NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045827

Metagenome / Metatranscriptome Family F045827

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045827
Family Type Metagenome / Metatranscriptome
Number of Sequences 152
Average Sequence Length 43 residues
Representative Sequence RMTEAQKGALSRETAEKVEQVEELNARSRKYNLPSASAPER
Number of Associated Samples 135
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.67 %
% of genes near scaffold ends (potentially truncated) 96.71 %
% of genes from short scaffolds (< 2000 bps) 92.76 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.737 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.842 % of family members)
Environment Ontology (ENVO) Unclassified
(34.211 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.526 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.13%    β-sheet: 0.00%    Coil/Unstructured: 60.87%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF00753Lactamase_B 3.95
PF01436NHL 1.97
PF13561adh_short_C2 1.32
PF01979Amidohydro_1 1.32
PF00135COesterase 1.32
PF00857Isochorismatase 1.32
PF00072Response_reg 0.66
PF00497SBP_bac_3 0.66
PF06441EHN 0.66
PF00196GerE 0.66
PF04199Cyclase 0.66
PF13432TPR_16 0.66
PF04392ABC_sub_bind 0.66
PF14832Tautomerase_3 0.66
PF00903Glyoxalase 0.66
PF02424ApbE 0.66
PF06707DUF1194 0.66
PF05199GMC_oxred_C 0.66
PF13360PQQ_2 0.66
PF08450SGL 0.66
PF08308PEGA 0.66
PF01909NTP_transf_2 0.66
PF01149Fapy_DNA_glyco 0.66
PF13714PEP_mutase 0.66
PF02668TauD 0.66
PF028725_nucleotid_C 0.66
PF01551Peptidase_M23 0.66
PF00296Bac_luciferase 0.66
PF03707MHYT 0.66
PF13673Acetyltransf_10 0.66
PF02452PemK_toxin 0.66
PF02310B12-binding 0.66
PF13751DDE_Tnp_1_6 0.66
PF12681Glyoxalase_2 0.66
PF13358DDE_3 0.66
PF01613Flavin_Reduct 0.66
PF02738MoCoBD_1 0.66
PF08241Methyltransf_11 0.66
PF13676TIR_2 0.66
PF12697Abhydrolase_6 0.66
PF13340DUF4096 0.66
PF00254FKBP_C 0.66
PF13442Cytochrome_CBB3 0.66
PF02899Phage_int_SAM_1 0.66
PF03928HbpS-like 0.66
PF13193AMP-binding_C 0.66
PF07366SnoaL 0.66
PF03466LysR_substrate 0.66
PF13924Lipocalin_5 0.66
PF14588YjgF_endoribonc 0.66
PF03734YkuD 0.66
PF00226DnaJ 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 1.32
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.32
COG2272Carboxylesterase type BLipid transport and metabolism [I] 1.32
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.66
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.66
COG07372',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase familyDefense mechanisms [V] 0.66
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.66
COG1477FAD:protein FMN transferase ApbEPosttranslational modification, protein turnover, chaperones [O] 0.66
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.66
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.66
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.66
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.66
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.66
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.66
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.66
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.66
COG3300MHYT domain, NO-binding membrane sensorSignal transduction mechanisms [T] 0.66
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.66
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.66
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.66
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.66
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.66

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.74 %
UnclassifiedrootN/A30.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001977|JGI24746J21847_1068977All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300003987|Ga0055471_10056193Not Available1077Open in IMG/M
3300004080|Ga0062385_11014238All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005177|Ga0066690_10479752All Organisms → cellular organisms → Bacteria → Proteobacteria839Open in IMG/M
3300005186|Ga0066676_10903593Not Available592Open in IMG/M
3300005332|Ga0066388_101444520All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1198Open in IMG/M
3300005332|Ga0066388_102233307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium988Open in IMG/M
3300005332|Ga0066388_105910548Not Available618Open in IMG/M
3300005364|Ga0070673_100513560All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1085Open in IMG/M
3300005444|Ga0070694_100667664Not Available843Open in IMG/M
3300005456|Ga0070678_101092488All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300005530|Ga0070679_101907137All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005542|Ga0070732_10050835Not Available2394Open in IMG/M
3300005554|Ga0066661_10686607All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300005556|Ga0066707_10103360Not Available1753Open in IMG/M
3300005556|Ga0066707_10256580All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300005559|Ga0066700_10697779All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300005578|Ga0068854_102017973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300005598|Ga0066706_10986885All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300005598|Ga0066706_11438711Not Available519Open in IMG/M
3300005843|Ga0068860_101054991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.831Open in IMG/M
3300006041|Ga0075023_100572267All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300006052|Ga0075029_100048040All Organisms → cellular organisms → Bacteria2466Open in IMG/M
3300006052|Ga0075029_100658701All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300006162|Ga0075030_100373340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1137Open in IMG/M
3300006237|Ga0097621_100194818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCD89291757Open in IMG/M
3300006237|Ga0097621_101971779Not Available558Open in IMG/M
3300006796|Ga0066665_11196706Not Available580Open in IMG/M
3300006854|Ga0075425_101036347All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium935Open in IMG/M
3300006881|Ga0068865_101148430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300007255|Ga0099791_10106160Not Available1295Open in IMG/M
3300009012|Ga0066710_100291962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2383Open in IMG/M
3300009012|Ga0066710_100729417All Organisms → cellular organisms → Bacteria → Acidobacteria1513Open in IMG/M
3300009012|Ga0066710_101758591All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300009089|Ga0099828_11061197All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300009094|Ga0111539_10906737All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_181025Open in IMG/M
3300009098|Ga0105245_13074474Not Available517Open in IMG/M
3300009156|Ga0111538_10605479All Organisms → cellular organisms → Bacteria → Acidobacteria1389Open in IMG/M
3300009176|Ga0105242_11606470All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300009520|Ga0116214_1315627All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300009792|Ga0126374_10239062Not Available1178Open in IMG/M
3300009824|Ga0116219_10071219All Organisms → cellular organisms → Bacteria → Proteobacteria2042Open in IMG/M
3300010043|Ga0126380_10382132Not Available1038Open in IMG/M
3300010304|Ga0134088_10001486All Organisms → cellular organisms → Bacteria → Acidobacteria9097Open in IMG/M
3300010304|Ga0134088_10261499Not Available833Open in IMG/M
3300010335|Ga0134063_10719007All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300010358|Ga0126370_11785338All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300010360|Ga0126372_10272643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1467Open in IMG/M
3300010361|Ga0126378_10341186All Organisms → cellular organisms → Bacteria1607Open in IMG/M
3300010362|Ga0126377_11022926All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300010362|Ga0126377_11642794All Organisms → cellular organisms → Bacteria → Proteobacteria717Open in IMG/M
3300010366|Ga0126379_13362929Not Available536Open in IMG/M
3300010398|Ga0126383_12247389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300010399|Ga0134127_10344329All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300010400|Ga0134122_11599212All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300010403|Ga0134123_11547366All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300011271|Ga0137393_10752602Not Available834Open in IMG/M
3300011397|Ga0137444_1031736All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300011416|Ga0137422_1132192Not Available589Open in IMG/M
3300011417|Ga0137326_1054579All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium873Open in IMG/M
3300011422|Ga0137425_1116141Not Available659Open in IMG/M
3300011430|Ga0137423_1008940All Organisms → cellular organisms → Bacteria3160Open in IMG/M
3300011435|Ga0137426_1132217Not Available723Open in IMG/M
3300011444|Ga0137463_1198547Not Available752Open in IMG/M
3300012134|Ga0137330_1046293All Organisms → cellular organisms → Bacteria → Proteobacteria573Open in IMG/M
3300012173|Ga0137327_1077713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300012189|Ga0137388_11411810All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300012199|Ga0137383_11039065Not Available596Open in IMG/M
3300012203|Ga0137399_11063447All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18681Open in IMG/M
3300012205|Ga0137362_11749220Not Available508Open in IMG/M
3300012206|Ga0137380_10474931All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300012207|Ga0137381_10718550All Organisms → cellular organisms → Bacteria → Acidobacteria868Open in IMG/M
3300012285|Ga0137370_10494419All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300012349|Ga0137387_10966619All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300012410|Ga0134060_1061984Not Available559Open in IMG/M
3300012486|Ga0157331_1037253Not Available511Open in IMG/M
3300012685|Ga0137397_10995385Not Available617Open in IMG/M
3300012900|Ga0157292_10172949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300012918|Ga0137396_10518468All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300012922|Ga0137394_10361706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.1238Open in IMG/M
3300012924|Ga0137413_11105963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300012930|Ga0137407_12431309All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300012944|Ga0137410_11486544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300013297|Ga0157378_13098004Not Available516Open in IMG/M
3300013306|Ga0163162_13274249All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300013308|Ga0157375_13298765Not Available538Open in IMG/M
3300014164|Ga0181532_10710084Not Available542Open in IMG/M
3300014657|Ga0181522_10892576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300014968|Ga0157379_11154034All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300014968|Ga0157379_12032530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales568Open in IMG/M
3300014969|Ga0157376_10453079All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300014969|Ga0157376_10813816All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300015254|Ga0180089_1070137All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300015371|Ga0132258_12454982All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300015371|Ga0132258_13141058Not Available1141Open in IMG/M
3300015374|Ga0132255_101306545All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1094Open in IMG/M
3300015374|Ga0132255_105613974All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300016270|Ga0182036_11694415Not Available534Open in IMG/M
3300016357|Ga0182032_10818754All Organisms → cellular organisms → Bacteria → Acidobacteria788Open in IMG/M
3300016445|Ga0182038_11350030Not Available638Open in IMG/M
3300017654|Ga0134069_1313488Not Available558Open in IMG/M
3300017659|Ga0134083_10605061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300017997|Ga0184610_1194433All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300018052|Ga0184638_1266460All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300018466|Ga0190268_12325105All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300018482|Ga0066669_10590917All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium972Open in IMG/M
3300020034|Ga0193753_10334830All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300021081|Ga0210379_10146587All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300021082|Ga0210380_10208069Not Available885Open in IMG/M
3300021420|Ga0210394_11470970Not Available577Open in IMG/M
3300021445|Ga0182009_10841967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300025796|Ga0210113_1069480All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300025901|Ga0207688_10304573All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira975Open in IMG/M
3300025907|Ga0207645_11082256Not Available541Open in IMG/M
3300025916|Ga0207663_10610321All Organisms → cellular organisms → Bacteria → Acidobacteria858Open in IMG/M
3300025938|Ga0207704_10884810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300025960|Ga0207651_10448560Not Available1106Open in IMG/M
3300026088|Ga0207641_11258770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCD8929740Open in IMG/M
3300026121|Ga0207683_10636488All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium988Open in IMG/M
3300026297|Ga0209237_1039806All Organisms → cellular organisms → Bacteria2470Open in IMG/M
3300026320|Ga0209131_1021449All Organisms → cellular organisms → Bacteria3871Open in IMG/M
3300026320|Ga0209131_1291767All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300026507|Ga0257165_1007276Not Available1651Open in IMG/M
3300026557|Ga0179587_10791738All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300027490|Ga0209899_1115547All Organisms → cellular organisms → Bacteria → Proteobacteria502Open in IMG/M
3300027835|Ga0209515_10119726All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300027855|Ga0209693_10371360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300027898|Ga0209067_10839985Not Available537Open in IMG/M
3300028784|Ga0307282_10253844All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300028789|Ga0302232_10424407All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300028803|Ga0307281_10114875Not Available917Open in IMG/M
3300030058|Ga0302179_10336714All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300031232|Ga0302323_102833871All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300031538|Ga0310888_10985046All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031547|Ga0310887_10295343All Organisms → cellular organisms → Bacteria → Acidobacteria921Open in IMG/M
3300031573|Ga0310915_10914780All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300031715|Ga0307476_11071840Not Available592Open in IMG/M
3300031720|Ga0307469_11146053Not Available733Open in IMG/M
3300031720|Ga0307469_11991096Not Available564Open in IMG/M
3300031820|Ga0307473_10012265All Organisms → cellular organisms → Bacteria3174Open in IMG/M
3300031858|Ga0310892_10578103All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300031940|Ga0310901_10250209All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300032059|Ga0318533_10687852All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300032179|Ga0310889_10237446All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira858Open in IMG/M
3300032205|Ga0307472_101245377Not Available713Open in IMG/M
3300032515|Ga0348332_13628018All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300032893|Ga0335069_11150314All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300033289|Ga0310914_10311768All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300033412|Ga0310810_10380377All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1468Open in IMG/M
3300033433|Ga0326726_12407255Not Available511Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.84%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil6.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.95%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.63%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.97%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.97%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.32%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.32%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.32%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.32%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.32%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.32%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.32%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.66%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.66%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.66%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.66%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.66%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.66%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.66%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.66%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001977Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5Host-AssociatedOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011397Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012134Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012486Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027490Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027835Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24746J21847_106897723300001977Corn, Switchgrass And Miscanthus RhizosphereALVELKTTGHMTEAQKGALSRETSEKVEQVDELNARSRKYNLPSASAPER*
Ga0055471_1005619323300003987Natural And Restored WetlandsLKATGRMVEAQKGALNDATADKIEQVEELNARSVKYNLPRSSGREQR*
Ga0062385_1101423813300004080Bog Forest SoilELQSTGRMAEAQKGALGRATVEKVQRVEELNARSRKYNLPSGSGQER*
Ga0066690_1047975213300005177SoilLQATGQIAEAQKGTLSRAMSDKVEQVEELNARARKYNLPRGSAAER*
Ga0066676_1090359313300005186SoilKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER*
Ga0066388_10144452013300005332Tropical Forest SoilTGRMTEAQKGSLSREMSDKVEQVEELNARSRKYNLPRPSASER*
Ga0066388_10223330713300005332Tropical Forest SoilTGRMTEAQKGSLSREMSDKVEQVEELNARSRKYNLPRPSAPER*
Ga0066388_10591054813300005332Tropical Forest SoilTEAQKGALSRETTEKVEQVDALNARSRKYNLPSASTPER*
Ga0070673_10051356013300005364Switchgrass RhizosphereLQTTGVIPNAQKTALSRVTSDKVEQVEELNARSAKYNLPKGSATER*
Ga0070694_10066766423300005444Corn, Switchgrass And Miscanthus RhizosphereATGRMTEAQKGTLNRATTDKVEQVEELNQRSRKYNLPSASGPER*
Ga0070678_10109248823300005456Miscanthus RhizosphereDKALAELKATGRMVEAEKGAVSGATRDKVEQVEELNARARKYNLPIGTASGSGAKR*
Ga0070679_10190713713300005530Corn RhizosphereELKTTGQMTEAQKSALSRETAEKLEQVAQLNARSQKYHLPAASASER*
Ga0070732_1005083513300005542Surface SoilKTLAELKATGRMTEAQKGVLNPETSRKVQHVEELNARSRKYNLPGIGSTSER*
Ga0066661_1068660713300005554SoilELKATGQMTAAQKGALGRETAEKLEHVEELNARSRKYNLPRGSAPER*
Ga0066707_1010336013300005556SoilELKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPGGSAPERQ*
Ga0066707_1025658033300005556SoilELKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER*
Ga0066700_1069777923300005559SoilGRMTEAQKGALSREMSDKVEQVAELNARSRKYNLPSASAPER*
Ga0068854_10201797323300005578Corn RhizosphereHMTEAQKGALSRETSEKVEQVDELNARSRKYNLPSASAPER*
Ga0066706_1098688523300005598SoilTGRMTEAQKGALSREMSDKVEQVEELNARSRKYNLPPASAPER*
Ga0066706_1143871113300005598SoilTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER*
Ga0068860_10105499113300005843Switchgrass RhizosphereMIEAQKVALSRETAAKVEQAEELNVRSRRYNLPTASASER*
Ga0075023_10057226713300006041WatershedsKATGRSAEAQKTALGADTTRKVQRVDELNARSRKYNLPGSGSASER*
Ga0075029_10004804013300006052WatershedsTGRMTEAQKGALSPETAAKVEHVEELNARSRKYNLPIASTSER*
Ga0075029_10065870123300006052WatershedsLQATGQIAEAQKGALSRATVEKVERVEELNALSRKYNLPSASASER*
Ga0075030_10037334043300006162WatershedsELKATGRMTQAQRGALSRETSEKVERVEELNARSRKYNLPSPSASER*
Ga0097621_10019481823300006237Miscanthus RhizosphereTGRMTEAQKGSLSREMSDKVEQVAELNARSRKYNLPSASAPER*
Ga0097621_10197177923300006237Miscanthus RhizosphereEAQKGALSRETSDKVEQVAELNARSRKYNLPSASTPER*
Ga0066665_1119670613300006796SoilGSLSRETSAKVEQVEELNARSRKYNLPSASAPER*
Ga0075425_10103634713300006854Populus RhizosphereGSLSREMSDKVEQVEELNARSRKYNLPRPSAPER*
Ga0068865_10114843013300006881Miscanthus RhizosphereEAQKGALSRETSDKVEQVADLNARSRKYNLPSASAPER*
Ga0099791_1010616013300007255Vadose Zone SoilTGRMTEAQKGAVSRATRDKVEQVEELDARARKYNLPKAMASGSGAER*
Ga0066710_10029196243300009012Grasslands SoilLAELKATGRMTEAQKGAVSRATREKVEQVEELNARARKYNLPSGSGSER
Ga0066710_10072941733300009012Grasslands SoilTAAAKGALGRETAEKVVQVAELNARARKYNLPSASAPER
Ga0066710_10175859113300009012Grasslands SoilRALAELKATGRMTEAQKGAVSRAMREKVEQVEELDARARKYNLPRATATGSGAER
Ga0099828_1106119713300009089Vadose Zone SoilMTAAQKGALGRETAEKLEHVEELNARSRKYNLPRASAPER*
Ga0111539_1090673723300009094Populus RhizosphereMTEAQKGALSRETSEKVEQVDELNARSRKYNLPSASAPER*
Ga0105245_1307447413300009098Miscanthus RhizosphereQSLGRIESHGRMTEAQKGALSRETAAKVEQVEELNARSLKYNLPIASASER*
Ga0111538_1060547913300009156Populus RhizosphereKGALSRETADKVERVEELNARSRKYNLPTASAAERQP*
Ga0105242_1160647023300009176Miscanthus RhizosphereMAAAAKGALSREMSDKVEQDEQVNARSRKYNLRSTSAPER*
Ga0116214_131562723300009520Peatlands SoilMTEAQKGALGRATVEKVERVEELNARSRKYNLPSGSASER*
Ga0126374_1023906233300009792Tropical Forest SoilATGRMTDAQKGALNRATMEKVEQVDELNARARKYNLPSGSGSER*
Ga0116219_1007121913300009824Peatlands SoilKGALGRATVEKVERVEELNARSRKYNLPSGSASER*
Ga0126380_1038213223300010043Tropical Forest SoilMTEAQKGALNREMSDKVEQVAELNARSRKYNLPAASAPER*
Ga0134088_1000148613300010304Grasslands SoilLKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER*
Ga0134088_1026149913300010304Grasslands SoilLKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSGSAPERQ*
Ga0134063_1071900723300010335Grasslands SoilLVELKATGQMTAAGKASLSREMAAKVEQVEELNARSRKYNLPSASAPER*
Ga0126370_1178533823300010358Tropical Forest SoilKATGQMAVANRGALSRETSEKVEHVEELNARSRKYNLPSPSAPERQ*
Ga0126372_1027264313300010360Tropical Forest SoilELKGTGRMTEAQKGALSRETSRKVERVEELNARSRKYNLPSASAPER*
Ga0126378_1034118613300010361Tropical Forest SoilALAELKGTGRMTEAQKGALSRETSRKVERVEELNARSRKYNLPSASASER*
Ga0126377_1102292613300010362Tropical Forest SoilIDRALAELKATGRMVEAQKGAVSRATRDKVEQVEELNARARKYNLPVGTASGSGAER*
Ga0126377_1164279413300010362Tropical Forest SoilELKTTGRMAEAQKGALSEEISDKVEQVDELNTRSRKYNLPRASAPERP*
Ga0126379_1336292913300010366Tropical Forest SoilKGALNRATMEKVEQVEELNARSRKYNLPSGTASER*
Ga0126383_1224738933300010398Tropical Forest SoilLKATGRMTEAQKSALSPQTAAKVEQAEEVNARSRKYNLPIASASER*
Ga0134127_1034432953300010399Terrestrial SoilAEAQKGALGDAMSDKIEQVAELNARSAKYNLPKASAPERPNAK*
Ga0134122_1159921223300010400Terrestrial SoilGALSEEVSDKVEQVEELNTRSRKYNLPRASAPERP*
Ga0134123_1154736623300010403Terrestrial SoilLKTTGRMTEAQKGALSREMAAKVEQIEELNALSRKYNLPTASASER*
Ga0137393_1075260213300011271Vadose Zone SoilQKGALSRETSRKVERVEELNARSRKYNLPSASASER*
Ga0137444_103173613300011397SoilHMTAAAKGALGRETAEKVEQVEELNARSRKYNLPSASAPER*
Ga0137422_113219223300011416SoilEAQKGALSRETAAKVEQVEELNARSRKYNLPIASTSER*
Ga0137326_105457923300011417SoilTEAQKGALGRETAEKIEQVEELNARSRKYNLPSASAPER*
Ga0137425_111614123300011422SoilRMAEAQKGALSRETAEKIEQVEELNARSRKYNLPSASAPER*
Ga0137423_100894053300011430SoilELKATGRMTEAQKGALSRETAAKVEQVEDLNARSRKYNLPIASASER*
Ga0137426_113221723300011435SoilELKATGRMAEAQKGALSRETAAKVEQVEELNARSRKYNLPIASTSER*
Ga0137463_119854723300011444SoilMTEAQKGALNRETSEKVERVEELNTRARKYNLPAASSGPER*
Ga0137330_104629323300012134SoilGALGRETAEKVEQVEELNARSRKYNLPRASAPER*
Ga0137327_107771323300012173SoilELKATGRMTEAQKGALGRETAEKIEQVEELNARSRKYNLPSASAPER*
Ga0137388_1141181023300012189Vadose Zone SoilRMTEAQKGALSRETSRKVERVEELNARSRKYNLPIASASER*
Ga0137383_1103906513300012199Vadose Zone SoilAEKGSLSRETSAKVEQVEELNARSRKYSLPNASAPER*
Ga0137399_1106344713300012203Vadose Zone SoilKGALSQQMAAKVEQVEELNARSRKYNLPVASVSER*
Ga0137362_1174922013300012205Vadose Zone SoilTQKGALSRATVEKVERVEELNALSRKYNLPSASASER*
Ga0137380_1047493113300012206Vadose Zone SoilALAELKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER*
Ga0137381_1071855013300012207Vadose Zone SoilALTETLATGRMVEAQKGALNRETSEKVERVEELNARSRKYNLPAASGPER*
Ga0137370_1049441913300012285Vadose Zone SoilRMTEAQKGVLSRATLEKVERVEELNARSRKYNLPIASASER*
Ga0137387_1096661913300012349Vadose Zone SoilAGKGSLGRETAAKVEQVEELNARSRKYNLPSGSAPER*
Ga0134060_106198413300012410Grasslands SoilDKALAELKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER*
Ga0157331_103725323300012486SoilGALSRETSDKVEQVAELNARSRKYNLPSASTPER*
Ga0137397_1099538513300012685Vadose Zone SoilATGRMTEAQKGALNRATSEKVERVEELNARSRKYNLPAASGPER*
Ga0157292_1017294923300012900SoilRMTEAQKGALSRETTEKVEQVEALNARSRKYNLPSASAPER*
Ga0137396_1051846813300012918Vadose Zone SoilKATGQMTTAAKAALGRETAEKLEHVEELNARSRKYNLPRASAPER*
Ga0137394_1036170613300012922Vadose Zone SoilQKGALSRETTEKVEQVEELNARSRKYNLPSASAPER*
Ga0137413_1110596313300012924Vadose Zone SoilQTTGKIPEAQKGALSRQVSDKVEQVEEINARAKKYNLPVGSATER*
Ga0137407_1243130913300012930Vadose Zone SoilAELKATGRMADAQKGALNRATMEKVEQVEELNARSRKYNLPSGSASER*
Ga0137410_1148654423300012944Vadose Zone SoilETQKGALNRATVEKVERVEELNALSRKYNLPSGSAPER*
Ga0157378_1309800413300013297Miscanthus RhizosphereEAQKGALNRATSDKVEQVEELIARARKYNLPAASGPER*
Ga0163162_1327424913300013306Switchgrass RhizosphereKTALSRATSDKVEQVEELNARAAKYNLPKGSATER*
Ga0157375_1329876513300013308Miscanthus RhizosphereLATTGRMTEAQKGALNRATSDKVEQVEQLNGRARKYNLPSASGPER*
Ga0181532_1071008413300014164BogMTEAQKGALGRATVEKVERVEELNARSRKYNLPSASAPER*
Ga0181522_1089257623300014657BogATGGMAEAQKGALGRATAEKVERVEELNARSRKYNLPTASASER*
Ga0157379_1115403423300014968Switchgrass RhizosphereAIDKALAELKATGRMVEAEKGAVSGATRDKVEQVEELNARARKYNLPIGTASGSGAKR*
Ga0157379_1203253023300014968Switchgrass RhizosphereEAQKGALSREISDKVEQVEELNARAAKYNLPKGSATER*
Ga0157376_1045307913300014969Miscanthus RhizosphereELKTTGRMTEAQKGALSREMAAKVEQIEELNALSRKYNLPTASASER*
Ga0157376_1081381623300014969Miscanthus RhizosphereGRMTDAQKGALNRETTDKIEQVDELNARSRKYNLPSASAPER*
Ga0180089_107013733300015254SoilGRMIAAQKGALSRETSEKVEQVEELNARSRKYNLPSASAPER*
Ga0132258_1245498213300015371Arabidopsis RhizosphereQMTAAQKAALGRETSDKVEQVDELNARSKKYNLPTASAPER*
Ga0132258_1314105813300015371Arabidopsis RhizosphereELKATGRMTEAQKGAVSRATREKVEQVAELDARARKYNLPKATASGSGAER*
Ga0132255_10130654523300015374Arabidopsis RhizosphereMTDAQKGALNRATSDKVEQVDELNGRSRKYNLPSASGPER*
Ga0132255_10561397413300015374Arabidopsis RhizosphereMTEAQKGSLIREMSDNVEQVEELNARSRKYNLPRPSAPER*
Ga0182036_1169441513300016270SoilAQKGALSPDTSRKVQRVEELNARSRKYNLPGTGSTSER
Ga0182032_1081875413300016357SoilKALVELKGTGRMTEAQKGTLSRATVDKIEQVEELNARSRKYNLPSGSASER
Ga0182037_1080833113300016404SoilTTESAKGALSRETFAKLEQVEELNARSRKYHLPSGSASER
Ga0182038_1135003013300016445SoilGALSPDTSRKVQRVEELNARSRKYNLPGTGSTSER
Ga0134069_131348813300017654Grasslands SoilALAELKTTGQMTAAEKGALSRETSAKVEQVEELNARSRKYNLPSASAPER
Ga0134083_1060506113300017659Grasslands SoilKGALSREVSDKVEQVTELNARSRKYNLPSASAPERP
Ga0184610_119443323300017997Groundwater SedimentFAELKATGRMTEAQKGALSRETSEKIEHVEELNVRSRKYNLPRGSASERQ
Ga0184638_126646033300018052Groundwater SedimentMTEAQKGALSEEISDKVEQVEELNTRSRKYNLPRASAPERQ
Ga0190268_1232510523300018466SoilVELKATGRMVEAQKGALNDATADKIEQVEELNARSVKYNLPRSSGREQR
Ga0066669_1059091713300018482Grasslands SoilLVELKATGRMTEAQKGTLSREMTDKVEQVEELNARSRKYNLPRASAPER
Ga0193753_1033483013300020034SoilTTGKIADAQKGALSRQTSDKVEQVEELNARSRKYNLPSGSATER
Ga0210379_1014658723300021081Groundwater SedimentRMTEAQKGALSRETAEKVEQVEELNARSRKYNLPSASAPER
Ga0210380_1020806923300021082Groundwater SedimentGQMTAAAKGALGRETAEKVEQVAELNARARKYNLPSASAPER
Ga0210394_1147097023300021420SoilKGALSRDMSEKVEHVEELNARSRKYNLPRASAAER
Ga0182009_1084196723300021445SoilAQKGALDRATTEKVEQVEELNRRSRKYNLPSGSGPER
Ga0210113_106948013300025796Natural And Restored WetlandsMVEAQKGALNDATADKIEQVEELNARSVKYNLPRSSGREQR
Ga0207688_1030457313300025901Corn, Switchgrass And Miscanthus RhizosphereGRMTEAQKGALGRETAEKVEQVEELNARSRKYNLPSASAPER
Ga0207645_1108225613300025907Miscanthus RhizosphereTTGRMTEAQKGALNRATSDKVEQVEQLNGRARKYNLPSASGPER
Ga0207663_1061032123300025916Corn, Switchgrass And Miscanthus RhizosphereQKGALNRETTDKIEQVDELNARSRKYNLPSASAPER
Ga0207704_1088481023300025938Miscanthus RhizosphereMTEAQKGALSRETSDKVEQVADLNARSRKYNLPSASAPER
Ga0207651_1044856023300025960Switchgrass RhizosphereMTEAQKGALNRATSDKVEQVEQLNGRARKYNLPSASGPER
Ga0207641_1125877013300026088Switchgrass RhizosphereQKGSLSREMSDKVEQVAELNARSRKYNLPSASAPER
Ga0207683_1063648823300026121Miscanthus RhizosphereTGVIPNAQKTALSRVTSDKVEQVEELNARSAKYNLPKGSATER
Ga0209237_103980643300026297Grasslands SoilEAQKGALSREASRKVERVEELNARSRKYNLPSASASER
Ga0209131_102144913300026320Grasslands SoilAELKGTGRMTEAQKGALSRETSREVERVEELNARSRKYNLPSASASER
Ga0209131_129176713300026320Grasslands SoilMTEAQKGALSRETAAKVEHVEELNARSRKYNLPIASASER
Ga0257165_100727613300026507SoilTEAQKGALSRETSRKVERVEELNARSRKYNLPSASASER
Ga0179587_1079173813300026557Vadose Zone SoilRMTEAQKGALSRETSRKVERVEELNARSRKYNLPSASASER
Ga0209899_111554723300027490Groundwater SandGRMTEAQKGALSEEISDKVEQVEELNTRSRKYNLPRASAPER
Ga0209515_1011972643300027835GroundwaterGSAKGALGRETSEKVERVEALNARSRKYNLPSASAPER
Ga0209693_1037136023300027855SoilLGELQATGQMTEAQKGALSRETSRKVEQVGELNARSRKYNLPSASASER
Ga0209067_1083998513300027898WatershedsTGQIAEAQKGALSRATVEKVERVEELNALSRKYNLPSASASER
Ga0307282_1025384413300028784SoilGRMTEAQKGALSREMSDKVEQVSELNARSRKYNLPSASAPER
Ga0302232_1042440723300028789PalsaGRMADAQKGALSRATVEKVEQVEELNARSRKYNLPSASSPER
Ga0307281_1011487513300028803SoilMTAAAKGALGRETAEKVEQVAELNARARKYNLPSASAPER
Ga0302179_1033671423300030058PalsaRMADAQKGALSRATVEKVEQVEELNARSRKYNLPSASSPER
Ga0302323_10283387123300031232FenTGRMTEAQKGALNRATREKIEQVEELNARARKYNLPGGSASEP
Ga0310888_1098504613300031538SoilKALTELKATGRMTEAQKGALSEEISGKVEQVDELNTRSRKYNLPRASAPER
Ga0310887_1029534313300031547SoilTTGRMTEAQKGALSRETADKVEQVEELNARSRKYNLPAASAPERQP
Ga0310915_1091478023300031573SoilLQATGRMAEAQKGALSRATSEKVERVEELNARSRKYNLPKASASER
Ga0307476_1107184023300031715Hardwood Forest SoilLTSTGRMAEAQKGALNRATSEKVEQVEELNARSRKYNLPGGSASER
Ga0307469_1058556613300031720Hardwood Forest SoilEAAKGSLSRESYAKVQQIEELDARSRKYHLPTAGSAPER
Ga0307469_1114605323300031720Hardwood Forest SoilMTEAQKGALSREMSDKVEQVAELNARSRKYNLPSASAPER
Ga0307469_1199109613300031720Hardwood Forest SoilGRMTEAQKGALNRETSDKVEQIEELNARARKYNLPRASAPEGR
Ga0307473_1001226533300031820Hardwood Forest SoilTTGRMTEAQKGALGRETTEKVEQVEELNARSRKYNLPSASAPER
Ga0310892_1057810323300031858SoilQKGALSEEISGKVEQVDELNTRSRKYNLPRASAPER
Ga0310901_1025020913300031940SoilLVELKTTGRMTEAQKGALSRETADKVEQVEELNARSRKYNLPAASAPERQP
Ga0318533_1068785213300032059SoilELKGTGRMTEAQKGALSRETSRKVERVEELNARSRKYNLPSASASER
Ga0310889_1023744623300032179SoilMTEAQKGALGRETAEKVEQVEELNARSRKYNLPSASAPER
Ga0307472_10124537733300032205Hardwood Forest SoilALAELKATGRMTEAQKGAVSRATRDKVEQVEELDARARKYNLPIGTASGSGAER
Ga0348332_1362801813300032515Plant LitterALAELQATGRMTEAQKGALNRATREKVEQVEDLNARARKYNLPSGSASEP
Ga0335069_1115031413300032893SoilMTDAQKGSLGRATSDKVEQVEELNARSRKYNLPSGSATER
Ga0310914_1031176843300033289SoilGRMAEAQKAALSRETSDKIEQVAELNTRSQKYNLPRGSAPER
Ga0310810_1038037733300033412SoilELKTTGRMTEAQKGSLSREMSDKVEQVAELNARSRKYNLPSASAPER
Ga0326726_1240725523300033433Peat SoilAAAKGALGRETAEKVEQVAELNARARKYNLPSASTPER

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.