NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045932

Metagenome / Metatranscriptome Family F045932

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045932
Family Type Metagenome / Metatranscriptome
Number of Sequences 152
Average Sequence Length 40 residues
Representative Sequence RARLDENEKWMAYLDANFQRQQAQLDLLRTAGQLDKVWQ
Number of Associated Samples 127
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.97 %
% of genes near scaffold ends (potentially truncated) 97.37 %
% of genes from short scaffolds (< 2000 bps) 90.79 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.632 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(17.763 % of family members)
Environment Ontology (ENVO) Unclassified
(34.211 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.237 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.22%    β-sheet: 0.00%    Coil/Unstructured: 44.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF00282Pyridoxal_deC 46.71
PF02321OEP 2.63
PF04055Radical_SAM 1.97
PF02310B12-binding 1.97
PF00072Response_reg 0.66
PF09339HTH_IclR 0.66
PF03625DUF302 0.66
PF07732Cu-oxidase_3 0.66
PF00155Aminotran_1_2 0.66
PF13506Glyco_transf_21 0.66
PF13580SIS_2 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 46.71
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 5.26
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.66
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.63 %
UnclassifiedrootN/A22.37 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_104787985All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300004091|Ga0062387_101323734All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300004152|Ga0062386_100195470All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300005162|Ga0066814_10094685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia552Open in IMG/M
3300005435|Ga0070714_102336312All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005437|Ga0070710_10378016All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300005468|Ga0070707_100389062All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300005536|Ga0070697_100352927All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300005555|Ga0066692_10692902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae632Open in IMG/M
3300005555|Ga0066692_10863406All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005556|Ga0066707_10932760All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005557|Ga0066704_10359123All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300005575|Ga0066702_10454311All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300005610|Ga0070763_10159204All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300006046|Ga0066652_101169742All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300006174|Ga0075014_100419964All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300006176|Ga0070765_101018911All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300006797|Ga0066659_11904611All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300006806|Ga0079220_11384376All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300009012|Ga0066710_100345936All Organisms → cellular organisms → Bacteria2196Open in IMG/M
3300009012|Ga0066710_102910104All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria671Open in IMG/M
3300009038|Ga0099829_10726132All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300009038|Ga0099829_10840528All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300009088|Ga0099830_10608678All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300009089|Ga0099828_10323368All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300009177|Ga0105248_11226651All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300009615|Ga0116103_1026558Not Available1794Open in IMG/M
3300009792|Ga0126374_10278056All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300009792|Ga0126374_10391879All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300009792|Ga0126374_10512833All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300009792|Ga0126374_11861910All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300010043|Ga0126380_12004359All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300010048|Ga0126373_10655321All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300010048|Ga0126373_12209744All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300010159|Ga0099796_10269819All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300010321|Ga0134067_10395019Not Available553Open in IMG/M
3300010339|Ga0074046_10102569Not Available1846Open in IMG/M
3300010343|Ga0074044_10603316All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium716Open in IMG/M
3300010358|Ga0126370_10361482All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300010358|Ga0126370_11652276Not Available615Open in IMG/M
3300010359|Ga0126376_10005504All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7583Open in IMG/M
3300010360|Ga0126372_10309634All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300010360|Ga0126372_11640119Not Available683Open in IMG/M
3300010360|Ga0126372_11735033All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300010361|Ga0126378_10839737All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300010361|Ga0126378_12253170Not Available622Open in IMG/M
3300010362|Ga0126377_11347980All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300010376|Ga0126381_102234641All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300010880|Ga0126350_12229619Not Available567Open in IMG/M
3300011269|Ga0137392_10011847All Organisms → cellular organisms → Bacteria5831Open in IMG/M
3300012201|Ga0137365_10564916All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300012202|Ga0137363_10745971All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300012203|Ga0137399_10218765Not Available1553Open in IMG/M
3300012206|Ga0137380_11234197All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300012285|Ga0137370_10456095All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300012359|Ga0137385_10063231All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3296Open in IMG/M
3300012361|Ga0137360_10255202All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300012361|Ga0137360_11132265All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300012363|Ga0137390_10361742All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300012582|Ga0137358_10129432Not Available1716Open in IMG/M
3300012582|Ga0137358_10962259Not Available555Open in IMG/M
3300012685|Ga0137397_10086436All Organisms → cellular organisms → Bacteria2285Open in IMG/M
3300012925|Ga0137419_11799862All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300012927|Ga0137416_11530923Not Available606Open in IMG/M
3300012929|Ga0137404_11321299Not Available665Open in IMG/M
3300012930|Ga0137407_11324555All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300012931|Ga0153915_13478622Not Available510Open in IMG/M
3300012971|Ga0126369_11603438All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300012971|Ga0126369_12618719Not Available589Open in IMG/M
3300015245|Ga0137409_10181966All Organisms → cellular organisms → Bacteria1903Open in IMG/M
3300015357|Ga0134072_10034584All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300015359|Ga0134085_10562485Not Available527Open in IMG/M
3300016341|Ga0182035_10006664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6513Open in IMG/M
3300016387|Ga0182040_11330618Not Available607Open in IMG/M
3300016422|Ga0182039_10615727All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300016422|Ga0182039_11129064All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300016730|Ga0181515_1189816All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300017933|Ga0187801_10314113All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300017943|Ga0187819_10553459All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300017966|Ga0187776_10882397All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300017975|Ga0187782_11342682All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300018088|Ga0187771_10519399All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300018468|Ga0066662_11481873All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria705Open in IMG/M
3300019882|Ga0193713_1087637All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300019885|Ga0193747_1026629All Organisms → cellular organisms → Bacteria → Acidobacteria1432Open in IMG/M
3300020021|Ga0193726_1081500All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300020021|Ga0193726_1139982All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300020062|Ga0193724_1036848All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300020579|Ga0210407_10388901All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300020581|Ga0210399_11066800Not Available648Open in IMG/M
3300020582|Ga0210395_10235950All Organisms → cellular organisms → Bacteria1374Open in IMG/M
3300020583|Ga0210401_10696999All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300020583|Ga0210401_11239534Not Available604Open in IMG/M
3300021086|Ga0179596_10178489All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300021170|Ga0210400_11173060Not Available619Open in IMG/M
3300021405|Ga0210387_10269098All Organisms → cellular organisms → Bacteria1494Open in IMG/M
3300021405|Ga0210387_10722441All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300021407|Ga0210383_11573242Not Available542Open in IMG/M
3300021474|Ga0210390_10590209All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300021475|Ga0210392_10277117All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300021478|Ga0210402_10814911All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300021479|Ga0210410_10120685All Organisms → cellular organisms → Bacteria2324Open in IMG/M
3300021559|Ga0210409_11352952Not Available588Open in IMG/M
3300022557|Ga0212123_10238125All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300024186|Ga0247688_1024775All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300024325|Ga0247678_1023240All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300025906|Ga0207699_10270395All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300025922|Ga0207646_10333543All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300026308|Ga0209265_1156509All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300026314|Ga0209268_1016028All Organisms → cellular organisms → Bacteria2852Open in IMG/M
3300026322|Ga0209687_1014808All Organisms → cellular organisms → Bacteria2572Open in IMG/M
3300026475|Ga0257147_1004781Not Available1648Open in IMG/M
3300026475|Ga0257147_1021652All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300026490|Ga0257153_1022361All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300026499|Ga0257181_1076743All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300026529|Ga0209806_1126666All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300026551|Ga0209648_10004789All Organisms → cellular organisms → Bacteria11517Open in IMG/M
3300026557|Ga0179587_10582672All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300027014|Ga0207815_1032789All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300027480|Ga0208993_1108106Not Available508Open in IMG/M
3300027651|Ga0209217_1033544Not Available1599Open in IMG/M
3300027680|Ga0207826_1182397All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300027846|Ga0209180_10113151All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300027846|Ga0209180_10392946All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300027853|Ga0209274_10362331All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300027908|Ga0209006_10836334All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300028906|Ga0308309_10205248Not Available1626Open in IMG/M
3300031128|Ga0170823_17087627Not Available831Open in IMG/M
3300031231|Ga0170824_115147035Not Available594Open in IMG/M
3300031231|Ga0170824_121638083All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300031247|Ga0265340_10458032Not Available562Open in IMG/M
3300031469|Ga0170819_16484084Not Available1751Open in IMG/M
3300031474|Ga0170818_100234795All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300031708|Ga0310686_101679706Not Available2403Open in IMG/M
3300031718|Ga0307474_10499557All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300031718|Ga0307474_10503020All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300031719|Ga0306917_11591640Not Available501Open in IMG/M
3300031754|Ga0307475_10468406All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300031796|Ga0318576_10019068All Organisms → cellular organisms → Bacteria2695Open in IMG/M
3300031890|Ga0306925_10939719All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300031910|Ga0306923_11035127All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300031910|Ga0306923_11936814Not Available600Open in IMG/M
3300031942|Ga0310916_10571331All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300031962|Ga0307479_10011752All Organisms → cellular organisms → Bacteria → Acidobacteria8174Open in IMG/M
3300032035|Ga0310911_10367642All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300032035|Ga0310911_10459253All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium738Open in IMG/M
3300032076|Ga0306924_10582428All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300032180|Ga0307471_100001192All Organisms → cellular organisms → Bacteria14096Open in IMG/M
3300032180|Ga0307471_101284844All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300032205|Ga0307472_102115240Not Available566Open in IMG/M
3300033004|Ga0335084_10294281Not Available1679Open in IMG/M
3300033405|Ga0326727_10411367All Organisms → cellular organisms → Bacteria1233Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.95%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.97%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.97%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.97%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.32%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.32%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.32%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.32%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.66%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.66%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.66%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.66%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.66%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.66%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027014Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10478798523300000559SoilENEKWMALLXXXXQRQQAQLDLLKTAGQLDKVLQ*
Ga0062387_10132373413300004091Bog Forest SoilVEKARLEENEKWMNYLDSNFQRQQAQLDLLRTAGQLDKVLQ*
Ga0062386_10019547013300004152Bog Forest SoilERARLDENEKWMAYLDANFQRQQAQLDLLRTAGQLDKVLQ*
Ga0066814_1009468513300005162SoilVERARLEESNRWMAYLDATFQRQQAQLELLRTAGQLDKVLE*
Ga0070714_10233631213300005435Agricultural SoilINVREVERARLEENDKWMAYLDANFQRQQAQLDLLQTAGQIDKVWQ*
Ga0070710_1037801623300005437Corn, Switchgrass And Miscanthus RhizosphereLPEIEKTRLDENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLQ*
Ga0070707_10038906223300005468Corn, Switchgrass And Miscanthus RhizosphereVREVEKARLEENNRWLAYLDANFQRQQAELDLLQTAGQLDKVWQ*
Ga0070697_10035292723300005536Corn, Switchgrass And Miscanthus RhizosphereEKVRLNENEKWMALLDATFQRQQAQLDLLKTAGQQDKVLQ*
Ga0066692_1069290213300005555SoilARLEENEKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ*
Ga0066692_1086340613300005555SoilKARLDENEKWMGYLDANFLRQQAQLDLLKTAGQLDKVLE*
Ga0066707_1093276013300005556SoilKTNLRDVERARLDESDRWMAYLDATFQRQQAQVELLRTAGQIDKVME*
Ga0066704_1035912313300005557SoilEKVRLNENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLQ*
Ga0066702_1045431123300005575SoilVLEKTRLDENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLQ*
Ga0070763_1015920413300005610SoilERARLDENEKWMAYLDAGFQKQQAQLELLKTAGQLDKVWQ*
Ga0066652_10116974213300006046SoilEENEKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ*
Ga0075014_10041996423300006174WatershedsTAVRDLVARLDENEKWMTYLDANFQRQQAQLELLRTAGQLDRVLQ*
Ga0070765_10101891123300006176SoilDENEKWMSYLDANFQRQQAQLDLLKTAGQLDKVLE*
Ga0066659_1190461113300006797SoilNLRDMEKARLDENDKWMAYLDANFQKQQAQLDLLKTAGQLDKVWQ*
Ga0079220_1138437613300006806Agricultural SoilKARLDENDKWMAYLDANFQKQQAQLDLLKMAGQLDKVWQ*
Ga0066710_10034593613300009012Grasslands SoilKVSVQEIEKVRLNENEKWIALLDATFQRQQAQLDLLKTARQLDTVMQ
Ga0066710_10291010423300009012Grasslands SoilEKARLEENEKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ
Ga0099829_1072613223300009038Vadose Zone SoilLEENEKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ*
Ga0099829_1084052813300009038Vadose Zone SoilNLQEVEKARLDENEKWMALLDATFQRQQAQLNLLKTAGQLDKVLQ*
Ga0099830_1060867813300009088Vadose Zone SoilKLNLREVEKARLEENERWMAYLDANFHKQQAQLELLKTAGQLDKVWQ*
Ga0099828_1032336823300009089Vadose Zone SoilARLEENEKWMHYLDANFQKQQAQLELLKTAGQLDKVWQ*
Ga0105248_1122665123300009177Switchgrass RhizosphereDENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLQ*
Ga0116103_102655833300009615PeatlandERARLDENEKWMAYLDANFQRQQAQLELLRTAGQLDKVLQ*
Ga0126374_1027805623300009792Tropical Forest SoilVEKSRLDENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLQ*
Ga0126374_1039187913300009792Tropical Forest SoilENEKWMAYLEANFRRQQAQLELLRAAGQLDKVLE*
Ga0126374_1051283313300009792Tropical Forest SoilKARLDENDKWMAYLDANFQRQQAQLDLLKAAGQLDTVWQ*
Ga0126374_1186191023300009792Tropical Forest SoilLERARLDENDKWMAYLDTNFQKQQAQLDLLKTAGQLDKVWQ*
Ga0126380_1200435923300010043Tropical Forest SoilLGENDRWMAFLDANFQKQQAQLDLLKTAGQLDKVWQ*
Ga0126373_1065532123300010048Tropical Forest SoilEKARLDENEKWMALLDATFARQQAQLDLLKTAGQLDTVLQ*
Ga0126373_1220974423300010048Tropical Forest SoilLDENEKWMRYLDANFQRQQAQVELLRTAGQLERVLE*
Ga0099796_1026981913300010159Vadose Zone SoilKARLEENNRWLAYLDANFQRQQAQLDLLQTAGQLDKVWQ*
Ga0134067_1039501913300010321Grasslands SoilEVEKARLEENEKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ*
Ga0074046_1010256923300010339Bog Forest SoilRLDENEKWMAYLDANFQRQQAQLELLRTAGQLDKVLQ*
Ga0074044_1060331623300010343Bog Forest SoilLDENEKWMAYLDAGFLRQQAQLELLRTAGQLDKVLQ*
Ga0126370_1036148213300010358Tropical Forest SoilKTRLDENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLE*
Ga0126370_1165227623300010358Tropical Forest SoilEKARLDENDKWMAYLDASFQKQQAQLDLLKTAGQLDKVWQ*
Ga0126376_1000550413300010359Tropical Forest SoilNLRDVERARLEESDRWMAYLDATFQRQQAQVELLRTAGQLDKILE*
Ga0126372_1030963413300010360Tropical Forest SoilARLDENEKWMALLDATFERQQAQLDLLKTAGQLDKVLQ*
Ga0126372_1164011913300010360Tropical Forest SoilEEGKINLRDVERARLEENDRWMAYLDATFQRQQAQVELLRTAGQLDKVLE*
Ga0126372_1173503323300010360Tropical Forest SoilVEKARLEENEKWMAYLDTNFQRQQAQLDLLKTAGQLDKVLQ*
Ga0126378_1083973723300010361Tropical Forest SoilLDENDKWMAYLDANFQRQQAQLDLLKAAGQLDKVWQ*
Ga0126378_1225317013300010361Tropical Forest SoilARLDENDKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ*
Ga0126377_1134798013300010362Tropical Forest SoilRLDESDRWMEYLDTTFKRQQAQLELLRAAGQIDRVLE*
Ga0126381_10223464123300010376Tropical Forest SoilDENDRWMAYLDANFQRQQAQLDLLKAAGQLDTVWQ*
Ga0126350_1222961913300010880Boreal Forest SoilNLREVERARLDENEKWMGYLDANFQRQQAQLDLLKTAGQLDKVWQ*
Ga0137392_1001184773300011269Vadose Zone SoilENEKWMAYLDANFQKQEAQLELLKTAGQLDKVWH*
Ga0137365_1056491623300012201Vadose Zone SoilLEESEKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ*
Ga0137363_1074597123300012202Vadose Zone SoilEKGRLDENEKWMSYLDANFQRQQAQLDLLKTAGQLDKVLE*
Ga0137399_1021876513300012203Vadose Zone SoilEKLRLEENERWMAYLDANFQKQQAQLELLKIAGQLDKVWQ*
Ga0137380_1123419723300012206Vadose Zone SoilKARLEENEKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ*
Ga0137370_1045609513300012285Vadose Zone SoilVQEIEKVRLNENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLQ*
Ga0137385_1006323113300012359Vadose Zone SoilVQEIEKVRLNENEKWMSLLDATFQRQQAQLDLLKTAGQLDKVLQ*
Ga0137360_1025520223300012361Vadose Zone SoilNENEKWMAYLDANFQKQQAQLELLKIAGQLDKVWQ*
Ga0137360_1113226523300012361Vadose Zone SoilREMEKARLNENEKWMAYLDANFQKQQAQLELLKTAGQLDKIWQ*
Ga0137390_1036174223300012363Vadose Zone SoilLDENEKWMALLDASFQRQQAQLDLLKTAGQLDKVLQ*
Ga0137358_1012943213300012582Vadose Zone SoilRLEENEKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ*
Ga0137358_1096225913300012582Vadose Zone SoilVERARLEENDKWMAYLDANFQRQQAQLDLLHTAGQLDKVWQ*
Ga0137397_1008643613300012685Vadose Zone SoilREMEKARLNENEKWMAYLDANFQKQQSQLELLKTAGQLDKVWQ*
Ga0137419_1179986223300012925Vadose Zone SoilQVVEKARLDENEKWMALLDASFQRQQAQLDLLKTAGQLDKVLQ*
Ga0137416_1153092313300012927Vadose Zone SoilRLEENEKWMAYLDANFQKQQAQLELLRTAGQLDKVWQ*
Ga0137404_1132129913300012929Vadose Zone SoilVEKARLEENNRWLAYLDANFQRQQAQLDLLQTAGQLDKVWQ*
Ga0137407_1132455513300012930Vadose Zone SoilENEKWMAYLDANFQRQQAQLDLLKTAGQLDKVWQ*
Ga0153915_1347862213300012931Freshwater WetlandsENEKWMAFLDATFQRQQAQLELLRTAGQLDKVFQ*
Ga0126369_1160343813300012971Tropical Forest SoilLTEVEKTRLDENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLE*
Ga0126369_1261871913300012971Tropical Forest SoilLEESDRWMAYLDATFQRQQAQVELLRTAGQLDKVLE*
Ga0137409_1018196633300015245Vadose Zone SoilRDVERARLEESDRWMAYLDATFQRQQAQVELLRTAGQLDKVLE*
Ga0134072_1003458423300015357Grasslands SoilMEKARLDENDKWMAYLDANFQKQQAQLDLLKTAGQLDKVWQ*
Ga0134085_1056248523300015359Grasslands SoilEKVRLNENEKWMALLDATFQRQQAQLNLLKTAGQLDKVLQ*
Ga0182035_1000666413300016341SoilDENEKWMALLDATFERQRAQLDLLETAGQLDKVLQ
Ga0182040_1133061813300016387SoilRLEENEKWMALLDATFARQQAQLDLLKTAGQLDKILQ
Ga0182039_1061572713300016422SoilRLNENEKWMAYLEANFRKQQAQLELLRSAGQLDKVLE
Ga0182039_1112906423300016422SoilRDVERSRLDESEKWMSYLDANFQRQQAQLELLRIAGQLEKALE
Ga0181515_118981623300016730PeatlandERARLDENEKWMAYLDANFQRQQAQLELLRTAGQLDKVLQ
Ga0187801_1031411323300017933Freshwater SedimentLDENEKWMTYLDANFQRQQAQLELLRIAGQLEKALE
Ga0187819_1055345913300017943Freshwater SedimentKARLDENEKWMAYLDANFQKQQAQLELLKAVGQLDKVWQ
Ga0187776_1088239723300017966Tropical PeatlandLRDMEKARLDENEKWMAYLDANFQKQQSQLDLLKTAGQLDKVWQ
Ga0187782_1134268223300017975Tropical PeatlandARLEENEKWMAYLDANFLRQQAQLELLRTAGQLDKVLQ
Ga0187771_1051939913300018088Tropical PeatlandKANLREVERARLDESEKWMTYLDANFQRQQAQLELLRMAGQLEKVLE
Ga0066662_1148187313300018468Grasslands SoilARLEESDKWMAYLDANFQRQQAQLDLLQTAGQLGKVWQ
Ga0193713_108763713300019882SoilLDENEKWMALLDTTFQRQQAQLDLLKTAGQLDKVLQ
Ga0193747_102662923300019885SoilVTVQEVEKMRLNENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLQ
Ga0193726_108150013300020021SoilKSRLDENEKWLALLDATFQRQQAQLDLLKTAGQLEKVLE
Ga0193726_113998213300020021SoilLAENEKWMLYLDANFQRQQAQLDLLQTAGQLDKVWQ
Ga0193724_103684823300020062SoilLDENEKWMALLDTTFQRQQAQLDLLKSTGQLDKVLQ
Ga0210407_1038890113300020579SoilRVDENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLQ
Ga0210399_1106680023300020581SoilEENDKWMAYLDANFQRQQAQLDLLQTAGQLDKVWQ
Ga0210395_1023595023300020582SoilRARVAENEKWMAYLDANFQRQQAQLDLLQAAGQLDKVWQ
Ga0210401_1069699913300020583SoilSLRDMEKARLDENERWMAYLDANFQRQQAQLELLRTAGQIEKALE
Ga0210401_1123953423300020583SoilEVEKARLEENEKWMAYLDANFQKQQAQLDLLRTAGQLDKVWQ
Ga0179596_1017848913300021086Vadose Zone SoilVEKARLEENEKWMAYLDTNFQKQQAQLELLKTAGQLDKVWQ
Ga0210400_1117306013300021170SoilRARVDESEKWMAYLDANFQRQQAELDLLQTAGQLDKIWQ
Ga0210387_1026909813300021405SoilVEKARLDENEKWMALLDATFQRQQAQLNLLKTAGQLDKVLQ
Ga0210387_1072244123300021405SoilARLDENEKWMAYLDANFGRQQAQLDLLKTAGQLDKVWQ
Ga0210383_1157324213300021407SoilERARLDENEKWMGYLDANFQRQQAQLDLLKTAGQLDKVWQ
Ga0210390_1059020913300021474SoilEESEKWMAFLDANFQRQQAQLDLLKTAGQLDKVWQ
Ga0210392_1027711713300021475SoilLREVERARVTENDRWMDFLDANFARQQAQLELLQTAGQLDKVWQ
Ga0210402_1081491113300021478SoilDENEKWMGYLDANFQRQQAQLDLLKTAGQLDKVWQ
Ga0210410_1012068513300021479SoilEENEKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ
Ga0210409_1135295223300021559SoilRLGENEKWMSYLDANFQRQQAQLDLLKTAGQLDKVLE
Ga0212123_1023812523300022557Iron-Sulfur Acid SpringRARLTENEHWMAYLDANFARQQAQLELLRVAGQLNKVWQ
Ga0247688_102477523300024186SoilEKARLDENEKWMGYLDANFHRQQAQLDLLKTAGQLDKVLQ
Ga0247678_102324013300024325SoilRDVERARLEENDRWMAYLDATFQRQQAQVELLRTAGQIDKVME
Ga0207699_1027039523300025906Corn, Switchgrass And Miscanthus RhizosphereIEKVRLNENEKWMALLDATFQRQQAQLDLLKTAGQLDKVLQ
Ga0207646_1033354323300025922Corn, Switchgrass And Miscanthus RhizosphereVREVEKARLEENNRWLAYLDANFQRQQAELDLLQTAGQLDKVWQ
Ga0209265_115650913300026308SoilINLREVERGRLEENDKWMAYLDANFQRQQAQLELLRAAGQLDTVWQ
Ga0209268_101602813300026314SoilDMERARLDENDKWMAYLDANFQRQQAQLDLLKAAGQLDKVWQ
Ga0209687_101480833300026322SoilEENDKWMAYLDANFQKQQAQLDLLKAAGQLDKVWQ
Ga0257147_100478113300026475SoilVERARLEESDRWMAYLDATFQRQQAQVELLRTAGQLDKVLE
Ga0257147_102165213300026475SoilKGRLDENEKWMSYLDANFQRQQAQLDLLKTAGQLDKVLE
Ga0257153_102236123300026490SoilEKGRLDENEKWMAYLDANFQRQQAQLDLLKTAGQLDKVLE
Ga0257181_107674323300026499SoilLEENDKWMAYLDANFQRQEAQIELLRTAGQLDKVWQ
Ga0209806_112666613300026529SoilGKLNLRDMEKARLEENDKWMAYLDANFQKQQAQLDLLKTAGQLDKVWQ
Ga0209648_1000478913300026551Grasslands SoilRLEENEKWMAYLDANFQKQQAQLELLKTAGQLDKVWQ
Ga0179587_1058267213300026557Vadose Zone SoilRARIDENDKWLAYLDADFGRQQAQLELLRAAGQLDKVWQ
Ga0207815_103278923300027014Tropical Forest SoilKARLEENEKWMLYLDATFQRQQAQLELLRTAGQLEKALE
Ga0208993_110810623300027480Forest SoilRARLTENERWMAYLDATFARQQAQLELLRVAGQLNKVWQ
Ga0209217_103354413300027651Forest SoilRARLTENERWMAYLDANFARQQAQLELLRVAGQLNKVWQ
Ga0207826_118239723300027680Tropical Forest SoilDESEKWMAFLDANFQRQQAQLELLRTAGQLGKALE
Ga0209180_1011315113300027846Vadose Zone SoilMEKARLEESEKWMAYLDANFQRQQAQLDLLRTAGQLDKVWQ
Ga0209180_1039294623300027846Vadose Zone SoilDVERARLEENEKWMLYLDANFQKQQAQLDLLKTAGQLDKVWQ
Ga0209274_1036233123300027853SoilLREVEKARLDENDKWMAYLDANFQRQQAQLDLLRAAGQLDKVWQ
Ga0209006_1083633423300027908Forest SoilVERARVTENEKWMQYLDANFQRQQAQLDLLQAAGQLDKVWQ
Ga0308309_1020524813300028906SoilEVERARLEENEKWMLYLDANFQRQQAQLDLLQTAGQLDKVWQ
Ga0170823_1708762723300031128Forest SoilDVEKARLAENEKWMLYLDANFQRQQAQLDLLQTAGQLDKVWQ
Ga0170824_11514703513300031231Forest SoilKLNLREVERARLTENERWMAYLDANFARQQAQLELLRTAGQLNKVWQ
Ga0170824_12163808323300031231Forest SoilVEKARVDENEKWMALLDATFRRQQAQLDLLNTAGQLDKVLQ
Ga0265340_1045803223300031247RhizosphereRARLDENEKWMAYLDANFQRQQAQLDLLRTAGQLDKVWQ
Ga0170819_1648408423300031469Forest SoilARLDENEKWMAYLDANFRRQQAQLELLKTAGQVDTVLQ
Ga0170818_10023479513300031474Forest SoilESLQVVEKARLDENEKWMALLDTTFQRQQAQLDLLKTAGQLDKVLQ
Ga0310686_10167970613300031708SoilARLEESEKWMAFLDANFQRQQAQLDLLKTAGQLDKVWQ
Ga0307474_1049955713300031718Hardwood Forest SoilLEESDKWMAYLDANFQRQQAQLDLLQTAGQLDKVWQ
Ga0307474_1050302013300031718Hardwood Forest SoilERARLDESEKWMAYLEANFQRQQAQLELLRTAGQLDKVLE
Ga0306917_1159164023300031719SoilDVEKARLDENEKWMAYLEANFLRQQAQLELLRSAGQLDKVLE
Ga0307475_1046840613300031754Hardwood Forest SoilEKGRLDENEKWMSYLDANFQRQQAQLDLLKTAGQLDKVLE
Ga0318576_1001906813300031796SoilERARLVENDKWMAYLDANFQRQQAKLDLLKAAGQLDKVWQ
Ga0306925_1093971913300031890SoilLDENDKWMAYLDANFQRQQAQLDLLKAAGQLDTVWQ
Ga0306923_1103512713300031910SoilRLRLDESEKWMAYLDANFQRQQAQLELLRVAGQLQKALE
Ga0306923_1193681413300031910SoilKARLEENEKWMALLDATFARQQAQLDLLKTAGQLDKILQ
Ga0310916_1057133123300031942SoilSLRDMEKARLEESEKWMSYLDANFQRQQAQLELLRTAGQLEKALE
Ga0307479_1001175213300031962Hardwood Forest SoilRARLDENDKWMAYLDANFQRQQAQLDLLKAAGQLDKVWQ
Ga0310911_1036764223300032035SoilKARLDENDKWMAYLDANFQRQQAQLDLLKAAGQLDTVWQ
Ga0310911_1045925323300032035SoilRARLDENEKWMAYLDANFMRQQAQLELLRTAGQLDRVLE
Ga0306924_1058242823300032076SoilRARLDENEKWMAYLDANFRRQQAQLELLKTAGQVDKVLQ
Ga0307471_10000119213300032180Hardwood Forest SoilLEENEKWMAYLDAGFQKQQAQLELLKTAGQLDKVWQ
Ga0307471_10128484413300032180Hardwood Forest SoilLNENEKWMAYLDANFQKQQAQLELLKAAGQLEKVWQ
Ga0307472_10211524023300032205Hardwood Forest SoilEVEKARLTENERWMAYLDANFARQQAQLELLRVAGQLNKVWQ
Ga0335084_1029428113300033004SoilRARLDENEKWMAYLDANFRRQQAQLELLRIAGQIDKVLE
Ga0326727_1041136713300033405Peat SoilRLDESEKWMAYLDANFQRQQAQLELLRTAGQLEKVLE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.