NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F045877

Metagenome Family F045877

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045877
Family Type Metagenome
Number of Sequences 152
Average Sequence Length 43 residues
Representative Sequence MSAEEARELLDSAKSDEHHSLAVPSGPRDPDQTPDKPFKNW
Number of Associated Samples 120
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 41.45 %
% of genes near scaffold ends (potentially truncated) 43.42 %
% of genes from short scaffolds (< 2000 bps) 86.84 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (73.026 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(13.158 % of family members)
Environment Ontology (ENVO) Unclassified
(24.342 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.105 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.39%    β-sheet: 0.00%    Coil/Unstructured: 82.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF13584BatD 43.42
PF07715Plug 0.66
PF08281Sigma70_r4_2 0.66
PF06319MmcB-like 0.66
PF01641SelR 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.66
COG5321Uncharacterized conserved proteinFunction unknown [S] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A73.03 %
All OrganismsrootAll Organisms26.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10258237Not Available1114Open in IMG/M
3300002245|JGIcombinedJ26739_100307064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1470Open in IMG/M
3300003505|JGIcombinedJ51221_10051303Not Available1568Open in IMG/M
3300004082|Ga0062384_100993201Not Available600Open in IMG/M
3300004092|Ga0062389_102107609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli739Open in IMG/M
3300004092|Ga0062389_103998742Not Available554Open in IMG/M
3300005260|Ga0074072_1000022All Organisms → cellular organisms → Bacteria → Proteobacteria93935Open in IMG/M
3300005329|Ga0070683_102434556Not Available502Open in IMG/M
3300005344|Ga0070661_101103018Not Available661Open in IMG/M
3300005355|Ga0070671_100630046Not Available928Open in IMG/M
3300005367|Ga0070667_100378328Not Available1286Open in IMG/M
3300005367|Ga0070667_100787088Not Available883Open in IMG/M
3300005367|Ga0070667_101588701Not Available615Open in IMG/M
3300005533|Ga0070734_10686511Not Available582Open in IMG/M
3300005591|Ga0070761_10696839Not Available636Open in IMG/M
3300005602|Ga0070762_10971605Not Available581Open in IMG/M
3300005614|Ga0068856_101432508Not Available705Open in IMG/M
3300005614|Ga0068856_102157931Not Available566Open in IMG/M
3300005712|Ga0070764_10092059All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium1609Open in IMG/M
3300005834|Ga0068851_11061322Not Available513Open in IMG/M
3300005921|Ga0070766_10444513Not Available855Open in IMG/M
3300005944|Ga0066788_10141788Not Available609Open in IMG/M
3300006028|Ga0070717_11611312Not Available588Open in IMG/M
3300006176|Ga0070765_100407913Not Available1269Open in IMG/M
3300006237|Ga0097621_100179009All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium LW231831Open in IMG/M
3300009093|Ga0105240_11692058Not Available661Open in IMG/M
3300009093|Ga0105240_12041998Not Available595Open in IMG/M
3300009101|Ga0105247_10123558All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium1680Open in IMG/M
3300009174|Ga0105241_10393772Not Available1213Open in IMG/M
3300009500|Ga0116229_10384042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli1174Open in IMG/M
3300009500|Ga0116229_10650826Not Available863Open in IMG/M
3300009500|Ga0116229_10679945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli841Open in IMG/M
3300009500|Ga0116229_10863129Not Available732Open in IMG/M
3300009500|Ga0116229_11090334Not Available640Open in IMG/M
3300009500|Ga0116229_11618350Not Available508Open in IMG/M
3300009510|Ga0116230_11007741Not Available609Open in IMG/M
3300009545|Ga0105237_10515175Not Available1203Open in IMG/M
3300009551|Ga0105238_11155903Not Available798Open in IMG/M
3300009633|Ga0116129_1001247All Organisms → cellular organisms → Bacteria → Proteobacteria14289Open in IMG/M
3300009709|Ga0116227_10020015All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria8740Open in IMG/M
3300009826|Ga0123355_10407525All Organisms → cellular organisms → Bacteria → Proteobacteria1748Open in IMG/M
3300010048|Ga0126373_10246414All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium1756Open in IMG/M
3300010371|Ga0134125_10135081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2746Open in IMG/M
3300010371|Ga0134125_11040855Not Available897Open in IMG/M
3300010371|Ga0134125_11150912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli848Open in IMG/M
3300010373|Ga0134128_10140064All Organisms → cellular organisms → Bacteria2737Open in IMG/M
3300010373|Ga0134128_11199561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli837Open in IMG/M
3300010375|Ga0105239_10195217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2267Open in IMG/M
3300010375|Ga0105239_12282480Not Available630Open in IMG/M
3300010376|Ga0126381_103976675Not Available576Open in IMG/M
3300010376|Ga0126381_104256837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli555Open in IMG/M
3300010396|Ga0134126_11017325Not Available927Open in IMG/M
3300010396|Ga0134126_12120642Not Available614Open in IMG/M
3300010396|Ga0134126_12351518Not Available580Open in IMG/M
3300011119|Ga0105246_11956861Not Available564Open in IMG/M
3300012930|Ga0137407_10452511All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium1195Open in IMG/M
3300013104|Ga0157370_10846249Not Available831Open in IMG/M
3300014168|Ga0181534_10001530All Organisms → cellular organisms → Bacteria → Proteobacteria15018Open in IMG/M
3300014168|Ga0181534_10298314Not Available868Open in IMG/M
3300014169|Ga0181531_10225893Not Available1140Open in IMG/M
3300014201|Ga0181537_10371823Not Available981Open in IMG/M
3300014201|Ga0181537_10595548Not Available754Open in IMG/M
3300014201|Ga0181537_10936806Not Available586Open in IMG/M
3300014325|Ga0163163_12387914Not Available587Open in IMG/M
3300014495|Ga0182015_10807507Not Available589Open in IMG/M
3300014501|Ga0182024_10050747All Organisms → cellular organisms → Bacteria → Proteobacteria6581Open in IMG/M
3300014655|Ga0181516_10385231Not Available715Open in IMG/M
3300014838|Ga0182030_10163906Not Available2777Open in IMG/M
3300015242|Ga0137412_10172603All Organisms → cellular organisms → Eukaryota → Opisthokonta1737Open in IMG/M
3300016319|Ga0182033_11905128Not Available541Open in IMG/M
3300016422|Ga0182039_12105029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli520Open in IMG/M
3300017948|Ga0187847_10121343Not Available1433Open in IMG/M
3300017959|Ga0187779_10389605Not Available907Open in IMG/M
3300019787|Ga0182031_1038283Not Available769Open in IMG/M
3300019789|Ga0137408_1388105Not Available1568Open in IMG/M
3300020140|Ga0179590_1129293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli687Open in IMG/M
3300020582|Ga0210395_10316512Not Available1173Open in IMG/M
3300021088|Ga0210404_10277939Not Available917Open in IMG/M
3300021180|Ga0210396_10516090Not Available1045Open in IMG/M
3300021180|Ga0210396_10637588Not Available924Open in IMG/M
3300021402|Ga0210385_11030627Not Available632Open in IMG/M
3300021404|Ga0210389_10497975Not Available959Open in IMG/M
3300021406|Ga0210386_10599122Not Available952Open in IMG/M
3300021420|Ga0210394_10637614Not Available936Open in IMG/M
3300021433|Ga0210391_10172372All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1703Open in IMG/M
3300021433|Ga0210391_11012319Not Available647Open in IMG/M
3300021474|Ga0210390_10932255Not Available713Open in IMG/M
3300021475|Ga0210392_10761761Not Available722Open in IMG/M
3300022873|Ga0224550_1034304Not Available723Open in IMG/M
3300025903|Ga0207680_10118751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli1726Open in IMG/M
3300025911|Ga0207654_10135508Not Available1564Open in IMG/M
3300025913|Ga0207695_10333069Not Available1406Open in IMG/M
3300025914|Ga0207671_10177540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli1656Open in IMG/M
3300025914|Ga0207671_10641689Not Available846Open in IMG/M
3300025921|Ga0207652_10124533All Organisms → cellular organisms → Bacteria2295Open in IMG/M
3300025927|Ga0207687_11788221Not Available526Open in IMG/M
3300025928|Ga0207700_11089179Not Available714Open in IMG/M
3300026041|Ga0207639_11553090Not Available621Open in IMG/M
3300027652|Ga0209007_1076191Not Available846Open in IMG/M
3300027807|Ga0209208_10077174All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium2477Open in IMG/M
3300027807|Ga0209208_10101183All Organisms → cellular organisms → Bacteria → Proteobacteria1955Open in IMG/M
3300027855|Ga0209693_10444184Not Available624Open in IMG/M
3300027860|Ga0209611_10575857Not Available624Open in IMG/M
3300027860|Ga0209611_10626067Not Available591Open in IMG/M
3300027889|Ga0209380_10569966Not Available657Open in IMG/M
3300027908|Ga0209006_11041596Not Available649Open in IMG/M
3300028731|Ga0302301_1146052Not Available589Open in IMG/M
3300028773|Ga0302234_10262275Not Available743Open in IMG/M
3300028783|Ga0302279_10307718Not Available694Open in IMG/M
3300028795|Ga0302227_10293488Not Available619Open in IMG/M
3300028813|Ga0302157_10027622All Organisms → cellular organisms → Bacteria4471Open in IMG/M
3300028871|Ga0302230_10320137Not Available601Open in IMG/M
3300028882|Ga0302154_10415559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium phaseoli646Open in IMG/M
3300029883|Ga0311327_10665843Not Available619Open in IMG/M
3300029951|Ga0311371_10515512Not Available1571Open in IMG/M
3300029952|Ga0311346_10199198Not Available2243Open in IMG/M
3300029999|Ga0311339_10630602Not Available1062Open in IMG/M
3300030007|Ga0311338_11575658Not Available602Open in IMG/M
3300030503|Ga0311370_10542101All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium1412Open in IMG/M
3300030503|Ga0311370_10692780Not Available1198Open in IMG/M
3300030520|Ga0311372_10813275Not Available1275Open in IMG/M
3300030580|Ga0311355_11874180Not Available507Open in IMG/M
3300030618|Ga0311354_10180088All Organisms → cellular organisms → Bacteria2278Open in IMG/M
3300030693|Ga0302313_10325835Not Available612Open in IMG/M
3300030906|Ga0302314_10226730All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium2253Open in IMG/M
3300030906|Ga0302314_10483254Not Available1338Open in IMG/M
3300031231|Ga0170824_115975492Not Available945Open in IMG/M
3300031233|Ga0302307_10717011Not Available501Open in IMG/M
3300031236|Ga0302324_100758763Not Available1358Open in IMG/M
3300031236|Ga0302324_101365708Not Available930Open in IMG/M
3300031236|Ga0302324_103152602Not Available544Open in IMG/M
3300031261|Ga0302140_10827220Not Available658Open in IMG/M
3300031525|Ga0302326_11904620Not Available773Open in IMG/M
3300031708|Ga0310686_107675069All Organisms → cellular organisms → Bacteria9805Open in IMG/M
3300031708|Ga0310686_113305466Not Available611Open in IMG/M
3300031708|Ga0310686_118421346All Organisms → cellular organisms → Bacteria1422Open in IMG/M
3300031726|Ga0302321_101580929Not Available757Open in IMG/M
3300031744|Ga0306918_10753083Not Available761Open in IMG/M
3300031823|Ga0307478_10359191Not Available1201Open in IMG/M
3300031823|Ga0307478_11656867Not Available528Open in IMG/M
3300031942|Ga0310916_10493008Not Available1043Open in IMG/M
3300031946|Ga0310910_10180634All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300031962|Ga0307479_10651404Not Available1034Open in IMG/M
3300032066|Ga0318514_10202470Not Available1040Open in IMG/M
3300032783|Ga0335079_11803044Not Available595Open in IMG/M
3300032829|Ga0335070_11020545Not Available763Open in IMG/M
3300032896|Ga0335075_10108159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3611Open in IMG/M
3300032897|Ga0335071_11242922Not Available690Open in IMG/M
3300032955|Ga0335076_10156933All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium2190Open in IMG/M
3300033134|Ga0335073_10012946All Organisms → cellular organisms → Bacteria → Proteobacteria11689Open in IMG/M
3300034124|Ga0370483_0028676Not Available1682Open in IMG/M
3300034163|Ga0370515_0019229Not Available3156Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa13.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.87%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated7.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere7.24%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.26%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.95%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.95%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.29%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.63%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.97%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.32%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.32%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.66%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.66%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.66%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.66%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.66%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.66%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.66%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.66%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.66%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.66%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005260Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, AustraliaEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009510Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027807Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028731Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030693Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1025823713300001593Forest SoilMSEEEARELLDSAKSDEHHSLAVPKGPRNPNDPDNVLKNW*
JGIcombinedJ26739_10030706413300002245Forest SoilMSAEEARELLDSEKSDEHHSLAAPVGPRNPDQAPDKAFKNW*
JGIcombinedJ51221_1005130313300003505Forest SoilLADNQREPGQMSEEEARELLDSAKSDEHHSLAVPSGPRKPNDPDNVLKNW*
Ga0062384_10099320123300004082Bog Forest SoilMAENQREPGQMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW*
Ga0062389_10210760923300004092Bog Forest SoilMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW*
Ga0062389_10399874223300004092Bog Forest SoilMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNALKNW*
Ga0074072_1000022763300005260SoilMSREEANALLNSAKSDEHHSLLVPSGPRPPDLSPDEPFKNW*
Ga0070683_10243455613300005329Corn RhizospherePGQMGVEDARALLDSAKSEERHSLPVPSGPRDPDQPDKPFKNW*
Ga0070661_10110301823300005344Corn RhizosphereMSAEEANALLNSAKSDEHHSLLVPSGPRPPDSSPDKPFKNW*
Ga0070671_10063004613300005355Switchgrass RhizosphereGQMSVEEANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNW*
Ga0070667_10037832823300005367Switchgrass RhizosphereMSADEARELLDSAKSDEHHSLLVPSGPRDPDQAPDKPFKNW*
Ga0070667_10078708823300005367Switchgrass RhizosphereMSVEEANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNW*
Ga0070667_10158870123300005367Switchgrass RhizosphereGQMSVEEANALLNSAKSDEHHSLLVPSGPQSPDLSPDKPFKNW*
Ga0070734_1068651123300005533Surface SoilMTPEEARELLDSAKSDEHQSLAVPSGPRDPNQPDKPFKNW*
Ga0070761_1069683913300005591SoilEEARELLDSEKSDEHHSLAVPAGPRTPDQTPDPLKNW*
Ga0070762_1097160523300005602SoilMSAEEARELLDSAKSDEHHSLAVPSGPRDPDSTPDKPFKNW*
Ga0068856_10143250823300005614Corn RhizosphereMTPEEARELLDSAKSDEHRSLAVPAGPRDPDQSDKPFKNW*
Ga0068856_10215793123300005614Corn RhizosphereMSAEEARGLLDSAKSDEHHSLPTPAGPRDPRNPDKPYKNW*
Ga0070764_1009205923300005712SoilGQQAPGQMSPEEARELLDSAKSDEHHSLGVPAGPRDPDQPPDKPFKNW*
Ga0068851_1106132223300005834Corn RhizosphereMSVEEANALLNSAKSDEHHSLLVPSGPQSPDLSPDKPFKNW*
Ga0070766_1044451313300005921SoilRSPGQMSAEEARELLDSAKSDEHHSLAVPSGPRDPDQTPDKPFKNW*
Ga0066788_1014178833300005944SoilMTREEARELLDSAKGDEHHSLGVPIGNRDPNIPTDKPYKNW
Ga0070717_1161131223300006028Corn, Switchgrass And Miscanthus RhizosphereEEARELLDSAKSEEHHSLAVPAGPRDPDQSADKPLKNW*
Ga0070765_10040791323300006176SoilSPEEARELLDSAKSDEHHSLGVPAGPRDPDQPPDKPFKNW*
Ga0097621_10017900923300006237Miscanthus RhizosphereMSAEEARGLLDSAKSDERHALPAPAAPRDPQTPDKPYRNW*
Ga0105240_1169205813300009093Corn RhizosphereMSVEEANDLLNSAKSDEHHSLLVPSGPRPPDLSPDEPFKNW*
Ga0105240_1204199823300009093Corn RhizosphereGSPGQMSVEEANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNW*
Ga0105247_1012355813300009101Switchgrass RhizosphereMSVEEANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNS*
Ga0105241_1039377213300009174Corn RhizosphereMSAEEANALLNSAKSDEHHSLLVPSGPRPPDLSPDKPFKNW*
Ga0116229_1038404213300009500Host-AssociatedMSQEEARELLDSAKSDEHHFLGAPLDRRDPDNAPDKPFKNW*
Ga0116229_1065082623300009500Host-AssociatedMSQEEARELLDSAKSDEHHFLSAPVDRRDQDNSPDKPFKNW*
Ga0116229_1067994523300009500Host-AssociatedMSQEEARELLDSAKADEHHFLGAPLDRRDPDNTPEKPFKNW*
Ga0116229_1086312923300009500Host-AssociatedTAQDQPGQMSQEEARELLDSAKADEHHVLGAPLDRRDPDNTPEKPFKNW*
Ga0116229_1109033423300009500Host-AssociatedQDQPGQMSQEEARELLDSAKADEHHILGAPLDRRDPDDTPDKPFKNW*
Ga0116229_1161835013300009500Host-AssociatedMSEEEARELLDSAKSDEHHSLAVPQDPRNPNDPDKAFKNW*
Ga0116230_1100774123300009510Host-AssociatedMSQEEARELLDSAKSDEHHFLGAPRDRRDQDDSPDKPFKNW*
Ga0105237_1051517523300009545Corn RhizosphereMSVEEANDLLNSAKSDEHHSLLVPSGPRPPDLSPDKPFKNW*
Ga0105238_1115590313300009551Corn RhizospherePAEARALLDSAKSDEHPSLMAPAGPRAPDSTPDKPIKNW*
Ga0116129_1001247143300009633PeatlandMSPEEARELLDSAKTDEHHFLGAPLDRRDPDNSPDKPFKNW*
Ga0116227_1002001593300009709Host-AssociatedMSQEEARELLDSAKADEHHFLGAPLDNREHDNTPDKPFKNW*
Ga0123355_1040752523300009826Termite GutMSAEEASQLLDSARSDERHSLFVPSGPRDPDPARDKAFKDW*
Ga0126373_1024641413300010048Tropical Forest SoilMEEASQDAPGQMSPEEARELLDSAKSDEHHALLVPSGPRDPDPDKPFKNW*
Ga0134125_1013508123300010371Terrestrial SoilMSAEDARELLDSAKSEERHSLPVPLGPRDPHQPDKPFKNW*
Ga0134125_1104085523300010371Terrestrial SoilMSADEARELLDSAKSDEHQSLLVPSGPRDPDQAPDKPFKNW*
Ga0134125_1115091213300010371Terrestrial SoilMSAEDARELLDSAKSEERHSLPVPSGPQDPHQPDKPFKNW*
Ga0134128_1014006433300010373Terrestrial SoilMTPEEARQLLDSAKSDEHNSLAVPAGPRNPNQPDKPFKNW*
Ga0134128_1119956113300010373Terrestrial SoilMSAEDARELLDSAKSEERHSLPVPSGPRDPHQPDKPFKNW
Ga0105239_1019521723300010375Corn RhizosphereMTPEEARELLDSAKSDEHRSLAVPAGPRDPDQPDKPFKNW*
Ga0105239_1228248023300010375Corn RhizosphereMSADEARELLDSAKSDEHQSLLVPSGPRDPDQPPDKPFKNW*
Ga0126381_10397667513300010376Tropical Forest SoilMEAAGHDAPGQMSPEEARELLDSAKSDEHHSLLVPSDPRDPDPDKPFKNW*
Ga0126381_10425683723300010376Tropical Forest SoilMSAEEARELLDSEKSDEHHPLAVPSGPRDPNPPDKPVKDW*
Ga0134126_1101732513300010396Terrestrial SoilMSAEDARELLDSAKSEERHSLPVPAGPRDPTPEKSFKNW*
Ga0134126_1212064223300010396Terrestrial SoilMSPEEARELLDSAKSDEHHSLLVPTGPRDPNQPEKAIKNW*
Ga0134126_1235151823300010396Terrestrial SoilMSAEDARELLDSAKSEERNSLPVPAGPRDPTPEKPFKNW*
Ga0105246_1195686123300011119Miscanthus RhizosphereMSVEEANALLNSAKSDEHHSLLVPSGPQPPELSPDKPFKNW*
Ga0137407_1045251113300012930Vadose Zone SoilGQMSVDEAHQLLDSAKSDEHHSLLVPSGPRAPDSTPEKAFKNW*
Ga0157370_1084624923300013104Corn RhizosphereEARGLLDSAKSDEHHSLPTPAGPRDPRNPDKPYKNW*
Ga0181534_1000153023300014168BogMSREEANALLNSAKSDEHHSLLVPSGPRPPDLSPDKPFKNW*
Ga0181534_1029831423300014168BogMSREEARELLDSAKSDEHHFLGAPLDRRDQDNSPDKPFKNW*
Ga0181531_1022589323300014169BogMSVAEARELLDSAKSDEHQSLGVPSGPRDPDQTPDKPFKNW*
Ga0181537_1037182323300014201BogMSEEEARELLDSAKSDEHHSLAVPAGPRNPNDTDNVLKNW*
Ga0181537_1059554823300014201BogMSVEEARELLDSAKSDEHHSLGVPSGPRDPNDAPEKAFKNW*
Ga0181537_1093680623300014201BogMSEEEARELLDSAKSDEHQSLAVPSGPRDPNDPDKVFKNW*
Ga0163163_1238791413300014325Switchgrass RhizosphereMSADEARELLDSAKSDEHQSLLAPSGPRDPDQAPDKPFKNW*
Ga0182015_1080750723300014495PalsaQGDEGDDQRPAGQMSAEEARELLDSEKSDEHHSLAVPAGPRNPYQAPDQALKNW*
Ga0182024_1005074723300014501PermafrostMSQEEARELLDSAKSDEHHFLGAPLDRRDQDTSPDKPFKNW*
Ga0181516_1038523123300014655BogMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDTDKVFKNW*
Ga0182030_1016390633300014838BogMSAEEARELLDSEKSDEHRSLGVPLIPRNPDQAPDKAFKNW*
Ga0137412_1017260333300015242Vadose Zone SoilMSAEEARELLDSAKSDEHHSLVVPAGPRDPNLPPDKPFKNW*
Ga0182033_1190512823300016319SoilMEAARHDAPGQMSPEEARQLLDSAKSDEHHSLLVPSGSQDPDADKPLKNW
Ga0182039_1210502923300016422SoilMEAANHDGQMSPEEARELLDSAKSDEHHSLLVPSGPRDPDPDKPFK
Ga0187847_1012134313300017948PeatlandSDADDGHTAENQRPPGQMSVEDARELLDSAKSDEHHSLAVPSGPRDPDQAPDKAFKNW
Ga0187779_1038960513300017959Tropical PeatlandGDGTPGQMSPEEARELLDSAKSDEHHPLLAPSGPRDPDPDKPFKDW
Ga0182031_103828313300019787BogPGQMSQEEEARELLDSAKSDEHHFLGAPLDSRDPDNRPDKPFKNW
Ga0137408_138810543300019789Vadose Zone SoilPPAQSGSTEADDQRAPGQMSVEEAHQLLDSAKSDEHHSFLVPSGPRAPDSTPDKAIKNW
Ga0179590_112929313300020140Vadose Zone SoilMSAEEARELLDSAKSDEHHSLAVPAGPRDPDLPPDKPFKNW
Ga0210395_1031651223300020582SoilMSEEEARELLDSAKSDEHHSLAVPSGPRKPNDPDNVLKNW
Ga0210404_1027793923300021088SoilMSAEEARELLDSAKSDEHHSLAVPAGPRDPNLPPDKPFKNW
Ga0210396_1051609023300021180SoilMSAEEARELLDSAKSDEHHSLLVPSGPRDPDTTPDKPFKNW
Ga0210396_1063758833300021180SoilPPPDAPARAPGQMSAEEARELLDSAKSDEHHSLAVPAGPRDPNLPPDKPFKNW
Ga0210385_1103062723300021402SoilRELLDSAKSDEHHFLGAPLDRRDQDNTPDKPYKNW
Ga0210389_1049797513300021404SoilREPGQMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVSKNW
Ga0210386_1059912223300021406SoilMTPEEARELLDSAKSEEHQSLAVPAGPRDPNQPPDKPFKNW
Ga0210394_1063761423300021420SoilPPDAPARAPGQMSAEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW
Ga0210391_1017237213300021433SoilGQMSAEEARELLDSAKSEEHHSLAVPAGPRDPDQSPDKPFKNW
Ga0210391_1101231923300021433SoilGQMSVEEARELLDSAKSDEHHSLGVPSGPRDPNDAPDKAFKNW
Ga0210390_1093225523300021474SoilQAQADSQQAPGQMSPEDARALLDSAKSDEHHSLAVPAGPRDPNQLDKPFKNW
Ga0210392_1076176123300021475SoilQMSAEEARELLDSAKSDEHASLLVPSGPQNPDPAPDKAFKNW
Ga0224550_103430423300022873SoilGQMSAEEARELLDSAKSDEHHSLAVPSGPRDPDQTPDKPFKNW
Ga0207680_1011875123300025903Switchgrass RhizosphereMSVEEANALLNSAKSDEHHSLLVPSGPQSPDLSPDKPFKNW
Ga0207654_1013550813300025911Corn RhizosphereMSVEEANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNW
Ga0207695_1033306923300025913Corn RhizosphereMSAEEANALLNSAKSDEHHSLLVPSGPRPPDSSPDKPFKNW
Ga0207671_1017754033300025914Corn RhizosphereMSVEEANALLNSAKSDEHHSLLVPSGSQPPDLSPDKPFKNW
Ga0207671_1064168923300025914Corn RhizosphereMSADEARELLDSAKSDEHHSLLVPSGPRDPDQAPDKPFKNW
Ga0207652_1012453313300025921Corn RhizosphereGQRGPGQMGVEDARALLDSAKSEERHSLPVPSGPRDPDQPDKPFKNW
Ga0207687_1178822113300025927Miscanthus RhizosphereMSAADARDLLDSAKSDEKHSLLVPSGPRTPDSTPDKPFKNW
Ga0207700_1108917913300025928Corn, Switchgrass And Miscanthus RhizosphereARGLLDSAKSDEHHSLPTQAGPRDPRNPDKPYKNW
Ga0207639_1155309023300026041Corn RhizosphereANALLNSAKSDEHHSLLVPSGPQPPDLSPDKPFKNW
Ga0209007_107619123300027652Forest SoilMSAEEARELLDSAKSDEHHSLAVPSGPRDPDQTPDKPFKNW
Ga0209208_1007717423300027807Host-AssociatedMSQEEARELLDSAKSDEHHFLGAPRDRRDQDDSPDKPFKNW
Ga0209208_1010118333300027807Host-AssociatedMSQEEARELLDSAKADEHHFLGAPLDRRDPDNTPEKPFKNW
Ga0209693_1044418413300027855SoilRPPGQMSPEEARELLDSEKSDEHHSLAVPAGPRTPDQAPDALKNW
Ga0209611_1057585723300027860Host-AssociatedMSQEEARELLDSAKSDEHHFLSAPVDRRDQDNSPDKPFKNW
Ga0209611_1062606723300027860Host-AssociatedEEARELLDSAKADEHHILGAPLDRRDPDDTPDKPFKNW
Ga0209380_1056996623300027889SoilRSPGQMSAEEARELLDSAKSDEHHSLAVPSGPRDPDQTPDKPFKNW
Ga0209006_1104159623300027908Forest SoilMSPEEARELLDSAKSDEHHSLGVPAGPRDPDQPPDKPFKNW
Ga0302301_114605213300028731PalsaEEARELLDSEKSDEHHSLAAPVGPRNPDQPPDKAFKNW
Ga0302234_1026227513300028773PalsaPGQMSEEEARELLDSAKSDEHHSLAVPSGPRSPNDPDNVLKNW
Ga0302279_1030771823300028783BogPPDQRSPGQMSPEEARELLDSEKSEEHHSLAAPSGPRNPDQAPDKALKDW
Ga0302227_1029348823300028795PalsaEGNDQRPPGQMSAEEARELLDSEKSDEHHSLAVPSGPRNPDQALDKAFKNW
Ga0302157_1002762243300028813BogMSPEEARELLDSEKSEEHHSLAAPSGPRNPDQAPDKALKDW
Ga0302230_1032013713300028871PalsaRELLDSEKSDEHHSLAVPSGPRNPDQALDKAFKNW
Ga0302154_1041555923300028882BogMSQEEARELLDSAKADEHHFLGAPLDRRDADDTPEKPFKNW
Ga0311327_1066584323300029883BogMSAEEARELLDSEKSDEHRSLGVPLIPRNPDQAPDKAFKNW
Ga0311371_1051551223300029951PalsaMSEEEARELLDSAKSDEHHSLAVPSGPRSPNDPDNVLKNW
Ga0311346_1019919813300029952BogPPPEQQRQPGQMSAEEARELLDSEKSDEHRSLGVPLIPRNPDQAPDKAFKNW
Ga0311339_1063060223300029999PalsaMSPEEARELLDSAKSDEHHFLGAPLDRRDQDNSPDKPFKNW
Ga0311338_1157565813300030007PalsaNQRQPGQMSEDEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW
Ga0311370_1054210123300030503PalsaSGNGQMSVEEARELLDSAKSDEHHSLGVPSGPRDPNDAPDKAFKNW
Ga0311370_1069278013300030503PalsaRQAADTQPPPGQMNAEEARELLDSAKSEEHHSLTVPSGPRDPNQPPDKAFKNW
Ga0311372_1081327533300030520PalsaMSPEEARELLDSAKSDEHHSLAVPAGPRDPDQPPDKPFKNW
Ga0311355_1187418013300030580PalsaEANDQRLPGQMSAEEARELLDSEKQDEHPSLAVPTGPRNPDQPPDKAFKNW
Ga0311354_1018008833300030618PalsaGSQAENQRQPGQMSEDEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW
Ga0302313_1032583513300030693PalsaPPGQMSVEEASELLDSAKSDEHHSLAVPSGPRDPDQSPDKAFKNW
Ga0302314_1022673033300030906PalsaQQAPGQMSPEDARALLDSAKSDEHHSLAVPAGPRDPNQPPDKPFKNW
Ga0302314_1048325423300030906PalsaQAAETQRPPGQMSVEEASELLDSAKSDEHHSLAVPSGPRDPDQSPDKAFKNW
Ga0170824_11597549213300031231Forest SoilENQGAPGQMTPEEARQLLDSAKSDEHNSLAVPAGPRNPNQPDKPVKNW
Ga0302307_1071701123300031233PalsaQGDEGDDQRPAGQMSAEEARELLDSEKSDEHHSLAVPAGPRNPEQAPDQALKNW
Ga0302324_10075876313300031236PalsaEADKSVAENQREPGQMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW
Ga0302324_10136570813300031236PalsaGQMSAEEARELLDSAKSDEHHSLAAPAGPRDPDQTPDKAFKNW
Ga0302324_10315260223300031236PalsaMSQEDARELLDSAKSDEHHFLGAPLDRRDQDTSPDKPFKNW
Ga0302140_1082722023300031261BogPPPEQRAPGQMSPEEARELLDSEKSDEHHSLAAPSGPRNPDQAPDKALKDW
Ga0302326_1190462013300031525PalsaDEADKSVAENQREPGQMSEEEARELLDSAKSDEHHSLAVPSGPRNPNDPDNVLKNW
Ga0310686_107675069103300031708SoilMTAQDARELLDSAKSDEHHSLGVPAGPRNPDQSPDKPFKNW
Ga0310686_11330546623300031708SoilMSPEEARELLDSAKSDEHHSLAVPSGPRDPNQPDKPFKNW
Ga0310686_11842134623300031708SoilMSPEEARELLDSAKSEEHHSLAVLTGPRDPDQSPDKPFKNW
Ga0302321_10158092913300031726FenPGQMSVDEAHQLLDSAKADEHHSLLVPSGPRAPDSTPDKAFKNW
Ga0306918_1075308313300031744SoilEAASDEAPGQMSPEEARELLDSAKSDEHHSLMVPSGPRDPDLDKPFKNW
Ga0307478_1035919123300031823Hardwood Forest SoilMSEEEARELLDSAKSDEHHSLAVPKGPRNPNEPDNVLKNW
Ga0307478_1165686713300031823Hardwood Forest SoilMSAAEARDLLDSAKSDEHHSLLVPSGPLNPNAEPDKPFKNW
Ga0310916_1049300813300031942SoilQGATGQMSPEEARELLDSAKSDEHHSLLVPSGPRDPDPDKPFKNW
Ga0310910_1018063413300031946SoilMSPEEARELLDSAKSDEHHSLLVPSGPRDPDPDKPFKNW
Ga0307479_1065140423300031962Hardwood Forest SoilMSPEEARELLDSAKSEEHQSLAVPAGPRDPNQAPDKPFKNW
Ga0318514_1020247013300032066SoilPGQMSPEEARELLDSAKSDEHHSLMVPSGPRDPDPDKPFKNW
Ga0335079_1180304413300032783SoilQTQSGQMSGEEARELLDSAKSDEHRSLLVPSGPRDPDAPDTVLKNW
Ga0335070_1102054523300032829SoilGSMSPEEARELLDSAKADEHHSLGLAGPRNPDPRADKPRKDW
Ga0335075_1010815943300032896SoilMSADEARELLDSAKADEHHSLPVPTGPRDPDPDKPYKNW
Ga0335071_1124292223300032897SoilARELLDSAKADEHHSLGLAGPRNPDPRADKPRKDW
Ga0335076_1015693323300032955SoilMSAAEARELLDSAKSDERRSLLVPSGPRNPDSTPDKAFKNW
Ga0335073_10012946123300033134SoilMSSEDARELLDSAKSDEHPSLLVPSGPRDPDPPDKPFRNW
Ga0370483_0028676_1508_16333300034124Untreated Peat SoilMSAEEARELLDSEKSDEHQSLAVPSGPRNPDQAPDKAFKNW
Ga0370515_0019229_320_4453300034163Untreated Peat SoilMSAEEARELLDSEKSDEHHSLAVPSGPRNPDQAPDKAFKNW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.