoilMLIPCIDLQQGQAVQLVHGRKRELAIADVLGLLERFS
Ga0326727_1056884523300033405Peat SoilMLVPCIDLQDGRAVQLVHGRRLRLAVDDALGLVEKFSGYS
Ga0371490_109278723300033561Peat SoilVLIPCIDLQAGQAVQLVHGRKRELAVADVLGLLDR
Ga0371489_0250837_1_1143300033755Peat SoilMLVPCIDLQDGRAVQLVHGRRLRLAVDDALGLVEKFSG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.