NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F046151

Metagenome Family F046151

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046151
Family Type Metagenome
Number of Sequences 151
Average Sequence Length 79 residues
Representative Sequence MLAAVEAAEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSSFNLF
Number of Associated Samples 23
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 93.38 %
% of genes near scaffold ends (potentially truncated) 10.60 %
% of genes from short scaffolds (< 2000 bps) 47.02 %
Associated GOLD sequencing projects 23
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (88.742 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(53.642 % of family members)
Environment Ontology (ENVO) Unclassified
(99.338 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(87.417 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF14223Retrotran_gag_2 17.88
PF13976gag_pre-integrs 5.30
PF00067p450 3.31
PF07727RVT_2 2.65
PF03732Retrotrans_gag 1.99
PF02183HALZ 1.99
PF00665rve 1.32
PF01048PNP_UDP_1 1.32
PF00078RVT_1 0.66
PF00481PP2C 0.66
PF00641zf-RanBP 0.66
PF00004AAA 0.66
PF13456RVT_3 0.66
PF13961DUF4219 0.66
PF00069Pkinase 0.66
PF16796Microtub_bd 0.66
PF02861Clp_N 0.66
PF07714PK_Tyr_Ser-Thr 0.66
PF03140DUF247 0.66
PF00632HECT 0.66
PF00046Homeodomain 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 5.30
COG2124Cytochrome P450Defense mechanisms [V] 3.31
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 1.32
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 1.32
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 1.32
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 1.32
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 1.32
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 1.32
COG4584TransposaseMobilome: prophages, transposons [X] 1.32
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 0.66
COG0631Serine/threonine protein phosphatase PrpCSignal transduction mechanisms [T] 0.66

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.74 %
UnclassifiedrootN/A11.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009156|Ga0111538_13913278Not Available515Open in IMG/M
3300028786|Ga0307517_10001283All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta42186Open in IMG/M
3300028786|Ga0307517_10001320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta41632Open in IMG/M
3300028786|Ga0307517_10003230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida25558Open in IMG/M
3300028786|Ga0307517_10067898All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3256Open in IMG/M
3300028786|Ga0307517_10192494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1291Open in IMG/M
3300028786|Ga0307517_10466507Not Available650Open in IMG/M
3300028786|Ga0307517_10480786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis636Open in IMG/M
3300028786|Ga0307517_10543056Not Available582Open in IMG/M
3300028786|Ga0307517_10609183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis537Open in IMG/M
3300028794|Ga0307515_10013563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta15210Open in IMG/M
3300028794|Ga0307515_10014232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix14780Open in IMG/M
3300028794|Ga0307515_10016132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta13699Open in IMG/M
3300028794|Ga0307515_10042695All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7082Open in IMG/M
3300028794|Ga0307515_10074384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4545Open in IMG/M
3300028794|Ga0307515_10083261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis4126Open in IMG/M
3300028794|Ga0307515_10185239All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2014Open in IMG/M
3300028794|Ga0307515_10271883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1414Open in IMG/M
3300028794|Ga0307515_10639051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis676Open in IMG/M
3300030521|Ga0307511_10080043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2304Open in IMG/M
3300030521|Ga0307511_10086049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2168Open in IMG/M
3300030521|Ga0307511_10129848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1522Open in IMG/M
3300030521|Ga0307511_10148333All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1354Open in IMG/M
3300030522|Ga0307512_10045764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3577Open in IMG/M
3300030522|Ga0307512_10054107Not Available3182Open in IMG/M
3300030522|Ga0307512_10059669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2957Open in IMG/M
3300030522|Ga0307512_10191799All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1125Open in IMG/M
3300030522|Ga0307512_10296812Not Available756Open in IMG/M
3300030522|Ga0307512_10330452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis686Open in IMG/M
3300030522|Ga0307512_10357362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis639Open in IMG/M
3300031456|Ga0307513_10023265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta7243Open in IMG/M
3300031456|Ga0307513_10077944Not Available3429Open in IMG/M
3300031456|Ga0307513_10106630Not Available2807Open in IMG/M
3300031456|Ga0307513_10340873All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1249Open in IMG/M
3300031456|Ga0307513_10423652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1060Open in IMG/M
3300031456|Ga0307513_10678545All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis736Open in IMG/M
3300031456|Ga0307513_10708059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis712Open in IMG/M
3300031456|Ga0307513_10709501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis711Open in IMG/M
3300031507|Ga0307509_10008652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida12920Open in IMG/M
3300031507|Ga0307509_10025045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae6669Open in IMG/M
3300031507|Ga0307509_10028026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera6263Open in IMG/M
3300031507|Ga0307509_10037064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis5331Open in IMG/M
3300031507|Ga0307509_10148263All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2267Open in IMG/M
3300031507|Ga0307509_10310482Not Available1319Open in IMG/M
3300031507|Ga0307509_10311506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1316Open in IMG/M
3300031507|Ga0307509_10577764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis798Open in IMG/M
3300031507|Ga0307509_10619496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis753Open in IMG/M
3300031507|Ga0307509_10710426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis671Open in IMG/M
3300031507|Ga0307509_10869109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis566Open in IMG/M
3300031507|Ga0307509_10996985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis504Open in IMG/M
3300031507|Ga0307509_11004137All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis501Open in IMG/M
3300031616|Ga0307508_10012810All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae7669Open in IMG/M
3300031616|Ga0307508_10141826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2007Open in IMG/M
3300031616|Ga0307508_10410573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea945Open in IMG/M
3300031616|Ga0307508_10883359All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis518Open in IMG/M
3300031649|Ga0307514_10057453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2980Open in IMG/M
3300031649|Ga0307514_10078744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2446Open in IMG/M
3300031649|Ga0307514_10120975All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1826Open in IMG/M
3300031649|Ga0307514_10163103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1471Open in IMG/M
3300031649|Ga0307514_10253515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1038Open in IMG/M
3300031649|Ga0307514_10401593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis699Open in IMG/M
3300031730|Ga0307516_10286963Not Available1325Open in IMG/M
3300031730|Ga0307516_10296387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1294Open in IMG/M
3300031730|Ga0307516_10383540All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1066Open in IMG/M
3300031730|Ga0307516_10969763Not Available520Open in IMG/M
3300031838|Ga0307518_10184510All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1406Open in IMG/M
3300031838|Ga0307518_10308279All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis956Open in IMG/M
3300031838|Ga0307518_10349221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis862Open in IMG/M
3300031838|Ga0307518_10393100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis778Open in IMG/M
3300031838|Ga0307518_10515431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis608Open in IMG/M
3300031838|Ga0307518_10632186All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis500Open in IMG/M
3300032354|Ga0325403_1002847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis15511Open in IMG/M
3300032354|Ga0325403_1003144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae14939Open in IMG/M
3300032354|Ga0325403_1013931All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera7554Open in IMG/M
3300032354|Ga0325403_1021035All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis5878Open in IMG/M
3300032354|Ga0325403_1021798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5747Open in IMG/M
3300032354|Ga0325403_1022727All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis5591Open in IMG/M
3300032354|Ga0325403_1025498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae5145Open in IMG/M
3300032354|Ga0325403_1031832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera4374Open in IMG/M
3300032354|Ga0325403_1044368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis3293Open in IMG/M
3300032354|Ga0325403_1047707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3073Open in IMG/M
3300032354|Ga0325403_1048077All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis3048Open in IMG/M
3300032354|Ga0325403_1049431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2962Open in IMG/M
3300032354|Ga0325403_1050740All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2881Open in IMG/M
3300032354|Ga0325403_1052614All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2776Open in IMG/M
3300032354|Ga0325403_1066435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2131Open in IMG/M
3300032354|Ga0325403_1068179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2063Open in IMG/M
3300032354|Ga0325403_1089086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1421Open in IMG/M
3300032354|Ga0325403_1118886All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis904Open in IMG/M
3300032354|Ga0325403_1122414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis866Open in IMG/M
3300032354|Ga0325403_1128436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea808Open in IMG/M
3300032354|Ga0325403_1159928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis567Open in IMG/M
3300032354|Ga0325403_1161573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis558Open in IMG/M
3300032355|Ga0325401_1005505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta12136Open in IMG/M
3300032355|Ga0325401_1015073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis7369Open in IMG/M
3300032355|Ga0325401_1032557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4508Open in IMG/M
3300032355|Ga0325401_1103045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1512Open in IMG/M
3300032355|Ga0325401_1111883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1365Open in IMG/M
3300032355|Ga0325401_1193032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis691Open in IMG/M
3300032355|Ga0325401_1211943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis615Open in IMG/M
3300032355|Ga0325401_1249823All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis507Open in IMG/M
3300032374|Ga0325400_1017763All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida6726Open in IMG/M
3300032374|Ga0325400_1044802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3735Open in IMG/M
3300032374|Ga0325400_1065497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2775Open in IMG/M
3300032389|Ga0325405_1000004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida191739Open in IMG/M
3300032389|Ga0325405_1005017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera13465Open in IMG/M
3300032389|Ga0325405_1006159All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida12119Open in IMG/M
3300032389|Ga0325405_1006934All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida11418Open in IMG/M
3300032389|Ga0325405_1013147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae7828Open in IMG/M
3300032389|Ga0325405_1014403All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae7367Open in IMG/M
3300032389|Ga0325405_1024758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis4984Open in IMG/M
3300032389|Ga0325405_1029959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis4242Open in IMG/M
3300032389|Ga0325405_1041429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis3111Open in IMG/M
3300032389|Ga0325405_1051131Not Available2457Open in IMG/M
3300032389|Ga0325405_1055091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2241Open in IMG/M
3300032389|Ga0325405_1062913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1862Open in IMG/M
3300032389|Ga0325405_1073306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1460Open in IMG/M
3300032389|Ga0325405_1101644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis831Open in IMG/M
3300032389|Ga0325405_1114496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis669Open in IMG/M
3300032389|Ga0325405_1126501Not Available550Open in IMG/M
3300032390|Ga0325404_1000228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta54283Open in IMG/M
3300032390|Ga0325404_1008069All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae10890Open in IMG/M
3300032390|Ga0325404_1008602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta10488Open in IMG/M
3300032390|Ga0325404_1022556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis5456Open in IMG/M
3300032390|Ga0325404_1054768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2186Open in IMG/M
3300032390|Ga0325404_1057504All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2039Open in IMG/M
3300032390|Ga0325404_1108871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis669Open in IMG/M
3300032735|Ga0325410_1058014Not Available1982Open in IMG/M
3300032735|Ga0325410_1121625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis554Open in IMG/M
3300032735|Ga0325410_1122204Not Available550Open in IMG/M
3300032741|Ga0325414_1030342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis4615Open in IMG/M
3300032741|Ga0325414_1062577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2068Open in IMG/M
3300033160|Ga0325402_1015156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis7126Open in IMG/M
3300033160|Ga0325402_1063435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2219Open in IMG/M
3300033179|Ga0307507_10011909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta10868Open in IMG/M
3300033179|Ga0307507_10163853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1634Open in IMG/M
3300033179|Ga0307507_10275766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1057Open in IMG/M
3300033179|Ga0307507_10332405Not Available906Open in IMG/M
3300033179|Ga0307507_10361477Not Available847Open in IMG/M
3300033180|Ga0307510_10018584All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8177Open in IMG/M
3300033180|Ga0307510_10032276All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae5900Open in IMG/M
3300033180|Ga0307510_10082711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis3104Open in IMG/M
3300033180|Ga0307510_10082954All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3097Open in IMG/M
3300033180|Ga0307510_10313857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1026Open in IMG/M
3300033180|Ga0307510_10644560All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis516Open in IMG/M
3300034389|Ga0325419_000011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida191448Open in IMG/M
3300034389|Ga0325419_000029All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida124229Open in IMG/M
3300034389|Ga0325419_015568All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae7367Open in IMG/M
3300034688|Ga0325420_048482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis2662Open in IMG/M
3300034688|Ga0325420_067224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1851Open in IMG/M
3300034688|Ga0325420_084957Not Available1356Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza53.64%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem40.40%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf5.30%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0111538_1391327813300009156Populus RhizosphereADVGCKRRRSPAMAEENPGGDAAEESTGGTARKEGCTAGEEESWTTGAAEFEDVCGGCSIEEGRLRGCEKSRFNLF*
Ga0307517_10001283263300028786EctomycorrhizaMLAATETTAALDVGCKKRCSPAMAEEKPGGEATEESRGGAAGEEGCTAREEGWTAGAAAEEDVCDSCSIEEGRL
Ga0307517_10001320353300028786EctomycorrhizaMFAAAETTAASDVGCKRRRSPAMAEEKPGGEAAEESRGGAVGEEGRTAGAAEEEDVCGGCSIEEGGAVRKVG
Ga0307517_1000323023300028786EctomycorrhizaMLAAVEAADVGCKRRRSPAMTEENPGGDAAEESIGGAARKEGCTVGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307517_1006789823300028786EctomycorrhizaMMLAAVEAADVGCKRRRSPAMAEENPGGDATEESIGGAARKEGCTAGEEESWTAGAAEFEDVCGGCSIEEERLGGCEKSRFNLF
Ga0307517_1019249413300028786EctomycorrhizaMLAAVEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGEK
Ga0307517_1046650713300028786EctomycorrhizaMLVAAETTAASNVGCKRRCSPAITEEKPGDEAAEESRGGTAVEEGCTAGEEGWTAGAAAEEDVCGGCSIEEGRL
Ga0307517_1048078613300028786EctomycorrhizaMLAAVEAAEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAKFKDVCGGCSIEEGRLGGCEKSSFNLF
Ga0307517_1054305613300028786EctomycorrhizaMLAAVEAAEATDVGCKRRRSPAMAEENPGGDAAEESTGGAARKEGCTVGEEESWTAGAAEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307517_1060918323300028786EctomycorrhizaVAVEAADVGCKRRRSPAMAEENPGGDATEESIGGTARKEGCTAREEESWTASAAEFEDVCGGCSIEEGRLGGWEKSRFNLF
Ga0307515_10013563183300028794EctomycorrhizaMLAAAETAAASDVGCKRRCSPAMAEEKPSGEVAEESRGGAAGEEGCTAGEEGWTAGATVEEDVCGGYSIEEGRL
Ga0307515_1001423223300028794EctomycorrhizaMLAAVEAAEAVDEGCKRRRSPAMAEENPGGDAAEESTGGAARKEGCTAGEEESWTAGAAKFKDVCGGCSIEEGRL
Ga0307515_10016132153300028794EctomycorrhizaMLAAAETAAASDVGCKRRRSPAMTEEKPGGEAAEESREGAAGEEGWTAGAAEKDVCGGCSIEEGEAVRKVG
Ga0307515_1004269513300028794EctomycorrhizaMLAAAEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTVGEEESWTAGAAEFKDVCGGCSIEEGRLGGWEKSRFNLF
Ga0307515_1007438423300028794EctomycorrhizaMLAAAETTAASDVGCKRRRSPAMAEEKPGGEAAEESRGGAAREEGCTVGEEGCTAGAAEEEDVCGGCSIEEGRL
Ga0307515_1008326123300028794EctomycorrhizaMFAAVEAADVGCKRRRSPAMAEENPGGDAAKESIGGAARKEGCTAGEEESWTAGAAEFEDVCGGCSIEEGRLGGWEAGRKVGLIYFRVLWL
Ga0307515_1018523923300028794EctomycorrhizaMLVAVEAADVGCKRRRSPAMAEENPGGDAAEESTGGTARKEGCTAGEEESWTAGAAEFEDVCGSCSIEEGRLRGCEKSRFNLF
Ga0307515_1027188313300028794EctomycorrhizaMLAAVEAAEAADVGCKTRHSPAMAEENRGGDAAEQSIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGG
Ga0307515_1063905113300028794EctomycorrhizaMLVAAETTAASDVGCKRRCSPAIAEEKPGGEAAEESREGVVGEEGCTAGEEGWTAGAAAEEDVCGGCSIEEGRL
Ga0307511_1008004313300030521EctomycorrhizaMLVAAETTAASNVGCKRRCSPAITEEKPGDEAAEESRGGTAVEEGCTAGEEGWTAGATAEEDVCGGCFIEEGRL
Ga0307511_1008604923300030521EctomycorrhizaMLAAVEAAKATDMGCKRRRSPAMAEENPGGDAAEESIGGAARKKGCTAREEESWTAGAAEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307511_1012984813300030521EctomycorrhizaMMLAAVEAADVGCKRRRSPALAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFEDVCGDCSIEEGRLGGCEKGRFNLF
Ga0307511_1014833323300030521EctomycorrhizaMFAAAETTAASDVGCKRRRSPAMAEEKPGGEAAEESRGGAVGEEGWTAGAAEEEDVCGGCSIEEGGAVRKVG
Ga0307512_1004576413300030522EctomycorrhizaMLAAVEAAEAADVGYKRRRSPAMAEENPGGDAAEESTGGAARKEGCTAGEEESWTTGAAEFEDVCGGCSIEEGRLRGCEKSRFNLF
Ga0307512_1005410713300030522EctomycorrhizaAVEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGATEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307512_1005966933300030522EctomycorrhizaMLAATETTVALDVGCKKRCSPAMTEEKPGGEATEESRGGAAGEEGCTAREEGWTAGAAAEEDVCDSCSIKEGRL
Ga0307512_1019179913300030522EctomycorrhizaMLAAVEAADVGCKKRCSPAMAEENPGGDTAEESIGGAARKEGCTAGEEESWTAGAVEFKDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307512_1029681213300030522EctomycorrhizaAAVEAADVGCKRRRSPAMAEENPGGDTAEESIGGAARKEGCTAGEEESWTAGAAKFEDVCGDCSIEEGRLGGCEKGRFNLF
Ga0307512_1033045213300030522EctomycorrhizaMWAAETAAASDVGCKRRRSPAMAEEKPGGEAAEESRGGAVGEEGWTAGAAEEEDVCGGCSIEEGGAVRKVG
Ga0307512_1035736213300030522EctomycorrhizaMLAAVEAAEAADVGCKRRRSPAMAEENPGGDAAEESTGGATRKEGCTAGEEESWTAGAAEFEDVCGGCFIEEGRLRGCEKSRFNLF
Ga0307513_1002326533300031456EctomycorrhizaMLAAVEAAEAADVGCKRRRSPAMAEENPGGDAVEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSSFNLF
Ga0307513_1007794413300031456EctomycorrhizaVEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGVAEFEDVCGGCSIEEGKLGGCEKSRFNLF
Ga0307513_1010663013300031456EctomycorrhizaRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGATEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307513_1034087323300031456EctomycorrhizaMLVAVEATEAADVGCKRRGSPTMAEENPGGDIAEESIEGAARKEGCTAGEEESWIAGAAEFEDVCGGCSIEEGRLRGCEKSRFNLF
Ga0307513_1042365213300031456EctomycorrhizaMFAAAETTAASDVGCKRRRSPAMAEEKPGGEAAEESRGGAAGEEGWTVGAAEEEDVCGGCSIEEGGAVRKVG
Ga0307513_1067854513300031456EctomycorrhizaMIAVVEAADVGCKRRRSPAMAEENPGGDAAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCGGCSIEEGRLRGCEKSKFNLF
Ga0307513_1070805913300031456EctomycorrhizaMLAAVETTAASDVGCKRRCSPAMAEEKPGGEAVEESRGDIAGEEGCTAGEEGWTAGTAVE
Ga0307513_1070950113300031456EctomycorrhizaMLAAVEAADVGCKKRCSPAMAEENPGGDTAEESIGGAARKEGCTAREEESWTAGAVEFKDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307509_1000865223300031507EctomycorrhizaMLAAAETAAASDVGCKRRRSPAMAEEKPGDEAAEESRGGAAGEEGWTAGAAEKDVCGGCSIEEGEAVRKVG
Ga0307509_1002504523300031507EctomycorrhizaMLAAVEAVEATDVGCKRRRSPAMAEENPGGDAAEESTGGAARKEGCTVGEEESWTAGAAEFEDVCGGCSIEEGRLGGWEAVRKVGLIYFRVLWL
Ga0307509_1002802693300031507EctomycorrhizaMLAAVETTAASDVGCKRRCSPAMAEEKLGGEAVEESRGGAAGEEGCTVGEEGWTTGAAVEEDVCGGCSIEEGRL
Ga0307509_1003706463300031507EctomycorrhizaMLAAVEAAKATDMGCKRRRSPAMAKENPGGDAAEESIGGAARKEGCTAREEESWTAGAAEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307509_1014826323300031507EctomycorrhizaMLVAVETAAASDVCCKRRCSPAIAEEKPGGEAAEESRGGAAGEEGCTTGEEGWTAGAAAEEDVCGGCSIEEGRL
Ga0307509_1031048213300031507EctomycorrhizaMIAAVEAAEAADVGCKRRRSPAMAEENPGGDAAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCGGCSIEEGRLRGCEKSKFNLF
Ga0307509_1031150613300031507EctomycorrhizaMLAAAETAAASDVGCKRRCSQAMAEKKPSGEAVEESRGGAAGEEGCTVGEEGWTAGTAVEKDVCGGCSIEEGRL
Ga0307509_1057776413300031507EctomycorrhizaMLAATETTAALDVGCKKRCSPAMTEEKPGGEATEESRGGAAGEEGCTAREEGWTAGAAAEEDVCDSCSIEE
Ga0307509_1061949613300031507EctomycorrhizaVAVEAADVGCKRRRSPAMAEENPGGDAAEESTGGTARKEGCTAGEEESWTAGAAEFEDVCGSCSIEEGRLRGCEKSRFNLF
Ga0307509_1071042613300031507EctomycorrhizaMLAAVEAADVGCKKRCSPAMAEENPGGDTAEESIGGAARKEGCTAGEEESWTAGAVEFKDVCGGCSIEERRLGGCEKSRFNLF
Ga0307509_1086910913300031507EctomycorrhizaMLATAETAAASDVGCKRRCSPAMAEEKPGGEAVEESRGGVAGEEGCTAGEEGWTTGAAVEEDVCGGCSIEEGRL
Ga0307509_1099698513300031507EctomycorrhizaMLAAVEAADVGCKRRRSPAMAEENPGGEAAEESIGGAARKEGCTAGEEESWTAGAAEFEDVCGGYSIEEGRLVVL
Ga0307509_1100413713300031507EctomycorrhizaMLAAVEAAEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSSFNLF
Ga0307508_1001281043300031616EctomycorrhizaMLVVVETAAASDVGCKRRCSPAIAEEKSGGEAAEESRGGAAGEEGCTTGEEGWTAGAAAEEDVCGGCSIEEGRL
Ga0307508_1014182643300031616EctomycorrhizaMFAAAETTAASDVGCKRRRSPAMAEEKPGGEAAEESRGGAAGEEGWTAGAAEEEDVCGGCSIEEGGVVRKVG
Ga0307508_1041057313300031616EctomycorrhizaMLAAAETVVASDMGCKRRRSPTMAEEKPGGEAAEESRGGAAREEGCTVGEEGCTAGAAEEEDVCGGCSIEEGRL
Ga0307508_1088335913300031616EctomycorrhizaVAVEAADVGCKRRRSPAMAEENPGGDAAKESTGGTARKKGCTAGEEESWTAGAAEFEDVCGSCSIEEGRLRGCEKSRFNLF
Ga0307514_1005745333300031649EctomycorrhizaMLAAVEAAEATDMGCKRRRSPAMAEENPGGDAAEESTGGAARKEGCTVGEEESWTAGAAEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307514_1007874423300031649EctomycorrhizaMLAAAETTAASDVGCKRRCSPAMAEEKPGGEAVEESRGDIAGEEGCTAGEEGWTAGTAVEEDVCGGCSIEEGRL
Ga0307514_1012097533300031649EctomycorrhizaMLAATETTAALDVGCKKRCSPAMAEEKPGGEATEESRGGAAGEEGCTAREEGWTAGAAAEEDVCD
Ga0307514_1016310313300031649EctomycorrhizaMLAAVEAADVGCKRRHSPAMAEENPGGDAAEESTRGAARKEGCTAGEEESWTAGAAEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307514_1025351513300031649EctomycorrhizaMLAAVEATEAADVGCKRRRSPAMAEENPGGDAVEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSSFNLF
Ga0307514_1040159313300031649EctomycorrhizaMLVAAETTAASNVGCKRRCSPAITEEKPGDEAAEESRGGTAVEEGCTAGEEGWTAGAAAEEDVCGGCSIEKGRL
Ga0307516_1028696313300031730EctomycorrhizaEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSSFNLF
Ga0307516_1029638713300031730EctomycorrhizaMLATAETTAASDVGCKRRCSPAMAEEKPGGEAVEESRGGVAGEEGCTAGEEGWTTGAAVEEDVCGGCSIEEGRL
Ga0307516_1038354013300031730EctomycorrhizaMLAAAETAAASDVGCKRRCSQAMAEKKPGGEAVEESRGGAAGEEGCTVGEEGWTAGTAVEEDVCGGCSIEEGRL
Ga0307516_1096976313300031730EctomycorrhizaASDVGCKRRRSPAMAEEKPGDEAAEESRGGAAGEEGWTAGAAEKDVCGGCSIEEGEAVRKVG
Ga0307518_1018451023300031838EctomycorrhizaMLAAVEAADVGYKRRRSPAMAKENPGGDAIEESIGGTARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRL
Ga0307518_1030827923300031838EctomycorrhizaMLAAVEAAEVADVGCKRRRSPAMAEENPGGDAAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCGGCSIEEGRLRGCEKSRFNLF
Ga0307518_1034922113300031838EctomycorrhizaMFAAVEAADVGCKRKRSPAMTEENPGGDAAEESTGGAARKERCTAGEEESWTAGAAEFDVCGGCSIEEGRLRGCEKSKFNLF
Ga0307518_1039310023300031838EctomycorrhizaMLAAAETAAASDMGCKRRCSPAMVEEKPGSEAVKESRGGAAGEEGCTAGEEGWTAGAAVEEN
Ga0307518_1051543113300031838EctomycorrhizaMIAAVEAVDVGCKRRRSPAMAEENPGGDAAEESTGGAARKEGCTAEEEESWTAGAAKFKDVCGGCSIEEGRL
Ga0307518_1063218613300031838EctomycorrhizaMLAEVEAAEATDMGCKRRRSPAMAEENPGDDAAEESTGGAARKEGCTVGEEESWTAGAAEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0325403_1002847103300032354XylemMLAAIEAADVGCKRRRSPAMVEENPGGDAAEESIGGAARKEGCTAGEEKSWTAGAAEFEDVCGDCSIEERRLGGCEKSRFNLF
Ga0325403_100314433300032354XylemMLATVEAADVGCKRRRSPAMAEENPGGDAAEESTRGAARKEGCTAREEESWTAGAAEFEDVCGGCSIEEGRLRGCEKSRFNLF
Ga0325403_101393123300032354XylemMEIMLAAVEEAEAADVGCKRRRSPAMVEENPGGDAAEESTGGAARKEGCTAGEDESWTAGATKYEDVCGGCSIEEGRLRGCEKSRFNLF
Ga0325403_102103523300032354XylemMLAAVEAAEAVDVGCKRRRSPAMAEENPGGDTAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCGGCFIEEGRL
Ga0325403_102179823300032354XylemMLAAVKAAEAADVGYKSRRSLAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFEDVCGGCSIKEGRLRGCEKRRFNLF
Ga0325403_102272743300032354XylemVAVEAADVGCKRRRSPAMAEENPGGDAAKESIGGAARKEGCTAREEESWAAGAAEFKDVCGGCSIEEGRLGGCEKSRFNLF
Ga0325403_102549853300032354XylemMLVTVEAAEAADVGCKRRRSPAMAEGNPGGDAGEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSRFNLF
Ga0325403_103183273300032354XylemMLAAVEAAEAADVGCKRRRSPAMTEENPGGDAAEESIGSAVRKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLRGCEKSRFNLF
Ga0325403_104436813300032354XylemMLATVEAAEAADVGCKRRRSPAMTEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGSCEKSRFNLF
Ga0325403_104770753300032354XylemMLAAVEAADVGCTRRRSPAMAEENPSGDAAEESTGGTARKEGCTAEEEESWTAGVAEFEDVWGGYSIEEGRLRGCEKSRFNLF
Ga0325403_104807713300032354XylemMLAAVEAADVGCKRRSSPAMAEENPGGDAVEKSTGGVARKEGCTAGEEESWTAGAAEFEDVCGGCFIEEGRLRGCEKGRFNLF
Ga0325403_104943133300032354XylemMLAAVEAADVGCKRRRSPYMVEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAKFKDVCGGYSIEEGRLRGCEKNRFNLF
Ga0325403_105074043300032354XylemMVVEAAEAADVGYKRRRSPPMVEENPGGDTTEESTGGAARKEGCTAEEEESWTAGAAEFEDVYGGCSI
Ga0325403_105261423300032354XylemMLAAVEAAEAADVGCKRRHSPAMVEENPGSDTAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCSCCFIEEGRLGDCEKSRFNLF
Ga0325403_106643523300032354XylemMLATVEAADVGCKRRRSPAMAEENPGGDAAEESTGGTARKEGCTAGEEERWTAGVAEFEDVCGGCSIEEGRLRGCEKSRINLF
Ga0325403_106817913300032354XylemMLAAVEAADVGCKRRRSPAMAEENPGSDAAEESTGGTARKEGCTAGEEESWTAGVAEFEDVCGGCSIEEGRLRGCEKSRFNLF
Ga0325403_108908613300032354XylemMFVAVEAAEAADVGCKRRHSPAMAKENPGGDAAEESIGGATRKEGCTAEEEESWTAGAAEFKDVCSSCSIEEGRL
Ga0325403_111888613300032354XylemMLAAVEAADVGCKRRRSPAMVEENPGSDAAEESTGGAARKEGCTAGEEESWTAGATEFEDVCDGCSIEEGRLGGCEKSMFNLF
Ga0325403_112241413300032354XylemMLAAAEAADVGCKRRRSPAMVEENPGGDAVEESTGCTARKEGCTAGEEESWTAGAAEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0325403_112843633300032354XylemMLAAVEAADTGCKRRRSPAMAEENPGGDAAEESRGGVPREEGCTVEEEESWTAGAAEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0325403_115992813300032354XylemMLAAIEAVEAVEAADVGCKRRRSPAIIEENPGGDAAKESIAGAARKEGCTAGEEESWTASAAEFEDVYGGCSIEEGRL
Ga0325403_116157313300032354XylemMLAAIEAVEAADVGCKRRRSPAIVEENPGGDAAEESIAGAARKEGCTAGEEESWTASAAEFEDVYGGCSIEEGRL
Ga0325401_1005505113300032355XylemVTVEAAEAADVGCKRRRSPAMAEGNPGGDAGEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSRFNLF
Ga0325401_101507353300032355XylemMTXXVXEREIMLAAVEAAEAADVGCKRRHSPAMVEENPGSDTAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCSCYFIEEGRLGDCEKSRFNLF
Ga0325401_103255723300032355XylemMLVAVEAANMGCKRRRSPAMAEENPGGDAAEESTGGAARKEGWTAGAAEFEDVCGGCSTEEGRLRGCDKSRFNLF
Ga0325401_110304523300032355XylemMLAAVEAADVGCKRRRSPAMAEENPGSDAAKESRGGAARKEGCTAGEEKSWTAGAAEFEDVCGGCSIEEGRLIGCEKSMFNLF
Ga0325401_111188323300032355XylemMLAAVEAADVGCKRRRSPAMAEENPGGDAVEKSTRGATRKESCTAGEEESWTAGAAEFEDVCGGCSIEEGRLIGCEKSMFNLF
Ga0325401_119303213300032355XylemMLAAIEAVEAVEAADVGCKRRRSPAIIEENPGGDAAKESIAGAARKEGCTAGEEESWTASAAEFEDVYGGCSIEEGRLGGWEAGRKVGLIYFRVLWL
Ga0325401_121194313300032355XylemMLAAIEAVEAADVGCKRRRSPAIVEENPGGDAAEESIAGAARKEGCTAGEEESWTASAAEFEDVYGGCSIEEGRLGGWEKSRFNLF
Ga0325401_124982323300032355XylemMLTVVEAADVGYKRRRSPPMVEENPGGDTAEESTGGAARKEGCTAGEEESWTAGAAEFEDVYGGCSI
Ga0325400_101776343300032374XylemMLAAVEAADVGCKRRHSPAMVEENPSGDATKESTGGAARKEGCTAGEEESWTAGAAEFEDVCGGCSIEEGRL
Ga0325400_104480293300032374XylemMLAAVEAADVGCKRRRSPAMAERNPGGDAGEENIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSRFNLF
Ga0325400_106549713300032374XylemMLAAVEAAEAADVGCKRRHSPAMVEENPGSDTAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCSCYFIEEGRLGDCEKSRFNLF
Ga0325405_100000493300032389XylemMVVEAAEAADVGYKRRRSPPMVEENPGDDTTEESTGGAARKEGCTAEEEESWTAGAAEFEDVYGGCSI
Ga0325405_100501723300032389XylemMLAAVEAAKATDVGYKRRRSPAMAEENPGGDAVEKSIGGAARKEGCTVGEEESWTAGAAEFKNVCRGCSIEEGRLGGCEKSRFNLF
Ga0325405_100615963300032389XylemMLAAVEAAEAADVGCKRRRSPAMVEENPGSDTAEESTGGAARKEGCTTGEEESWTAGAAEFEDVCSFCFIEEGRLGDCEKSRFNLF
Ga0325405_100693423300032389XylemMLAAVEAAKAVDVGYKRRRSPAMAEENPGGDAVEKSIGGTARKEGCTAGEEESWTAGAAEFKNVCRGCSIEEGRLGGCEKSRFNLF
Ga0325405_101314723300032389XylemMLAAIEAVEAADVGCKRRRSPAIVEENPGGDAAEESIAGAARKEGCTAGEEESWTASAAEFKDVYGGCSIEEGRLGGWEKSRFNLF
Ga0325405_101440323300032389XylemVAVEAADVGCKRRRSPTMVEENPGGDAAKKSTGGAARKEGCTAREEESWTAGAAEFEDVCGVVPLKKGG
Ga0325405_102475823300032389XylemMEIMLAAIEAADAGCKRRRSPAMVEENPGGDAAEESIGGAARKEGCTAGEEESWTAGVAEFEDVCGDCSIEERRLGGCEKSRFNLF
Ga0325405_102995943300032389XylemMLAAVEATDVGCKRRRSPAKAEENLGDDAAEESIGGAARKEGCTTGEEESWTAGAAEFKDVCSGCSIEEGRLGGCEKSRFNLF
Ga0325405_104142913300032389XylemMLAAVEAADVGCKRRRSPAMAEENLGGDAAKESTGGAARKESCTAGEEESWTAGAAEFEDVCGGCSIEEGRLIGCEKSMFNLF
Ga0325405_105113123300032389XylemMLAAAETAAASDMGCKRRRSPAMAEEKPGGEVAEESRXGVAGEEGCTAKKEGXTAGAAKEEDVWGGCSIE
Ga0325405_105509143300032389XylemMLAAVEAADVGCKRRRSPAMVEENPGSDAAEESTGGAARKEGCTAGEEESWTAGATEFEDVCDGCSIEEGRLGGWEKSMFNLF
Ga0325405_106291343300032389XylemMFVAVEAAEAADVGCKRRHSPAMAKENPGGDAAEESIGGATRKEGCTAGEEESWTAGAAEFKDVCSSCSIEEGRLGGCEKSSFNLF
Ga0325405_107330613300032389XylemMLAAVEATEAVDVGCKRRRSPAMAEENPGGYAVEESTGGAARKEGCTAGEEESWTVGAAEFEDVCGDCSIEEGRL
Ga0325405_110164423300032389XylemMEIMLATVKEAEAADVGCKRRRSPAMVEENPGDDAAEESTGGAARKEGCTAGEDESWTAGATEYEDVCGGCSIEEGKLGGCEKSRFNLF
Ga0325405_111449613300032389XylemMLAAVEAAEAVDMGCKRRRSPAMAEENPGGDTAEESTGGAARKEGCTAGEEESWTAGVAKFEDVCGGCFIEEGRL
Ga0325405_112650113300032389XylemMLAAVEATEAVDVGCKRRRSPAMAEENPGGDTAEESTGGAARKEGCTAGEEESWTAGVAKFEDVCGGCFIEEGRL
Ga0325404_1000228463300032390XylemMLATVEAAEAADVGCKRRRSPAMTEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSRFNLF
Ga0325404_100806943300032390XylemMLAAVEAADVGCKRRRSPAMAEENPSGDAAEESRGGAAREEGCTIGEEESWTAGAVEFEDVCSGCSIEEGRLRGCEKNMFNLF
Ga0325404_100860253300032390XylemMLAAVEAAEAADVGCKRRRSPAMVEENPGSDTAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCSFCFIEEGRLGDCEKSRFNLF
Ga0325404_102255653300032390XylemVAVEAADVGCKRRRSPAMAEENPGGDAAKESIGGVARKEGCTAREEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSRFNLF
Ga0325404_105476823300032390XylemMLATVEAADVGCKRRRSPAMAEENPGGDAAKESTGGTARKEGCTAGEEERWTAGVAEFEDVCGGCSIEEGRLRGCEKSRINLF
Ga0325404_105750423300032390XylemMLEAVKAADVGCKRRHSPAMAKENPGGDAAEESIGGATRKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGGCEKSSFNLF
Ga0325404_110887113300032390XylemMLAAVEAAEAVDMGCKRRRSPAMAEENPGGDTAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCGGCFIEEGRL
Ga0325410_105801443300032735XylemMLAAVEAADVGCKRRRSPAMVEENPGGDAAEESTGGAARKEGCTAGEEESWTAGATEFEDVCDGCSIEEGRLGGCEKSMFNLF
Ga0325410_112162513300032735XylemMLATVEAAEAADVGCKRRRSPAMTEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLG
Ga0325410_112220413300032735XylemMLAAVEATEAVDVGCKRRRSPAMAEENPGGDTAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCGGCFIEEGRL
Ga0325414_103034253300032741LeafMLATVEAAEAAEAADVGCKRRRSPAMTEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGSCEKSRFNLF
Ga0325414_106257713300032741LeafMLAAVEATDVGCKRRRSPAMAEKNPGGDAAEESREGAAREEGCTIREEESWTASAAEFEDVCGGCSIEEGRLGGWEKIKFNLF
Ga0325402_101515643300033160XylemMTXXVXEREIMLAAVEAAEAVDVGCKRRRSPAMAEENPGGDTAEESTGGAARKEGCTAGEEESWTAGAAEFEDVCGGCFIEEGRLXEK
Ga0325402_106343523300033160XylemMLAAVEAADVGCKRRRSPTMVEENPGGDAAKKSTGGAARKEGCTAREEESWTAGAAEFEDVCGAVPLKKGG
Ga0307507_10011909103300033179EctomycorrhizaMFAAAETTAASDVGCKRRRSPAMAEEKPGGEAAEESRGGAAGEEGWTAGAAEEEDVCGGCSIEEGGAVRKVG
Ga0307507_1016385313300033179EctomycorrhizaMLAAVEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGVAEFEDVCGGCSIEEGKLGGCEKSRFNLF
Ga0307507_1027576613300033179EctomycorrhizaMLATAETAAASDVGCKRRCSPAMAEEKPGGEAVEESRGGVAGEEGCTAGEEGWTTGAAVEEDVCGGCSIEKGRL
Ga0307507_1033240513300033179EctomycorrhizaMLAAVEVAEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGEK
Ga0307507_1036147713300033179EctomycorrhizaLAAAEAADVGCKRRRSPAMAEENPGGDAAEQSIGGAARKEGCTAGEEESWTAGAAEFKDVCGGCSIEEGRLGG
Ga0307510_1001858493300033180EctomycorrhizaVAVEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAREEESWTAGAAEFEDVCGGCSIEEGRLGEK
Ga0307510_1003227623300033180EctomycorrhizaMLAAVEAADVGCKRRRSPAMTEENPGGDAAEESIGGAARKEGCTVGEEESWTAGAAEFKDVCGGCSIEEGRL
Ga0307510_1008271133300033180EctomycorrhizaMLAAVEAAKATDMGCKRRRSPAMAKENPGDDAAEESIGGAARKEGCTAREEESWTAGAAEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307510_1008295413300033180EctomycorrhizaMLAAVEAADVGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEERWTAGAAEFKDVCGGCSIEEGRLGGCEKSSFNLF
Ga0307510_1031385723300033180EctomycorrhizaMLATVEAAEAADMGCKRRRSPAMAEENPGGDAAEESIGGAARKEGCTAGEEESWTAGATEFEDVCGGCSIEEGRLGGCEKSRFNLF
Ga0307510_1064456013300033180EctomycorrhizaVAVEAAEAADVGCKRRHSPAMAEENPSGDAAEESIGGAARKEGCTAGEEESWTAGAAEFEDVCGGYSIDEGRLGGCEKSRFNLF
Ga0325419_000011_178892_1791043300034389LeafMLMVVEAAEAADVGYKRRRSPPMVEENPGGDTTEESTGGAARKEGCTAEEEESWTAGAAEFEDVYGGCSI
Ga0325419_000029_68849_690763300034389LeafMLAAVKAAEVIDVGCKRRRSPAMAEENPGGDVAEESRGGAAREEGCTVGEEESWIAGVAEFEDVCGGCSIEEGRL
Ga0325419_015568_1482_16973300034389LeafMLVAVEAADVGCKRRRSPTMVEENPGGDAAKKSTGGAARKEGCTAREEESWTAGAAEFEDVCGVVPLKKGG
Ga0325420_048482_125_3763300034688LeafMFAAVQAADVGCKRRRSPSMAEENPGGDTAEESIGGATRKEGCTTREEESWTAGAAKFKDVCGGCFIEEGRLGGCEKSRFNLF
Ga0325420_067224_1473_16913300034688LeafMLAAVEAADVGCKRRHSPAMVEENPSGNATKESTGGAARKEGCTAGEEESWTAGAAEFEDVCGGCSIEEGRL
Ga0325420_084957_1039_12903300034688LeafMLAAVEAADVGCKRRRSPAMVEENPGGDAAEESTGGAARKEGCTAGEEESWTAGATEFEDVCDGCSIEEGRLGGWEKSMFNLF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.