Basic Information | |
---|---|
Family ID | F045877 |
Family Type | Metagenome |
Number of Sequences | 152 |
Average Sequence Length | 43 residues |
Representative Sequence | MSAEEARELLDSAKSDEHHSLAVPSGPRDPDQTPDKPFKNW |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 152 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 41.45 % |
% of genes near scaffold ends (potentially truncated) | 43.42 % |
% of genes from short scaffolds (< 2000 bps) | 86.84 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (73.026 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (13.158 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.342 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.105 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.39% β-sheet: 0.00% Coil/Unstructured: 82.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 152 Family Scaffolds |
---|---|---|
PF13584 | BatD | 43.42 |
PF07715 | Plug | 0.66 |
PF08281 | Sigma70_r4_2 | 0.66 |
PF06319 | MmcB-like | 0.66 |
PF01641 | SelR | 0.66 |
COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
---|---|---|---|
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
COG5321 | Uncharacterized conserved protein | Function unknown [S] | 0.66 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 73.03 % |
All Organisms | root | All Organisms | 26.97 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10258237 | Not Available | 1114 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100307064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1470 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10051303 | Not Available | 1568 | Open in IMG/M |
3300004082|Ga0062384_100993201 | Not Available | 600 | Open in IMG/M |
3300004092|Ga0062389_102107609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 739 | Open in IMG/M |
3300004092|Ga0062389_103998742 | Not Available | 554 | Open in IMG/M |
3300005260|Ga0074072_1000022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 93935 | Open in IMG/M |
3300005329|Ga0070683_102434556 | Not Available | 502 | Open in IMG/M |
3300005344|Ga0070661_101103018 | Not Available | 661 | Open in IMG/M |
3300005355|Ga0070671_100630046 | Not Available | 928 | Open in IMG/M |
3300005367|Ga0070667_100378328 | Not Available | 1286 | Open in IMG/M |
3300005367|Ga0070667_100787088 | Not Available | 883 | Open in IMG/M |
3300005367|Ga0070667_101588701 | Not Available | 615 | Open in IMG/M |
3300005533|Ga0070734_10686511 | Not Available | 582 | Open in IMG/M |
3300005591|Ga0070761_10696839 | Not Available | 636 | Open in IMG/M |
3300005602|Ga0070762_10971605 | Not Available | 581 | Open in IMG/M |
3300005614|Ga0068856_101432508 | Not Available | 705 | Open in IMG/M |
3300005614|Ga0068856_102157931 | Not Available | 566 | Open in IMG/M |
3300005712|Ga0070764_10092059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1609 | Open in IMG/M |
3300005834|Ga0068851_11061322 | Not Available | 513 | Open in IMG/M |
3300005921|Ga0070766_10444513 | Not Available | 855 | Open in IMG/M |
3300005944|Ga0066788_10141788 | Not Available | 609 | Open in IMG/M |
3300006028|Ga0070717_11611312 | Not Available | 588 | Open in IMG/M |
3300006176|Ga0070765_100407913 | Not Available | 1269 | Open in IMG/M |
3300006237|Ga0097621_100179009 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium LW23 | 1831 | Open in IMG/M |
3300009093|Ga0105240_11692058 | Not Available | 661 | Open in IMG/M |
3300009093|Ga0105240_12041998 | Not Available | 595 | Open in IMG/M |
3300009101|Ga0105247_10123558 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1680 | Open in IMG/M |
3300009174|Ga0105241_10393772 | Not Available | 1213 | Open in IMG/M |
3300009500|Ga0116229_10384042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 1174 | Open in IMG/M |
3300009500|Ga0116229_10650826 | Not Available | 863 | Open in IMG/M |
3300009500|Ga0116229_10679945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 841 | Open in IMG/M |
3300009500|Ga0116229_10863129 | Not Available | 732 | Open in IMG/M |
3300009500|Ga0116229_11090334 | Not Available | 640 | Open in IMG/M |
3300009500|Ga0116229_11618350 | Not Available | 508 | Open in IMG/M |
3300009510|Ga0116230_11007741 | Not Available | 609 | Open in IMG/M |
3300009545|Ga0105237_10515175 | Not Available | 1203 | Open in IMG/M |
3300009551|Ga0105238_11155903 | Not Available | 798 | Open in IMG/M |
3300009633|Ga0116129_1001247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14289 | Open in IMG/M |
3300009709|Ga0116227_10020015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8740 | Open in IMG/M |
3300009826|Ga0123355_10407525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1748 | Open in IMG/M |
3300010048|Ga0126373_10246414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1756 | Open in IMG/M |
3300010371|Ga0134125_10135081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2746 | Open in IMG/M |
3300010371|Ga0134125_11040855 | Not Available | 897 | Open in IMG/M |
3300010371|Ga0134125_11150912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 848 | Open in IMG/M |
3300010373|Ga0134128_10140064 | All Organisms → cellular organisms → Bacteria | 2737 | Open in IMG/M |
3300010373|Ga0134128_11199561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 837 | Open in IMG/M |
3300010375|Ga0105239_10195217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2267 | Open in IMG/M |
3300010375|Ga0105239_12282480 | Not Available | 630 | Open in IMG/M |
3300010376|Ga0126381_103976675 | Not Available | 576 | Open in IMG/M |
3300010376|Ga0126381_104256837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 555 | Open in IMG/M |
3300010396|Ga0134126_11017325 | Not Available | 927 | Open in IMG/M |
3300010396|Ga0134126_12120642 | Not Available | 614 | Open in IMG/M |
3300010396|Ga0134126_12351518 | Not Available | 580 | Open in IMG/M |
3300011119|Ga0105246_11956861 | Not Available | 564 | Open in IMG/M |
3300012930|Ga0137407_10452511 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1195 | Open in IMG/M |
3300013104|Ga0157370_10846249 | Not Available | 831 | Open in IMG/M |
3300014168|Ga0181534_10001530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15018 | Open in IMG/M |
3300014168|Ga0181534_10298314 | Not Available | 868 | Open in IMG/M |
3300014169|Ga0181531_10225893 | Not Available | 1140 | Open in IMG/M |
3300014201|Ga0181537_10371823 | Not Available | 981 | Open in IMG/M |
3300014201|Ga0181537_10595548 | Not Available | 754 | Open in IMG/M |
3300014201|Ga0181537_10936806 | Not Available | 586 | Open in IMG/M |
3300014325|Ga0163163_12387914 | Not Available | 587 | Open in IMG/M |
3300014495|Ga0182015_10807507 | Not Available | 589 | Open in IMG/M |
3300014501|Ga0182024_10050747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6581 | Open in IMG/M |
3300014655|Ga0181516_10385231 | Not Available | 715 | Open in IMG/M |
3300014838|Ga0182030_10163906 | Not Available | 2777 | Open in IMG/M |
3300015242|Ga0137412_10172603 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1737 | Open in IMG/M |
3300016319|Ga0182033_11905128 | Not Available | 541 | Open in IMG/M |
3300016422|Ga0182039_12105029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 520 | Open in IMG/M |
3300017948|Ga0187847_10121343 | Not Available | 1433 | Open in IMG/M |
3300017959|Ga0187779_10389605 | Not Available | 907 | Open in IMG/M |
3300019787|Ga0182031_1038283 | Not Available | 769 | Open in IMG/M |
3300019789|Ga0137408_1388105 | Not Available | 1568 | Open in IMG/M |
3300020140|Ga0179590_1129293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 687 | Open in IMG/M |
3300020582|Ga0210395_10316512 | Not Available | 1173 | Open in IMG/M |
3300021088|Ga0210404_10277939 | Not Available | 917 | Open in IMG/M |
3300021180|Ga0210396_10516090 | Not Available | 1045 | Open in IMG/M |
3300021180|Ga0210396_10637588 | Not Available | 924 | Open in IMG/M |
3300021402|Ga0210385_11030627 | Not Available | 632 | Open in IMG/M |
3300021404|Ga0210389_10497975 | Not Available | 959 | Open in IMG/M |
3300021406|Ga0210386_10599122 | Not Available | 952 | Open in IMG/M |
3300021420|Ga0210394_10637614 | Not Available | 936 | Open in IMG/M |
3300021433|Ga0210391_10172372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1703 | Open in IMG/M |
3300021433|Ga0210391_11012319 | Not Available | 647 | Open in IMG/M |
3300021474|Ga0210390_10932255 | Not Available | 713 | Open in IMG/M |
3300021475|Ga0210392_10761761 | Not Available | 722 | Open in IMG/M |
3300022873|Ga0224550_1034304 | Not Available | 723 | Open in IMG/M |
3300025903|Ga0207680_10118751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 1726 | Open in IMG/M |
3300025911|Ga0207654_10135508 | Not Available | 1564 | Open in IMG/M |
3300025913|Ga0207695_10333069 | Not Available | 1406 | Open in IMG/M |
3300025914|Ga0207671_10177540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 1656 | Open in IMG/M |
3300025914|Ga0207671_10641689 | Not Available | 846 | Open in IMG/M |
3300025921|Ga0207652_10124533 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
3300025927|Ga0207687_11788221 | Not Available | 526 | Open in IMG/M |
3300025928|Ga0207700_11089179 | Not Available | 714 | Open in IMG/M |
3300026041|Ga0207639_11553090 | Not Available | 621 | Open in IMG/M |
3300027652|Ga0209007_1076191 | Not Available | 846 | Open in IMG/M |
3300027807|Ga0209208_10077174 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2477 | Open in IMG/M |
3300027807|Ga0209208_10101183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1955 | Open in IMG/M |
3300027855|Ga0209693_10444184 | Not Available | 624 | Open in IMG/M |
3300027860|Ga0209611_10575857 | Not Available | 624 | Open in IMG/M |
3300027860|Ga0209611_10626067 | Not Available | 591 | Open in IMG/M |
3300027889|Ga0209380_10569966 | Not Available | 657 | Open in IMG/M |
3300027908|Ga0209006_11041596 | Not Available | 649 | Open in IMG/M |
3300028731|Ga0302301_1146052 | Not Available | 589 | Open in IMG/M |
3300028773|Ga0302234_10262275 | Not Available | 743 | Open in IMG/M |
3300028783|Ga0302279_10307718 | Not Available | 694 | Open in IMG/M |
3300028795|Ga0302227_10293488 | Not Available | 619 | Open in IMG/M |
3300028813|Ga0302157_10027622 | All Organisms → cellular organisms → Bacteria | 4471 | Open in IMG/M |
3300028871|Ga0302230_10320137 | Not Available | 601 | Open in IMG/M |
3300028882|Ga0302154_10415559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli | 646 | Open in IMG/M |
3300029883|Ga0311327_10665843 | Not Available | 619 | Open in IMG/M |
3300029951|Ga0311371_10515512 | Not Available | 1571 | Open in IMG/M |
3300029952|Ga0311346_10199198 | Not Available | 2243 | Open in IMG/M |
3300029999|Ga0311339_10630602 | Not Available | 1062 | Open in IMG/M |
3300030007|Ga0311338_11575658 | Not Available | 602 | Open in IMG/M |
3300030503|Ga0311370_10542101 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1412 | Open in IMG/M |
3300030503|Ga0311370_10692780 | Not Available | 1198 | Open in IMG/M |
3300030520|Ga0311372_10813275 | Not Available | 1275 | Open in IMG/M |
3300030580|Ga0311355_11874180 | Not Available | 507 | Open in IMG/M |
3300030618|Ga0311354_10180088 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
3300030693|Ga0302313_10325835 | Not Available | 612 | Open in IMG/M |
3300030906|Ga0302314_10226730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2253 | Open in IMG/M |
3300030906|Ga0302314_10483254 | Not Available | 1338 | Open in IMG/M |
3300031231|Ga0170824_115975492 | Not Available | 945 | Open in IMG/M |
3300031233|Ga0302307_10717011 | Not Available | 501 | Open in IMG/M |
3300031236|Ga0302324_100758763 | Not Available | 1358 | Open in IMG/M |
3300031236|Ga0302324_101365708 | Not Available | 930 | Open in IMG/M |
3300031236|Ga0302324_103152602 | Not Available | 544 | Open in IMG/M |
3300031261|Ga0302140_10827220 | Not Available | 658 | Open in IMG/M |
3300031525|Ga0302326_11904620 | Not Available | 773 | Open in IMG/M |
3300031708|Ga0310686_107675069 | All Organisms → cellular organisms → Bacteria | 9805 | Open in IMG/M |
3300031708|Ga0310686_113305466 | Not Available | 611 | Open in IMG/M |
3300031708|Ga0310686_118421346 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300031726|Ga0302321_101580929 | Not Available | 757 | Open in IMG/M |
3300031744|Ga0306918_10753083 | Not Available | 761 | Open in IMG/M |
3300031823|Ga0307478_10359191 | Not Available | 1201 | Open in IMG/M |
3300031823|Ga0307478_11656867 | Not Available | 528 | Open in IMG/M |
3300031942|Ga0310916_10493008 | Not Available | 1043 | Open in IMG/M |
3300031946|Ga0310910_10180634 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
3300031962|Ga0307479_10651404 | Not Available | 1034 | Open in IMG/M |
3300032066|Ga0318514_10202470 | Not Available | 1040 | Open in IMG/M |
3300032783|Ga0335079_11803044 | Not Available | 595 | Open in IMG/M |
3300032829|Ga0335070_11020545 | Not Available | 763 | Open in IMG/M |
3300032896|Ga0335075_10108159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3611 | Open in IMG/M |
3300032897|Ga0335071_11242922 | Not Available | 690 | Open in IMG/M |
3300032955|Ga0335076_10156933 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2190 | Open in IMG/M |
3300033134|Ga0335073_10012946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11689 | Open in IMG/M |
3300034124|Ga0370483_0028676 | Not Available | 1682 | Open in IMG/M |
3300034163|Ga0370515_0019229 | Not Available | 3156 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 13.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.87% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 7.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 7.24% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.26% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.61% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.95% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.95% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.29% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.63% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.97% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.32% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.66% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.66% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.66% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.66% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.66% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.66% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.66% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.66% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.66% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027807 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes) | Host-Associated | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_102582371 | 3300001593 | Forest Soil | MSEEEARELLDSAKSDEHHSLAVPKGPRNPNDPDNVLKNW* |
JGIcombinedJ26739_1003070641 | 3300002245 | Forest Soil | MSAEEARELLDSEKSDEHHSLAAPVGPRNPDQAPDKAFKNW* |
JGIcombinedJ51221_100513031 | 3300003505 | Forest Soil | LADNQREPGQMSEEEARELLDSAKSDEHHSLAVPSGPRKPNDPDNVLKNW* |
Ga0062384_1009932012 | 3300004082 | Bog Forest Soil | MAENQREPGQMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW* |
Ga0062389_1021076092 | 3300004092 | Bog Forest Soil | MSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW* |
Ga0062389_1039987422 | 3300004092 | Bog Forest Soil | MSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNALKNW* |
Ga0074072_100002276 | 3300005260 | Soil | MSREEANALLNSAKSDEHHSLLVPSGPRPPDLSPDEPFKNW* |
Ga0070683_1024345561 | 3300005329 | Corn Rhizosphere | PGQMGVEDARALLDSAKSEERHSLPVPSGPRDPDQPDKPFKNW* |
Ga0070661_1011030182 | 3300005344 | Corn Rhizosphere | MSAEEANALLNSAKSDEHHSLLVPSGPRPPDSSPDKPFKNW* |
Ga0070671_1006300461 | 3300005355 | Switchgrass Rhizosphere | GQMSVEEANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNW* |
Ga0070667_1003783282 | 3300005367 | Switchgrass Rhizosphere | MSADEARELLDSAKSDEHHSLLVPSGPRDPDQAPDKPFKNW* |
Ga0070667_1007870882 | 3300005367 | Switchgrass Rhizosphere | MSVEEANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNW* |
Ga0070667_1015887012 | 3300005367 | Switchgrass Rhizosphere | GQMSVEEANALLNSAKSDEHHSLLVPSGPQSPDLSPDKPFKNW* |
Ga0070734_106865112 | 3300005533 | Surface Soil | MTPEEARELLDSAKSDEHQSLAVPSGPRDPNQPDKPFKNW* |
Ga0070761_106968391 | 3300005591 | Soil | EEARELLDSEKSDEHHSLAVPAGPRTPDQTPDPLKNW* |
Ga0070762_109716052 | 3300005602 | Soil | MSAEEARELLDSAKSDEHHSLAVPSGPRDPDSTPDKPFKNW* |
Ga0068856_1014325082 | 3300005614 | Corn Rhizosphere | MTPEEARELLDSAKSDEHRSLAVPAGPRDPDQSDKPFKNW* |
Ga0068856_1021579312 | 3300005614 | Corn Rhizosphere | MSAEEARGLLDSAKSDEHHSLPTPAGPRDPRNPDKPYKNW* |
Ga0070764_100920592 | 3300005712 | Soil | GQQAPGQMSPEEARELLDSAKSDEHHSLGVPAGPRDPDQPPDKPFKNW* |
Ga0068851_110613222 | 3300005834 | Corn Rhizosphere | MSVEEANALLNSAKSDEHHSLLVPSGPQSPDLSPDKPFKNW* |
Ga0070766_104445131 | 3300005921 | Soil | RSPGQMSAEEARELLDSAKSDEHHSLAVPSGPRDPDQTPDKPFKNW* |
Ga0066788_101417883 | 3300005944 | Soil | MTREEARELLDSAKGDEHHSLGVPIGNRDPNIPTDKPYKNW |
Ga0070717_116113122 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EEARELLDSAKSEEHHSLAVPAGPRDPDQSADKPLKNW* |
Ga0070765_1004079132 | 3300006176 | Soil | SPEEARELLDSAKSDEHHSLGVPAGPRDPDQPPDKPFKNW* |
Ga0097621_1001790092 | 3300006237 | Miscanthus Rhizosphere | MSAEEARGLLDSAKSDERHALPAPAAPRDPQTPDKPYRNW* |
Ga0105240_116920581 | 3300009093 | Corn Rhizosphere | MSVEEANDLLNSAKSDEHHSLLVPSGPRPPDLSPDEPFKNW* |
Ga0105240_120419982 | 3300009093 | Corn Rhizosphere | GSPGQMSVEEANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNW* |
Ga0105247_101235581 | 3300009101 | Switchgrass Rhizosphere | MSVEEANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNS* |
Ga0105241_103937721 | 3300009174 | Corn Rhizosphere | MSAEEANALLNSAKSDEHHSLLVPSGPRPPDLSPDKPFKNW* |
Ga0116229_103840421 | 3300009500 | Host-Associated | MSQEEARELLDSAKSDEHHFLGAPLDRRDPDNAPDKPFKNW* |
Ga0116229_106508262 | 3300009500 | Host-Associated | MSQEEARELLDSAKSDEHHFLSAPVDRRDQDNSPDKPFKNW* |
Ga0116229_106799452 | 3300009500 | Host-Associated | MSQEEARELLDSAKADEHHFLGAPLDRRDPDNTPEKPFKNW* |
Ga0116229_108631292 | 3300009500 | Host-Associated | TAQDQPGQMSQEEARELLDSAKADEHHVLGAPLDRRDPDNTPEKPFKNW* |
Ga0116229_110903342 | 3300009500 | Host-Associated | QDQPGQMSQEEARELLDSAKADEHHILGAPLDRRDPDDTPDKPFKNW* |
Ga0116229_116183501 | 3300009500 | Host-Associated | MSEEEARELLDSAKSDEHHSLAVPQDPRNPNDPDKAFKNW* |
Ga0116230_110077412 | 3300009510 | Host-Associated | MSQEEARELLDSAKSDEHHFLGAPRDRRDQDDSPDKPFKNW* |
Ga0105237_105151752 | 3300009545 | Corn Rhizosphere | MSVEEANDLLNSAKSDEHHSLLVPSGPRPPDLSPDKPFKNW* |
Ga0105238_111559031 | 3300009551 | Corn Rhizosphere | PAEARALLDSAKSDEHPSLMAPAGPRAPDSTPDKPIKNW* |
Ga0116129_100124714 | 3300009633 | Peatland | MSPEEARELLDSAKTDEHHFLGAPLDRRDPDNSPDKPFKNW* |
Ga0116227_100200159 | 3300009709 | Host-Associated | MSQEEARELLDSAKADEHHFLGAPLDNREHDNTPDKPFKNW* |
Ga0123355_104075252 | 3300009826 | Termite Gut | MSAEEASQLLDSARSDERHSLFVPSGPRDPDPARDKAFKDW* |
Ga0126373_102464141 | 3300010048 | Tropical Forest Soil | MEEASQDAPGQMSPEEARELLDSAKSDEHHALLVPSGPRDPDPDKPFKNW* |
Ga0134125_101350812 | 3300010371 | Terrestrial Soil | MSAEDARELLDSAKSEERHSLPVPLGPRDPHQPDKPFKNW* |
Ga0134125_110408552 | 3300010371 | Terrestrial Soil | MSADEARELLDSAKSDEHQSLLVPSGPRDPDQAPDKPFKNW* |
Ga0134125_111509121 | 3300010371 | Terrestrial Soil | MSAEDARELLDSAKSEERHSLPVPSGPQDPHQPDKPFKNW* |
Ga0134128_101400643 | 3300010373 | Terrestrial Soil | MTPEEARQLLDSAKSDEHNSLAVPAGPRNPNQPDKPFKNW* |
Ga0134128_111995611 | 3300010373 | Terrestrial Soil | MSAEDARELLDSAKSEERHSLPVPSGPRDPHQPDKPFKNW |
Ga0105239_101952172 | 3300010375 | Corn Rhizosphere | MTPEEARELLDSAKSDEHRSLAVPAGPRDPDQPDKPFKNW* |
Ga0105239_122824802 | 3300010375 | Corn Rhizosphere | MSADEARELLDSAKSDEHQSLLVPSGPRDPDQPPDKPFKNW* |
Ga0126381_1039766751 | 3300010376 | Tropical Forest Soil | MEAAGHDAPGQMSPEEARELLDSAKSDEHHSLLVPSDPRDPDPDKPFKNW* |
Ga0126381_1042568372 | 3300010376 | Tropical Forest Soil | MSAEEARELLDSEKSDEHHPLAVPSGPRDPNPPDKPVKDW* |
Ga0134126_110173251 | 3300010396 | Terrestrial Soil | MSAEDARELLDSAKSEERHSLPVPAGPRDPTPEKSFKNW* |
Ga0134126_121206422 | 3300010396 | Terrestrial Soil | MSPEEARELLDSAKSDEHHSLLVPTGPRDPNQPEKAIKNW* |
Ga0134126_123515182 | 3300010396 | Terrestrial Soil | MSAEDARELLDSAKSEERNSLPVPAGPRDPTPEKPFKNW* |
Ga0105246_119568612 | 3300011119 | Miscanthus Rhizosphere | MSVEEANALLNSAKSDEHHSLLVPSGPQPPELSPDKPFKNW* |
Ga0137407_104525111 | 3300012930 | Vadose Zone Soil | GQMSVDEAHQLLDSAKSDEHHSLLVPSGPRAPDSTPEKAFKNW* |
Ga0157370_108462492 | 3300013104 | Corn Rhizosphere | EARGLLDSAKSDEHHSLPTPAGPRDPRNPDKPYKNW* |
Ga0181534_100015302 | 3300014168 | Bog | MSREEANALLNSAKSDEHHSLLVPSGPRPPDLSPDKPFKNW* |
Ga0181534_102983142 | 3300014168 | Bog | MSREEARELLDSAKSDEHHFLGAPLDRRDQDNSPDKPFKNW* |
Ga0181531_102258932 | 3300014169 | Bog | MSVAEARELLDSAKSDEHQSLGVPSGPRDPDQTPDKPFKNW* |
Ga0181537_103718232 | 3300014201 | Bog | MSEEEARELLDSAKSDEHHSLAVPAGPRNPNDTDNVLKNW* |
Ga0181537_105955482 | 3300014201 | Bog | MSVEEARELLDSAKSDEHHSLGVPSGPRDPNDAPEKAFKNW* |
Ga0181537_109368062 | 3300014201 | Bog | MSEEEARELLDSAKSDEHQSLAVPSGPRDPNDPDKVFKNW* |
Ga0163163_123879141 | 3300014325 | Switchgrass Rhizosphere | MSADEARELLDSAKSDEHQSLLAPSGPRDPDQAPDKPFKNW* |
Ga0182015_108075072 | 3300014495 | Palsa | QGDEGDDQRPAGQMSAEEARELLDSEKSDEHHSLAVPAGPRNPYQAPDQALKNW* |
Ga0182024_100507472 | 3300014501 | Permafrost | MSQEEARELLDSAKSDEHHFLGAPLDRRDQDTSPDKPFKNW* |
Ga0181516_103852312 | 3300014655 | Bog | MSEEEARELLDSAKSDEHHSLAVPSGPRNPNDTDKVFKNW* |
Ga0182030_101639063 | 3300014838 | Bog | MSAEEARELLDSEKSDEHRSLGVPLIPRNPDQAPDKAFKNW* |
Ga0137412_101726033 | 3300015242 | Vadose Zone Soil | MSAEEARELLDSAKSDEHHSLVVPAGPRDPNLPPDKPFKNW* |
Ga0182033_119051282 | 3300016319 | Soil | MEAARHDAPGQMSPEEARQLLDSAKSDEHHSLLVPSGSQDPDADKPLKNW |
Ga0182039_121050292 | 3300016422 | Soil | MEAANHDGQMSPEEARELLDSAKSDEHHSLLVPSGPRDPDPDKPFK |
Ga0187847_101213431 | 3300017948 | Peatland | SDADDGHTAENQRPPGQMSVEDARELLDSAKSDEHHSLAVPSGPRDPDQAPDKAFKNW |
Ga0187779_103896051 | 3300017959 | Tropical Peatland | GDGTPGQMSPEEARELLDSAKSDEHHPLLAPSGPRDPDPDKPFKDW |
Ga0182031_10382831 | 3300019787 | Bog | PGQMSQEEEARELLDSAKSDEHHFLGAPLDSRDPDNRPDKPFKNW |
Ga0137408_13881054 | 3300019789 | Vadose Zone Soil | PPAQSGSTEADDQRAPGQMSVEEAHQLLDSAKSDEHHSFLVPSGPRAPDSTPDKAIKNW |
Ga0179590_11292931 | 3300020140 | Vadose Zone Soil | MSAEEARELLDSAKSDEHHSLAVPAGPRDPDLPPDKPFKNW |
Ga0210395_103165122 | 3300020582 | Soil | MSEEEARELLDSAKSDEHHSLAVPSGPRKPNDPDNVLKNW |
Ga0210404_102779392 | 3300021088 | Soil | MSAEEARELLDSAKSDEHHSLAVPAGPRDPNLPPDKPFKNW |
Ga0210396_105160902 | 3300021180 | Soil | MSAEEARELLDSAKSDEHHSLLVPSGPRDPDTTPDKPFKNW |
Ga0210396_106375883 | 3300021180 | Soil | PPPDAPARAPGQMSAEEARELLDSAKSDEHHSLAVPAGPRDPNLPPDKPFKNW |
Ga0210385_110306272 | 3300021402 | Soil | RELLDSAKSDEHHFLGAPLDRRDQDNTPDKPYKNW |
Ga0210389_104979751 | 3300021404 | Soil | REPGQMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVSKNW |
Ga0210386_105991222 | 3300021406 | Soil | MTPEEARELLDSAKSEEHQSLAVPAGPRDPNQPPDKPFKNW |
Ga0210394_106376142 | 3300021420 | Soil | PPDAPARAPGQMSAEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW |
Ga0210391_101723721 | 3300021433 | Soil | GQMSAEEARELLDSAKSEEHHSLAVPAGPRDPDQSPDKPFKNW |
Ga0210391_110123192 | 3300021433 | Soil | GQMSVEEARELLDSAKSDEHHSLGVPSGPRDPNDAPDKAFKNW |
Ga0210390_109322552 | 3300021474 | Soil | QAQADSQQAPGQMSPEDARALLDSAKSDEHHSLAVPAGPRDPNQLDKPFKNW |
Ga0210392_107617612 | 3300021475 | Soil | QMSAEEARELLDSAKSDEHASLLVPSGPQNPDPAPDKAFKNW |
Ga0224550_10343042 | 3300022873 | Soil | GQMSAEEARELLDSAKSDEHHSLAVPSGPRDPDQTPDKPFKNW |
Ga0207680_101187512 | 3300025903 | Switchgrass Rhizosphere | MSVEEANALLNSAKSDEHHSLLVPSGPQSPDLSPDKPFKNW |
Ga0207654_101355081 | 3300025911 | Corn Rhizosphere | MSVEEANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNW |
Ga0207695_103330692 | 3300025913 | Corn Rhizosphere | MSAEEANALLNSAKSDEHHSLLVPSGPRPPDSSPDKPFKNW |
Ga0207671_101775403 | 3300025914 | Corn Rhizosphere | MSVEEANALLNSAKSDEHHSLLVPSGSQPPDLSPDKPFKNW |
Ga0207671_106416892 | 3300025914 | Corn Rhizosphere | MSADEARELLDSAKSDEHHSLLVPSGPRDPDQAPDKPFKNW |
Ga0207652_101245331 | 3300025921 | Corn Rhizosphere | GQRGPGQMGVEDARALLDSAKSEERHSLPVPSGPRDPDQPDKPFKNW |
Ga0207687_117882211 | 3300025927 | Miscanthus Rhizosphere | MSAADARDLLDSAKSDEKHSLLVPSGPRTPDSTPDKPFKNW |
Ga0207700_110891791 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ARGLLDSAKSDEHHSLPTQAGPRDPRNPDKPYKNW |
Ga0207639_115530902 | 3300026041 | Corn Rhizosphere | ANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNW |
Ga0209007_10761912 | 3300027652 | Forest Soil | MSAEEARELLDSAKSDEHHSLAVPSGPRDPDQTPDKPFKNW |
Ga0209208_100771742 | 3300027807 | Host-Associated | MSQEEARELLDSAKSDEHHFLGAPRDRRDQDDSPDKPFKNW |
Ga0209208_101011833 | 3300027807 | Host-Associated | MSQEEARELLDSAKADEHHFLGAPLDRRDPDNTPEKPFKNW |
Ga0209693_104441841 | 3300027855 | Soil | RPPGQMSPEEARELLDSEKSDEHHSLAVPAGPRTPDQAPDALKNW |
Ga0209611_105758572 | 3300027860 | Host-Associated | MSQEEARELLDSAKSDEHHFLSAPVDRRDQDNSPDKPFKNW |
Ga0209611_106260672 | 3300027860 | Host-Associated | EEARELLDSAKADEHHILGAPLDRRDPDDTPDKPFKNW |
Ga0209380_105699662 | 3300027889 | Soil | RSPGQMSAEEARELLDSAKSDEHHSLAVPSGPRDPDQTPDKPFKNW |
Ga0209006_110415962 | 3300027908 | Forest Soil | MSPEEARELLDSAKSDEHHSLGVPAGPRDPDQPPDKPFKNW |
Ga0302301_11460521 | 3300028731 | Palsa | EEARELLDSEKSDEHHSLAAPVGPRNPDQPPDKAFKNW |
Ga0302234_102622751 | 3300028773 | Palsa | PGQMSEEEARELLDSAKSDEHHSLAVPSGPRSPNDPDNVLKNW |
Ga0302279_103077182 | 3300028783 | Bog | PPDQRSPGQMSPEEARELLDSEKSEEHHSLAAPSGPRNPDQAPDKALKDW |
Ga0302227_102934882 | 3300028795 | Palsa | EGNDQRPPGQMSAEEARELLDSEKSDEHHSLAVPSGPRNPDQALDKAFKNW |
Ga0302157_100276224 | 3300028813 | Bog | MSPEEARELLDSEKSEEHHSLAAPSGPRNPDQAPDKALKDW |
Ga0302230_103201371 | 3300028871 | Palsa | RELLDSEKSDEHHSLAVPSGPRNPDQALDKAFKNW |
Ga0302154_104155592 | 3300028882 | Bog | MSQEEARELLDSAKADEHHFLGAPLDRRDADDTPEKPFKNW |
Ga0311327_106658432 | 3300029883 | Bog | MSAEEARELLDSEKSDEHRSLGVPLIPRNPDQAPDKAFKNW |
Ga0311371_105155122 | 3300029951 | Palsa | MSEEEARELLDSAKSDEHHSLAVPSGPRSPNDPDNVLKNW |
Ga0311346_101991981 | 3300029952 | Bog | PPPEQQRQPGQMSAEEARELLDSEKSDEHRSLGVPLIPRNPDQAPDKAFKNW |
Ga0311339_106306022 | 3300029999 | Palsa | MSPEEARELLDSAKSDEHHFLGAPLDRRDQDNSPDKPFKNW |
Ga0311338_115756581 | 3300030007 | Palsa | NQRQPGQMSEDEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW |
Ga0311370_105421012 | 3300030503 | Palsa | SGNGQMSVEEARELLDSAKSDEHHSLGVPSGPRDPNDAPDKAFKNW |
Ga0311370_106927801 | 3300030503 | Palsa | RQAADTQPPPGQMNAEEARELLDSAKSEEHHSLTVPSGPRDPNQPPDKAFKNW |
Ga0311372_108132753 | 3300030520 | Palsa | MSPEEARELLDSAKSDEHHSLAVPAGPRDPDQPPDKPFKNW |
Ga0311355_118741801 | 3300030580 | Palsa | EANDQRLPGQMSAEEARELLDSEKQDEHPSLAVPTGPRNPDQPPDKAFKNW |
Ga0311354_101800883 | 3300030618 | Palsa | GSQAENQRQPGQMSEDEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW |
Ga0302313_103258351 | 3300030693 | Palsa | PPGQMSVEEASELLDSAKSDEHHSLAVPSGPRDPDQSPDKAFKNW |
Ga0302314_102267303 | 3300030906 | Palsa | QQAPGQMSPEDARALLDSAKSDEHHSLAVPAGPRDPNQPPDKPFKNW |
Ga0302314_104832542 | 3300030906 | Palsa | QAAETQRPPGQMSVEEASELLDSAKSDEHHSLAVPSGPRDPDQSPDKAFKNW |
Ga0170824_1159754921 | 3300031231 | Forest Soil | ENQGAPGQMTPEEARQLLDSAKSDEHNSLAVPAGPRNPNQPDKPVKNW |
Ga0302307_107170112 | 3300031233 | Palsa | QGDEGDDQRPAGQMSAEEARELLDSEKSDEHHSLAVPAGPRNPEQAPDQALKNW |
Ga0302324_1007587631 | 3300031236 | Palsa | EADKSVAENQREPGQMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW |
Ga0302324_1013657081 | 3300031236 | Palsa | GQMSAEEARELLDSAKSDEHHSLAAPAGPRDPDQTPDKAFKNW |
Ga0302324_1031526022 | 3300031236 | Palsa | MSQEDARELLDSAKSDEHHFLGAPLDRRDQDTSPDKPFKNW |
Ga0302140_108272202 | 3300031261 | Bog | PPPEQRAPGQMSPEEARELLDSEKSDEHHSLAAPSGPRNPDQAPDKALKDW |
Ga0302326_119046201 | 3300031525 | Palsa | DEADKSVAENQREPGQMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW |
Ga0310686_10767506910 | 3300031708 | Soil | MTAQDARELLDSAKSDEHHSLGVPAGPRNPDQSPDKPFKNW |
Ga0310686_1133054662 | 3300031708 | Soil | MSPEEARELLDSAKSDEHHSLAVPSGPRDPNQPDKPFKNW |
Ga0310686_1184213462 | 3300031708 | Soil | MSPEEARELLDSAKSEEHHSLAVLTGPRDPDQSPDKPFKNW |
Ga0302321_1015809291 | 3300031726 | Fen | PGQMSVDEAHQLLDSAKADEHHSLLVPSGPRAPDSTPDKAFKNW |
Ga0306918_107530831 | 3300031744 | Soil | EAASDEAPGQMSPEEARELLDSAKSDEHHSLMVPSGPRDPDLDKPFKNW |
Ga0307478_103591912 | 3300031823 | Hardwood Forest Soil | MSEEEARELLDSAKSDEHHSLAVPKGPRNPNEPDNVLKNW |
Ga0307478_116568671 | 3300031823 | Hardwood Forest Soil | MSAAEARDLLDSAKSDEHHSLLVPSGPLNPNAEPDKPFKNW |
Ga0310916_104930081 | 3300031942 | Soil | QGATGQMSPEEARELLDSAKSDEHHSLLVPSGPRDPDPDKPFKNW |
Ga0310910_101806341 | 3300031946 | Soil | MSPEEARELLDSAKSDEHHSLLVPSGPRDPDPDKPFKNW |
Ga0307479_106514042 | 3300031962 | Hardwood Forest Soil | MSPEEARELLDSAKSEEHQSLAVPAGPRDPNQAPDKPFKNW |
Ga0318514_102024701 | 3300032066 | Soil | PGQMSPEEARELLDSAKSDEHHSLMVPSGPRDPDPDKPFKNW |
Ga0335079_118030441 | 3300032783 | Soil | QTQSGQMSGEEARELLDSAKSDEHRSLLVPSGPRDPDAPDTVLKNW |
Ga0335070_110205452 | 3300032829 | Soil | GSMSPEEARELLDSAKADEHHSLGLAGPRNPDPRADKPRKDW |
Ga0335075_101081594 | 3300032896 | Soil | MSADEARELLDSAKADEHHSLPVPTGPRDPDPDKPYKNW |
Ga0335071_112429222 | 3300032897 | Soil | ARELLDSAKADEHHSLGLAGPRNPDPRADKPRKDW |
Ga0335076_101569332 | 3300032955 | Soil | MSAAEARELLDSAKSDERRSLLVPSGPRNPDSTPDKAFKNW |
Ga0335073_1001294612 | 3300033134 | Soil | MSSEDARELLDSAKSDEHPSLLVPSGPRDPDPPDKPFRNW |
Ga0370483_0028676_1508_1633 | 3300034124 | Untreated Peat Soil | MSAEEARELLDSEKSDEHQSLAVPSGPRNPDQAPDKAFKNW |
Ga0370515_0019229_320_445 | 3300034163 | Untreated Peat Soil | MSAEEARELLDSEKSDEHHSLAVPSGPRNPDQAPDKAFKNW |
⦗Top⦘ |