NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046038

Metagenome / Metatranscriptome Family F046038

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046038
Family Type Metagenome / Metatranscriptome
Number of Sequences 152
Average Sequence Length 41 residues
Representative Sequence YHTQGTYQGKPYDHVGRFTDTWVLDLGKWQCVASHTSLLKK
Number of Associated Samples 133
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.37 %
% of genes from short scaffolds (< 2000 bps) 86.84 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.737 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.816 % of family members)
Environment Ontology (ENVO) Unclassified
(22.368 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.684 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 34.78%    Coil/Unstructured: 65.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF00892EamA 34.87
PF10415FumaraseC_C 13.82
PF14534DUF4440 1.97
PF03724META 1.32
PF08281Sigma70_r4_2 1.32
PF03129HGTP_anticodon 1.32
PF08238Sel1 0.66
PF04120Iron_permease 0.66
PF05016ParE_toxin 0.66
PF00282Pyridoxal_deC 0.66
PF00440TetR_N 0.66
PF04542Sigma70_r2 0.66
PF08545ACP_syn_III 0.66
PF01491Frataxin_Cyay 0.66
PF00117GATase 0.66
PF06271RDD 0.66
PF12891Glyco_hydro_44 0.66
PF12804NTP_transf_3 0.66
PF135632_5_RNA_ligase2 0.66
PF02452PemK_toxin 0.66
PF07676PD40 0.66
PF13520AA_permease_2 0.66
PF12838Fer4_7 0.66
PF01432Peptidase_M3 0.66
PF14088DUF4268 0.66
PF00326Peptidase_S9 0.66
PF03466LysR_substrate 0.66
PF15902Sortilin-Vps10 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG0124Histidyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.32
COG0423Glycyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 1.32
COG0441Threonyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.32
COG0442Prolyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.32
COG3187Heat shock protein HslJPosttranslational modification, protein turnover, chaperones [O] 1.32
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.66
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.66
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.66
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.66
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.66
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.66
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.66
COG1965Fe-S cluster assembly protein CyaY, frataxin homologInorganic ion transport and metabolism [P] 0.66
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.66
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.66

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.39 %
UnclassifiedrootN/A4.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16497862All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300000567|JGI12270J11330_10204078All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300002245|JGIcombinedJ26739_101073082All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300005167|Ga0066672_10011880All Organisms → cellular organisms → Bacteria4242Open in IMG/M
3300005436|Ga0070713_101687305All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005439|Ga0070711_101522292All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005538|Ga0070731_10825616All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005541|Ga0070733_10041727All Organisms → cellular organisms → Bacteria2864Open in IMG/M
3300005541|Ga0070733_10483694All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300005542|Ga0070732_10695632All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005556|Ga0066707_10229836All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300005557|Ga0066704_10494928All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300005602|Ga0070762_10808436All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300005764|Ga0066903_100235868All Organisms → cellular organisms → Bacteria2798Open in IMG/M
3300005921|Ga0070766_10668158All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300006052|Ga0075029_100078649All Organisms → cellular organisms → Bacteria1950Open in IMG/M
3300006162|Ga0075030_100990179All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300006163|Ga0070715_10614500All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300006173|Ga0070716_100033924All Organisms → cellular organisms → Bacteria2795Open in IMG/M
3300006175|Ga0070712_100143551All Organisms → cellular organisms → Bacteria → Acidobacteria1825Open in IMG/M
3300006176|Ga0070765_100654847All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300006893|Ga0073928_10271295All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300009089|Ga0099828_11856978All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300009644|Ga0116121_1147283All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300009665|Ga0116135_1310056All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300009700|Ga0116217_10421720All Organisms → cellular organisms → Bacteria → Acidobacteria845Open in IMG/M
3300010343|Ga0074044_10687079All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300010358|Ga0126370_11795795All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300010362|Ga0126377_10182176All Organisms → cellular organisms → Bacteria1999Open in IMG/M
3300010366|Ga0126379_10956037All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300010376|Ga0126381_102585318Not Available727Open in IMG/M
3300010376|Ga0126381_103112045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300010376|Ga0126381_104209432All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300012202|Ga0137363_11191990All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012203|Ga0137399_11787343All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012205|Ga0137362_10834582All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300012205|Ga0137362_11739661All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300012363|Ga0137390_10154942All Organisms → cellular organisms → Bacteria2277Open in IMG/M
3300012582|Ga0137358_10370837All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300012923|Ga0137359_10583804All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300013100|Ga0157373_10389563All Organisms → cellular organisms → Bacteria → Acidobacteria997Open in IMG/M
3300013105|Ga0157369_10610725All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300014155|Ga0181524_10295579All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300014157|Ga0134078_10347442All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300014164|Ga0181532_10109789All Organisms → cellular organisms → Bacteria1705Open in IMG/M
3300014201|Ga0181537_10060588All Organisms → cellular organisms → Bacteria2565Open in IMG/M
3300014654|Ga0181525_10148331All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300014657|Ga0181522_10369386Not Available856Open in IMG/M
3300015241|Ga0137418_10804001All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300015242|Ga0137412_10047015All Organisms → cellular organisms → Bacteria → Acidobacteria3519Open in IMG/M
3300016371|Ga0182034_11999220Not Available512Open in IMG/M
3300016387|Ga0182040_10559724All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium921Open in IMG/M
3300016404|Ga0182037_11765397Not Available552Open in IMG/M
3300016750|Ga0181505_10448604All Organisms → cellular organisms → Eukaryota771Open in IMG/M
3300017924|Ga0187820_1007164All Organisms → cellular organisms → Bacteria → Acidobacteria2632Open in IMG/M
3300017927|Ga0187824_10117240All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300017934|Ga0187803_10071252All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300017943|Ga0187819_10210980All Organisms → cellular organisms → Bacteria → Acidobacteria1144Open in IMG/M
3300017955|Ga0187817_10000122All Organisms → cellular organisms → Bacteria → Acidobacteria26756Open in IMG/M
3300017955|Ga0187817_10448038All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300017972|Ga0187781_10137591All Organisms → cellular organisms → Bacteria1710Open in IMG/M
3300017972|Ga0187781_10663713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300017974|Ga0187777_10206394All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300017995|Ga0187816_10091987All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300018007|Ga0187805_10282280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300018025|Ga0187885_10466123All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300018034|Ga0187863_10266528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae952Open in IMG/M
3300018035|Ga0187875_10263308All Organisms → cellular organisms → Bacteria → Acidobacteria939Open in IMG/M
3300018042|Ga0187871_10279666All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300018062|Ga0187784_10180594All Organisms → cellular organisms → Bacteria1724Open in IMG/M
3300018085|Ga0187772_10827816All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300018085|Ga0187772_10858750All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300018085|Ga0187772_10897830All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300018088|Ga0187771_10187809All Organisms → cellular organisms → Bacteria → Acidobacteria1712Open in IMG/M
3300019786|Ga0182025_1069760All Organisms → cellular organisms → Bacteria1513Open in IMG/M
3300020582|Ga0210395_10798756All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300020583|Ga0210401_10452201All Organisms → cellular organisms → Bacteria → Acidobacteria1147Open in IMG/M
3300021170|Ga0210400_10002801All Organisms → cellular organisms → Bacteria15762Open in IMG/M
3300021178|Ga0210408_11218375All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300021180|Ga0210396_10131528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2255Open in IMG/M
3300021181|Ga0210388_10055364All Organisms → cellular organisms → Bacteria → Acidobacteria3312Open in IMG/M
3300021181|Ga0210388_10711324All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46874Open in IMG/M
3300021401|Ga0210393_11303030All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300021403|Ga0210397_11568667All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300021405|Ga0210387_10979341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46741Open in IMG/M
3300021405|Ga0210387_11362969All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300021407|Ga0210383_10585141All Organisms → cellular organisms → Bacteria → Acidobacteria962Open in IMG/M
3300021432|Ga0210384_10980226All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300021433|Ga0210391_10565535All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300021439|Ga0213879_10252066All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300021474|Ga0210390_11630463All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300021477|Ga0210398_11063921All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300021478|Ga0210402_10549846All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1071Open in IMG/M
3300021479|Ga0210410_10872727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300025419|Ga0208036_1000396All Organisms → cellular organisms → Bacteria → Acidobacteria27245Open in IMG/M
3300025496|Ga0208191_1003930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5481Open in IMG/M
3300025906|Ga0207699_11461171All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300025916|Ga0207663_10390405All Organisms → cellular organisms → Bacteria → Acidobacteria1062Open in IMG/M
3300025916|Ga0207663_10924151All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300025929|Ga0207664_10795824All Organisms → cellular organisms → Bacteria → Acidobacteria850Open in IMG/M
3300026078|Ga0207702_10823546All Organisms → cellular organisms → Bacteria → Acidobacteria918Open in IMG/M
3300026879|Ga0207763_1018333All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300027604|Ga0208324_1187952All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300027674|Ga0209118_1124844All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300027767|Ga0209655_10073238All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300027795|Ga0209139_10025498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2111Open in IMG/M
3300027854|Ga0209517_10422991All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300027867|Ga0209167_10797407All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300027884|Ga0209275_10562573All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300027889|Ga0209380_10499271All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300027898|Ga0209067_10178872All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300027911|Ga0209698_11024617All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300028020|Ga0265351_1027514All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300028037|Ga0265349_1027382All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300028748|Ga0302156_10187867All Organisms → cellular organisms → Bacteria → Acidobacteria978Open in IMG/M
3300028788|Ga0302189_10404870All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300029883|Ga0311327_10238262Not Available1218Open in IMG/M
3300029908|Ga0311341_10435094All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300029943|Ga0311340_10684472All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300029999|Ga0311339_10285530All Organisms → cellular organisms → Bacteria1787Open in IMG/M
3300030047|Ga0302286_10574399All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300030054|Ga0302182_10216240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium818Open in IMG/M
3300031231|Ga0170824_117599454All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300031249|Ga0265339_10142006All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300031708|Ga0310686_114480431All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300031708|Ga0310686_116800865All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300031708|Ga0310686_116991802All Organisms → cellular organisms → Bacteria → Acidobacteria1768Open in IMG/M
3300031715|Ga0307476_11276110All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031753|Ga0307477_10304881All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300031754|Ga0307475_10379305All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300031879|Ga0306919_10555695Not Available886Open in IMG/M
3300031879|Ga0306919_10914625All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300031941|Ga0310912_10620727All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300031962|Ga0307479_10787087All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300031962|Ga0307479_11683373All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031962|Ga0307479_11746057All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300031996|Ga0308176_11202118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium804Open in IMG/M
3300032119|Ga0316051_1007405All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300032205|Ga0307472_102346850All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300032782|Ga0335082_11264978All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300032783|Ga0335079_10010758All Organisms → cellular organisms → Bacteria → Acidobacteria10420Open in IMG/M
3300032783|Ga0335079_11458432All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300032828|Ga0335080_10175192All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2368Open in IMG/M
3300032828|Ga0335080_10222164All Organisms → cellular organisms → Bacteria → Acidobacteria2072Open in IMG/M
3300032828|Ga0335080_11211257All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300032892|Ga0335081_10388926All Organisms → cellular organisms → Bacteria1799Open in IMG/M
3300033289|Ga0310914_10311057All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300033290|Ga0318519_10644844All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300033807|Ga0314866_033301All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300033983|Ga0371488_0318126All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300034124|Ga0370483_0000301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae14183Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.58%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.26%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.26%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.95%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.29%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.29%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.29%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.63%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.63%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.63%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.63%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.97%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.32%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.32%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.32%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.66%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.66%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.66%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.66%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.66%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.66%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.66%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.66%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.66%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026879Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028020Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4EnvironmentalOpen in IMG/M
3300028037Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032119Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_040019602088090014SoilQGTYQGKPYDHVGRFTDTWVLDQGKWQCVASHTSLLKK
JGI12270J11330_1020407823300000567Peatlands SoilYGGKPYEHFGRFTDTWVFQDGAWLCVASHSSLLKK*
JGIcombinedJ26739_10107308213300002245Forest SoilTKGTYGAKPYEHFGRFTDTWVFQDGKWLCVASHTSLLKK*
Ga0066672_1001188053300005167SoilAKGTYQGRPYDHVGRFTDTWILEDGKWQCVASHSSLLKK*
Ga0070713_10168730513300005436Corn, Switchgrass And Miscanthus RhizosphereGIYHTQGTYQGKPYNHVGRFTDTWVLDTGKWQCVASHTSLLKK*
Ga0070711_10152229223300005439Corn, Switchgrass And Miscanthus RhizosphereYHTQGTYQGKSYDHVGRFTDTWVFDQGKWQCVASHTSLLKK*
Ga0070731_1082561623300005538Surface SoilGSYHAKPYEHTGRFTDTWVLNDSRWQCVASHTSLLQK*
Ga0070733_1004172713300005541Surface SoilGIYHTKGTYEGKPYEHFGRYTDTWVYTDGRWQCAASHTSLLKK*
Ga0070733_1048369433300005541Surface SoilSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK*
Ga0070732_1069563223300005542Surface SoilVTGVYHTKGSYEGKPYDHIGRFTDTWINDGGKWQCVASHTSLLKK*
Ga0066707_1022983613300005556SoilYRTRGTYQGKSYDHLGRFTDTWIQEGGKWQCVASHTSLLKK*
Ga0066704_1049492813300005557SoilLVPWFGRLTKGIYKGKPFEHFGRFTDSWIHQNGKWQCIASH
Ga0066702_1009843413300005575SoilNGKPYLHRGRFTDTWVRQGSSWMCVASHSTLMQR*
Ga0070762_1080843613300005602SoilKGTYQAKPYEHWGRFTDTWIYAQGRWQCVASHTSLLKK*
Ga0066903_10023586813300005764Tropical Forest SoilGIYHTQGTYQGKSYDHVGRFTDTWVMDQGKWQCVASHTSLLKK*
Ga0070766_1066815813300005921SoilYHNTGVVTGSYHTKGSYNSKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK*
Ga0075029_10007864913300006052WatershedsYQGKSYDHVGRFTDTWVYDQGKWQCVASHTSLLKNK*
Ga0075030_10099017913300006162WatershedsGTYQGKPYDHVGRFTDTWVLDMGKWQCVASHTSLLKK*
Ga0070715_1061450023300006163Corn, Switchgrass And Miscanthus RhizosphereGTYKSKPYDHTGRFTDTWVFDMGKWQCVSSHTSLLKK*
Ga0070716_10003392413300006173Corn, Switchgrass And Miscanthus RhizosphereQGKPYDHVGRFTDTWVLDQGKWQCVASHTSLLKK*
Ga0070712_10014355133300006175Corn, Switchgrass And Miscanthus RhizosphereQTKGTYSGKAYEHVGRFTDTWIFENGKWLCVASHTSLLKK*
Ga0070765_10065484713300006176SoilYQGKPYEHFGRFTDTWVYSDGRWQCVASHTSLLKK*
Ga0073928_1027129513300006893Iron-Sulfur Acid SpringVVTGIYHTQGSYQGKPYDHLGRFTDTWVQDLGKWQCVASHTSLLKK*
Ga0099828_1185697813300009089Vadose Zone SoilQNKPYEHWGRFTDTWVFTEGRWQCVASHTSLVKK*
Ga0116121_114728323300009644PeatlandVVTGIYHASGTYQGKPYDHMGRFTDTWVMDLGKWQCVASHTSLLKK*
Ga0116135_131005623300009665PeatlandIYHSQGTYQGKPYDHVGRFTDTWVMDAGKWQCVASYTSLIKK*
Ga0116217_1042172013300009700Peatlands SoilGTYGAKPYEHFGRFTDTWIFQDGKWQCVASHTSLVKK*
Ga0074044_1068707913300010343Bog Forest SoilAVVTGTYHTQGTYQGKPYDHVGRFTDTWIFGSGRWQCVASHTSLIKK*
Ga0126370_1179579513300010358Tropical Forest SoilASKPYEHTGRFTDTWIFEDGKWLCVASHTSLLKK*
Ga0126377_1018217633300010362Tropical Forest SoilVYYTKGTFSGKPYEHTGRFTDTWIFENGKWLCVASHTSLLGK*
Ga0126379_1095603713300010366Tropical Forest SoilTQGTYQGKPYDHVGRFTDTWVLDLGKWQCVASHTSLLKK*
Ga0126381_10258531823300010376Tropical Forest SoilIYRTQGTFQGKAYDHVGRFTDTWVYELGRWQCVASHTSLIKK*
Ga0126381_10311204523300010376Tropical Forest SoilYHTKGTYDSKPYEHLGRFTDTWVFEGGRWMCVASHTSLLKK*
Ga0126381_10420943213300010376Tropical Forest SoilYQGKSYEHVGRFTDTWVFADARWQCVASHSSLLQK*
Ga0137363_1119199013300012202Vadose Zone SoilQGKSYDHVGRFTDTWVMDQGKWQCVASHTSLLKNK*
Ga0137399_1178734313300012203Vadose Zone SoilKGTYQGRPYEHFGRFTDAWMLQDGRWQCVASHTSLVKK*
Ga0137362_1083458223300012205Vadose Zone SoilYHTKGTYGAKPYEHFGRFTDTWVFQDGKWLCVASHTSLLKK*
Ga0137362_1173966113300012205Vadose Zone SoilHTKGTYGAKPYEHFGRFTDTWVFQDGKWLCVASHTSLLKK*
Ga0137390_1015494213300012363Vadose Zone SoilYQGRPYEHFGRFTDTWVLDDGRWQCVASHTSLVKK*
Ga0137358_1037083713300012582Vadose Zone SoilSGVYHTKGTYGAKPYEHFGRFTDTWVFQDGKWLCVASHTSLLKK*
Ga0137359_1058380443300012923Vadose Zone SoilYQNKPYEHWGRFTDTWVFTEGRWQCVASHTSLVKK*
Ga0157373_1038956323300013100Corn RhizosphereYKGKAYDHVGRFTDTWVLDGAKWLCVASHTSLIKN*
Ga0157369_1061072533300013105Corn RhizosphereKGTISGKPFDHHGRFTDTWVNQGGKWQCVASHTSSLKKPPQ*
Ga0181524_1029557923300014155BogVTGTYHTKGTYGGKPYDHIGRFTDTWILQNGKWLCVASHSSLLKK*
Ga0134078_1034744213300014157Grasslands SoilTGNYHTKGLYASKPYEHFGRFTDTWVFQESKWLCVASHSSLVKK*
Ga0181532_1010978913300014164BogTYGAKPYEHFGRFTDTWIFQDGKWQCVASHTSLIKK*
Ga0181537_1006058833300014201BogYHIRGSYNNQPYEHTGRFTDTWIYDGGKWLCVASHSSLLKK*
Ga0181525_1014833123300014654BogEYHTKGSYQGKAYDHVGRFTDTWVFQGGKWVCVASHASLLKK*
Ga0181522_1036938623300014657BogYNTQAYEHTGRFTDTWIFEGGKWLCVASHSSLIKKN*
Ga0137418_1080400123300015241Vadose Zone SoilYQTKGTYHGKAYDHFGRFTDTWILENGKWQCVASHTSLLKK*
Ga0137412_1004701513300015242Vadose Zone SoilTKGVYGSKPYEHFGRFTDTWVFQDGKWLCVASHSSLKK*
Ga0182034_1199922013300016371SoilVVIGSYHSKGSYQGKSYDHFGRFTDTWVFADARWQCVASHSSLVQK
Ga0182040_1055972413300016387SoilYQAKGTYSGKAYEHIGRFTDTWIFENGRWLCVASHTSLLKK
Ga0182037_1176539713300016404SoilNVAVVIGSYHSKGSYQGKSYDHFGRFTDTWVFADARWQCVASHSSLVQK
Ga0181505_1044860423300016750PeatlandVVIGEYHTKGSYQGKAYDHVGRFTDTWVMDSGKWQCVASHTSLIKK
Ga0187820_100716433300017924Freshwater SedimentVITGTYHTQGTYQGKAYDHVGRFTDTWVLDGGKWQCVASHTSLIKK
Ga0187824_1011724033300017927Freshwater SedimentTKGTYSGKPYEHTGRFTDTWIFGNGRWLCVASHTSLLKKEKSEG
Ga0187803_1007125223300017934Freshwater SedimentVTGIYHTKGTYQGKPYEHVGRFTDTWIFENGRWLCVASHTSLVKK
Ga0187819_1021098013300017943Freshwater SedimentTYSGKPYEHFGRFTDTWVYQDGKWLCVASHSSLKNK
Ga0187817_10000122253300017955Freshwater SedimentVVTGIYRAKGTYQGKPYDHIGRFTDTWVLQDAKWECVASHTSLLQK
Ga0187817_1044803823300017955Freshwater SedimentSYNGKPYDHLGRFTDTWIFQDGKWECVASHTSLMKK
Ga0187781_1013759133300017972Tropical PeatlandKGTYQGKPYEHLGRFTDTWVFQDARWQCVASHTSLLQK
Ga0187781_1066371323300017972Tropical PeatlandYQGKPYDHFGRFTDTWVLDSGKWQCVASHTSLVKK
Ga0187777_1020639413300017974Tropical PeatlandHTKGTYQAKPYDHFGRFTDTWIQQLGKWQCVASHTSLVKK
Ga0187816_1009198723300017995Freshwater SedimentGVYHTQGTYHGKPYDHVGRFTDTWVFDLGKWQCVASHTSLLKK
Ga0187805_1028228023300018007Freshwater SedimentRHTKGTYQGEAFEHYSRFTDTWVYQHSRWLCVASQTSLIKK
Ga0187885_1046612323300018025PeatlandHTKGSYNGKPYDHLGRFTDTWILEDGKWECVASHTSLLKR
Ga0187863_1026652823300018034PeatlandFYGRAAVVTGGYHAKGTYQGKPYDHNGRFTDTWVSSDTVTWQCVASHTSLLQK
Ga0187875_1026330813300018035PeatlandKGSYNGKPYDHLGRFTDTWILEDGKWECVASHTSLLKR
Ga0187871_1027966623300018042PeatlandHTKGSYNGKPYDHLGRFTDTGMLEDGKWECVASHTSLLKK
Ga0187784_1018059413300018062Tropical PeatlandHTKGTYQGKPYEHLGRFTDTWVFQDARWQCVASHTSLLQK
Ga0187772_1082781613300018085Tropical PeatlandGEYHAQGTYQGKPYDHVGRFTDTWVEQNGKWVCVCSHSSLLKK
Ga0187772_1085875013300018085Tropical PeatlandTYQGKPYDHLGRFTDTWIFDMGKWQCVASHTSLLKK
Ga0187772_1089783013300018085Tropical PeatlandDYHTKGMYGGKPFEHFGRFTDTWVHQDSKWLCVASHASLKK
Ga0187771_1018780913300018088Tropical PeatlandTQGTYQGKPYEHWGRFTDTWVFDGVKWQCVASHTSLLKK
Ga0182025_106976013300019786PermafrostGKIPKGTYQGKSYEHIGRFTDTWVFTEGRWQCAASHTSLLKK
Ga0210395_1079875613300020582SoilYQGKPYDHVGRFTDTWVLDLGKWQCVASHTSLVKK
Ga0210401_1045220123300020583SoilTGSYHTKGSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK
Ga0210400_10002801103300021170SoilTAVITGIYHTAGTYQGKPYDHVGRFTDTWVMDMGKWQCVASHTSLLKK
Ga0210408_1121837513300021178SoilTGVVTGSYHTKGSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK
Ga0210396_1013152833300021180SoilVTGIYHAQGTYQGKTYDHVGRFTDTWVQELGKWQCVASHTSLVKK
Ga0210388_1005536413300021181SoilHTKGSYNGKPYDHLGRFTDTWILEDGRWECVASHTSLLKK
Ga0210388_1071132413300021181SoilVTGSYHTKGSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK
Ga0210393_1130303023300021401SoilIYHTKGTYQAKPYEHWGRFTDTWIYAQGRWQCVASHTSLLKK
Ga0210397_1156866713300021403SoilVTGIYHTKGSYHGKPYDHVGRFTDTWIYDDGKWQCVASHTSLLKR
Ga0210387_1097934113300021405SoilSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK
Ga0210387_1136296923300021405SoilTYGSKPYEHFGRFTDTWVFQDGRWLCVASHSSLVKK
Ga0210383_1058514113300021407SoilYHNTGVVTGSYHTKGSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKK
Ga0210384_1098022613300021432SoilYHTQGTYQGKPYDHVGRFTDTWVLDLGKWQCVASHTSLLKK
Ga0210391_1056553523300021433SoilRTKGSYQGKTYDHVGRFTDTWVFQSDKWVCVASHSSLLKK
Ga0213879_1025206613300021439Bulk SoilKGTYMGKAYEHTGRFTDTWVLQDARWQCVASHTSLLQK
Ga0210390_1163046313300021474SoilRTKGTYGGKPYDHLGRFTDTWVFQDGKWLCVASHTSLLKK
Ga0210398_1106392113300021477SoilIYHAQGSYQGKSYDHVGRFTDTWVMDAGKWQCVASHTSLIKK
Ga0210402_1054984613300021478SoilGNYHVKGVYGSKPYEHFGRFTDTWILEDGKWLCVASHSSLVKK
Ga0210410_1087272713300021479SoilYHAKGTYAGKGYEHTGRFTDTWIFESGKWLCVASHTSLLKK
Ga0208036_100039613300025419PeatlandSAAVVGIYHTKGTYQGKPYEHFGRFTDTWVFTEGRWQCAASHTSLLKK
Ga0208191_100393073300025496PeatlandVVGIYHTKGTYQGKPYEHFGRFTDTWVFTEGRWQCAASHTSLLKK
Ga0207699_1146117123300025906Corn, Switchgrass And Miscanthus RhizosphereTYHAAGTYQGKPYDHVGRFTDTWISDNGHWQCVASHTSLLKK
Ga0207663_1039040523300025916Corn, Switchgrass And Miscanthus RhizosphereLTKGTYSGRIYEHTGRFTDTWIFENGRWLCVASHTSLVKK
Ga0207663_1092415123300025916Corn, Switchgrass And Miscanthus RhizosphereHTQGTYKSKPYDHTGRFTDTWVFDMGKWQCVSSHTSLLKK
Ga0207664_1079582423300025929Agricultural SoilGTYSGKAYEHLGRFTDTWIFENGKWLCVASHTSLLKK
Ga0207702_1082354613300026078Corn RhizosphereHSKGTIAGKPFDHHGRFTDTWVNQGGKWQCVASHTSSLKKPPQ
Ga0207763_101833313300026879Tropical Forest SoilTGTYHAQGSYQGKPYDHIGRFTDTWVLDAGKWQCVASHTSLVKK
Ga0208324_118795213300027604Peatlands SoilKGSYNGKPYDHLGRFTDTWIFQDGKWECVASHTSLVKR
Ga0209118_112484413300027674Forest SoilGAYHTKGTYGAKPYEHFGRFTDTWVFQDGKWLCVASHTSLLKK
Ga0209655_1007323813300027767Bog Forest SoilVVGIYHTKGMYQNKPYEHFGRFTDTWIYSEGRWQCVASHTSLLKK
Ga0209139_1002549833300027795Bog Forest SoilVVGIDHAKGIYQNKPYEHLGRFTDTWIYAEGRWQCVASHTSLLKK
Ga0209517_1042299113300027854Peatlands SoilYGGKPYEHFGRFTDTWVFQDGAWLCVASHSSLLKK
Ga0209167_1079740723300027867Surface SoilGYHAKGTYQGKPYDHNGRFTDTWVSTDSETWQCVASHTSLLQK
Ga0209275_1056257323300027884SoilAVVVGIYHTKGIYQGKPYDHFGRFTDTWVFTEGRWQCVASHTSLLKK
Ga0209380_1049927123300027889SoilGTYQGKSYDHVGRFTDTWVFDQGKWQCVASHTSLLKNK
Ga0209067_1017887213300027898WatershedsTYQGKPYDHVGRFTDTWVLDQGKWQCVASHTSLLKK
Ga0209698_1102461713300027911WatershedsGTYHTQGTFQGKPYDHVGRFTDTWIFDTGKWQCVASHTSLLKK
Ga0265351_102751413300028020SoilAYHTQGSFQGKPYDHVGRFTDTWVLELGKWQCVASHTSLLKK
Ga0265349_102738213300028037SoilYHTKGTYQGKPYEHFGRFTDTWVFTEGRWQCVASHTSLLKK
Ga0302156_1018786723300028748BogVVGVYHTKGTYQSKPYEHWGRFTDTWVFTEGRWQCAASHTSLLKK
Ga0302189_1040487023300028788BogYHTKGTYGPKAYEHFGRFTDTWVYSDGKWLCVASHSSLMKK
Ga0311327_1023826223300029883BogYHAKGTYNAQAYEHTGRFTDTWIFEGGKWLCVASHSSLIKKN
Ga0311341_1043509423300029908BogTYHTKGTYGPKAYEHFGRFTDTWVYSDGKWLCVASHSSLMKK
Ga0311340_1068447213300029943PalsaTAVVTGIYHTQGTYQGKPYDHVGRFTDTWVMDLGKWQCVASHTSLLKK
Ga0311339_1028553013300029999PalsaGTYQGKPYDHVGRFTDTWVFDTGKWECVASHTSLLKK
Ga0302286_1057439913300030047FenIVTGIYRTKGTYQGKPYGHVGRFTDTWVFENDKWQCVASHTSLLKK
Ga0302182_1021624023300030054PalsaYQTKPYDHVGRFTDTWVLDNGKWQCVASHTSLIKK
Ga0170824_11759945423300031231Forest SoilIYHTQGTYQGKPYNHVGRFTDTWVLDTGKWQCVASHTSLLKK
Ga0265339_1014200623300031249RhizosphereYQGKAYDHVGRFTDTWIFDGGKWQCVASHTSLLKK
Ga0310686_11448043113300031708SoilKGTYQAKPYEHWGRFTDTWIYAQGRWQCVASHTSLLKK
Ga0310686_11680086513300031708SoilYHTKGSYNGKPYDHLGRFTDTWILEDGKWECVASHTSLLKK
Ga0310686_11699180213300031708SoilYHNTGVVTGSYHTKGSYNGKPYDHLGRFTDTWVFEDGKWECVASHTSLLKR
Ga0307476_1127611013300031715Hardwood Forest SoilVVVGIYHAKGTYQAKPYEHWGRFTDTWIYAQGRWQCVASHTSLLKK
Ga0307477_1030488113300031753Hardwood Forest SoilIYHAQGTFQGKPYDHLGRFTDTWVLELGKWQCVASHTSLLKK
Ga0307475_1037930513300031754Hardwood Forest SoilRTKGTYQGRPYEHFGRFTDTWMLENGRWQCVASHTSLVKK
Ga0306919_1055569523300031879SoilTLLSNVAVVIGSYHSKGSYQGKSYDHFGRFTDTWVFADARWQCVASHSSLVQK
Ga0306919_1091462513300031879SoilGTYQGKPYDHMGRFTDTWVLDGGKWQCVASHTSLLKSK
Ga0310912_1062072713300031941SoilTYRSKGSHMNKSYDHLGRFTDTWVFADGKWQCVASHTSLLQK
Ga0307479_1078708723300031962Hardwood Forest SoilYHAQGTFQGKAYDHLGRFTDTWVFEMGKWQCVASHTSLLKK
Ga0307479_1168337313300031962Hardwood Forest SoilSAVVVGIYHNKGTYQAKPYEHWGRFTDTWIYAQGRWQCVASHTSLLRK
Ga0307479_1174605723300031962Hardwood Forest SoilKGTYQGKAYEHWGRFTDTWAFTEGRWQCVASHTSLLKK
Ga0308176_1120211823300031996SoilVYHTQGTYKSKPYDHTGRFTDTWVFDMGKWQCVSSHTSLLKK
Ga0316051_100740513300032119SoilAGVVTGVYHTKGSYNGKPYDHVGRFTDTWIFQEGKWECVASHTSLVKK
Ga0307472_10234685013300032205Hardwood Forest SoilRNTGVVTGIYHTKGSYYGKPYDHLGRFTDTWIFEDGKWECVASHTSLLKK
Ga0335082_1126497813300032782SoilGLYAGKPYEHFGRFTDTWVFQDGKWLCVASHSSLKK
Ga0335079_1001075883300032783SoilQGSYQGKPYDHVGRFTDTWVFDTGKWSCVASHTSLLKK
Ga0335079_1145843223300032783SoilGIYHTKGTVQGKPYEHAGRFTDTWIFQDARWECVASHTSLLQK
Ga0335080_1017519213300032828SoilIVTGDYHTKGVYAGKPYEHFGRFTDTWVYQDSKWLCVASHSSLKK
Ga0335080_1022216413300032828SoilGVYHTAGTYQGKPYDHVGRFTDTWIFDMGKWQCVASHTSLLKK
Ga0335080_1121125713300032828SoilTYQGKPYDHVGRFTDTWVLDMGKWQCVASHTSLLKKQ
Ga0335081_1038892613300032892SoilGIYHTQGTYQGKPYDHMGRFTDTWVLDMGKWQCVASHTSLLKK
Ga0310914_1031105733300033289SoilVVTGTYRSKGSYMNKSYDHLGRFTDTWVFADGKWQCVASHTSLLQK
Ga0318519_1064484423300033290SoilAVVTGTYRSKGSYMNKSYDHLGRFTDTWVFADGKWQCVASHTSLLQK
Ga0314866_033301_2_1333300033807PeatlandGTYHTAGTYQGKPYDHVGRFTDTWVLDLGKWQCVASHTSLLKK
Ga0371488_0318126_1_1083300033983Peat SoilYGTKPYEHFGRFTDTWVFQEGKWVCVASHTSLLKK
Ga0370483_0000301_18_1553300034124Untreated Peat SoilVVGVYHTKGTYQSKAYEHWGRFTDTWVFTEGRWQCAASHTSLLRK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.