NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047167

Metagenome / Metatranscriptome Family F047167

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047167
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 40 residues
Representative Sequence MARGRKTSLTIRLTPAERQTLLAWQRATTISAGRARR
Number of Associated Samples 107
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 97.28 %
% of genes near scaffold ends (potentially truncated) 96.67 %
% of genes from short scaffolds (< 2000 bps) 94.67 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (50.667 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(24.000 % of family members)
Environment Ontology (ENVO) Unclassified
(27.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(56.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.00%    β-sheet: 0.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF00076RRM_1 4.67
PF01209Ubie_methyltran 4.00
PF00072Response_reg 2.00
PF01609DDE_Tnp_1 2.00
PF04972BON 2.00
PF10771DUF2582 2.00
PF01548DEDD_Tnp_IS110 1.33
PF03400DDE_Tnp_IS1 1.33
PF00216Bac_DNA_binding 1.33
PF13613HTH_Tnp_4 0.67
PF13546DDE_5 0.67
PF13650Asp_protease_2 0.67
PF13560HTH_31 0.67
PF02452PemK_toxin 0.67
PF13358DDE_3 0.67
PF01610DDE_Tnp_ISL3 0.67
PF00753Lactamase_B 0.67
PF02518HATPase_c 0.67
PF13676TIR_2 0.67
PF00196GerE 0.67
PF04392ABC_sub_bind 0.67
PF05443ROS_MUCR 0.67
PF13580SIS_2 0.67
PF06794UPF0270 0.67
PF13518HTH_28 0.67
PF01471PG_binding_1 0.67
PF00589Phage_integrase 0.67
PF11075DUF2780 0.67
PF13551HTH_29 0.67
PF01807zf-CHC2 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 4.00
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 4.00
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 2.00
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 2.00
COG3293TransposaseMobilome: prophages, transposons [X] 2.00
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 2.00
COG5421TransposaseMobilome: prophages, transposons [X] 2.00
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 2.00
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 1.33
COG1662Transposase and inactivated derivatives, IS1 familyMobilome: prophages, transposons [X] 1.33
COG3547TransposaseMobilome: prophages, transposons [X] 1.33
COG0358DNA primase (bacterial type)Replication, recombination and repair [L] 0.67
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.67
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.67
COG3089Uncharacterized conserved protein YheU, UPF0270 familyFunction unknown [S] 0.67
COG3464TransposaseMobilome: prophages, transposons [X] 0.67
COG4957Predicted transcriptional regulatorTranscription [K] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A50.67 %
All OrganismsrootAll Organisms49.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_102015894Not Available996Open in IMG/M
3300000858|JGI10213J12805_10477013Not Available626Open in IMG/M
3300000858|JGI10213J12805_10947363All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium557Open in IMG/M
3300000955|JGI1027J12803_102714466All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300005332|Ga0066388_102261059Not Available983Open in IMG/M
3300005332|Ga0066388_102978302All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005332|Ga0066388_104624418Not Available700Open in IMG/M
3300005467|Ga0070706_101929262All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium536Open in IMG/M
3300005558|Ga0066698_10706975Not Available664Open in IMG/M
3300005559|Ga0066700_10985817Not Available555Open in IMG/M
3300005576|Ga0066708_10681797All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005586|Ga0066691_10341743Not Available886Open in IMG/M
3300005617|Ga0068859_102114939Not Available621Open in IMG/M
3300005719|Ga0068861_100516372All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300005764|Ga0066903_104223716All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella768Open in IMG/M
3300005764|Ga0066903_108829054Not Available512Open in IMG/M
3300006194|Ga0075427_10025907All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300006196|Ga0075422_10165455All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300006794|Ga0066658_10780451All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300006796|Ga0066665_11505561Not Available525Open in IMG/M
3300006797|Ga0066659_10397482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1083Open in IMG/M
3300006844|Ga0075428_100109046All Organisms → cellular organisms → Bacteria3017Open in IMG/M
3300006844|Ga0075428_101193008All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300006844|Ga0075428_101316013All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300006845|Ga0075421_102086649Not Available601Open in IMG/M
3300006846|Ga0075430_100584095Not Available922Open in IMG/M
3300006847|Ga0075431_100160330All Organisms → cellular organisms → Bacteria2313Open in IMG/M
3300006847|Ga0075431_100399598All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1375Open in IMG/M
3300006847|Ga0075431_100777708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia amicalis931Open in IMG/M
3300006847|Ga0075431_101508880All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina631Open in IMG/M
3300006852|Ga0075433_10845191All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300006853|Ga0075420_100247981All Organisms → cellular organisms → Bacteria1548Open in IMG/M
3300006854|Ga0075425_102133670Not Available625Open in IMG/M
3300006871|Ga0075434_101866837Not Available607Open in IMG/M
3300006880|Ga0075429_100610795Not Available955Open in IMG/M
3300006880|Ga0075429_101137601Not Available682Open in IMG/M
3300006903|Ga0075426_10647252Not Available791Open in IMG/M
3300006969|Ga0075419_10488466Not Available854Open in IMG/M
3300006969|Ga0075419_11197267All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium560Open in IMG/M
3300006969|Ga0075419_11526780All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium502Open in IMG/M
3300007255|Ga0099791_10238975Not Available860Open in IMG/M
3300007265|Ga0099794_10065853All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1767Open in IMG/M
3300009012|Ga0066710_102816226All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium687Open in IMG/M
3300009012|Ga0066710_104276949All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium533Open in IMG/M
3300009089|Ga0099828_10232916All Organisms → cellular organisms → Bacteria1648Open in IMG/M
3300009090|Ga0099827_11107051Not Available688Open in IMG/M
3300009090|Ga0099827_11138233Not Available678Open in IMG/M
3300009094|Ga0111539_12825229Not Available562Open in IMG/M
3300009098|Ga0105245_10760287Not Available1005Open in IMG/M
3300009100|Ga0075418_10303071All Organisms → cellular organisms → Bacteria1703Open in IMG/M
3300009100|Ga0075418_10511535Not Available1289Open in IMG/M
3300009100|Ga0075418_10630542All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1154Open in IMG/M
3300009100|Ga0075418_12488452Not Available565Open in IMG/M
3300009100|Ga0075418_12762599Not Available536Open in IMG/M
3300009137|Ga0066709_100947666All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1257Open in IMG/M
3300009137|Ga0066709_101009399All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1219Open in IMG/M
3300009143|Ga0099792_10508528All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria755Open in IMG/M
3300009156|Ga0111538_10490523All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300009156|Ga0111538_13250059Not Available566Open in IMG/M
3300009162|Ga0075423_12164143Not Available604Open in IMG/M
3300009162|Ga0075423_13011362Not Available516Open in IMG/M
3300010043|Ga0126380_11103973All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12676Open in IMG/M
3300010046|Ga0126384_11165044Not Available709Open in IMG/M
3300010046|Ga0126384_12089361Not Available543Open in IMG/M
3300010048|Ga0126373_10186997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1997Open in IMG/M
3300010358|Ga0126370_11181458Not Available710Open in IMG/M
3300010359|Ga0126376_10359734All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella1294Open in IMG/M
3300010359|Ga0126376_11270766All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria755Open in IMG/M
3300010360|Ga0126372_10571045All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella1079Open in IMG/M
3300010360|Ga0126372_13103759Not Available516Open in IMG/M
3300010362|Ga0126377_11767382Not Available694Open in IMG/M
3300010366|Ga0126379_10101397All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis2562Open in IMG/M
3300010366|Ga0126379_13292339Not Available541Open in IMG/M
3300012198|Ga0137364_11446950Not Available507Open in IMG/M
3300012199|Ga0137383_10917542All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium639Open in IMG/M
3300012199|Ga0137383_10944747Not Available629Open in IMG/M
3300012203|Ga0137399_10078476Not Available2499Open in IMG/M
3300012203|Ga0137399_10646685All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium890Open in IMG/M
3300012203|Ga0137399_11181469All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300012206|Ga0137380_11746618All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300012209|Ga0137379_10163113Not Available2140Open in IMG/M
3300012209|Ga0137379_11291494All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella635Open in IMG/M
3300012210|Ga0137378_11272228Not Available652Open in IMG/M
3300012211|Ga0137377_10295468All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1554Open in IMG/M
3300012349|Ga0137387_10848549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4661Open in IMG/M
3300012353|Ga0137367_10492606Not Available864Open in IMG/M
3300012357|Ga0137384_10939578Not Available696Open in IMG/M
3300012359|Ga0137385_10456345All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella1085Open in IMG/M
3300012361|Ga0137360_10514619All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella1019Open in IMG/M
3300012361|Ga0137360_11109194Not Available683Open in IMG/M
3300012363|Ga0137390_11466220Not Available624Open in IMG/M
3300012391|Ga0134035_1120985Not Available1092Open in IMG/M
3300012908|Ga0157286_10444203Not Available514Open in IMG/M
3300012948|Ga0126375_10071580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece → unclassified Cyanothece → Cyanothece sp. SIO1E11947Open in IMG/M
3300012971|Ga0126369_11380133All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium795Open in IMG/M
3300012971|Ga0126369_12174941Not Available642Open in IMG/M
3300013297|Ga0157378_10992366All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300013306|Ga0163162_10354149All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1600Open in IMG/M
3300014154|Ga0134075_10446970All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium574Open in IMG/M
3300014326|Ga0157380_11976879All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300014326|Ga0157380_13543485Not Available500Open in IMG/M
3300015264|Ga0137403_10272249All Organisms → cellular organisms → Bacteria → Proteobacteria1596Open in IMG/M
3300015371|Ga0132258_13033788All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300015371|Ga0132258_13348235Not Available1102Open in IMG/M
3300015372|Ga0132256_100349803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → unclassified Fischerella → Fischerella sp. PCC 96051572Open in IMG/M
3300015373|Ga0132257_100883466Not Available1119Open in IMG/M
3300015373|Ga0132257_101092763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1006Open in IMG/M
3300015374|Ga0132255_101319802Not Available1089Open in IMG/M
3300018082|Ga0184639_10212246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus1026Open in IMG/M
3300025910|Ga0207684_11048764Not Available680Open in IMG/M
3300025936|Ga0207670_10343509All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300025961|Ga0207712_10896910Not Available783Open in IMG/M
3300025961|Ga0207712_11350040All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella637Open in IMG/M
3300025961|Ga0207712_12139431Not Available500Open in IMG/M
3300026313|Ga0209761_1192562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria908Open in IMG/M
3300026318|Ga0209471_1103688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_131227Open in IMG/M
3300026318|Ga0209471_1302018Not Available530Open in IMG/M
3300026552|Ga0209577_10710502Not Available568Open in IMG/M
3300027577|Ga0209874_1058186All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300027655|Ga0209388_1169542Not Available613Open in IMG/M
3300027873|Ga0209814_10529766Not Available523Open in IMG/M
3300027880|Ga0209481_10461337Not Available654Open in IMG/M
3300027882|Ga0209590_10809547Not Available595Open in IMG/M
3300027909|Ga0209382_10423512Not Available1479Open in IMG/M
3300027909|Ga0209382_11495505Not Available673Open in IMG/M
3300027909|Ga0209382_11522367All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium665Open in IMG/M
3300028587|Ga0247828_10251768Not Available950Open in IMG/M
3300028587|Ga0247828_10443021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6758Open in IMG/M
3300028587|Ga0247828_10988944Not Available549Open in IMG/M
3300028819|Ga0307296_10549262All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300030563|Ga0247653_1041352Not Available620Open in IMG/M
3300031081|Ga0308185_1033543All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria627Open in IMG/M
3300031092|Ga0308204_10159751All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium675Open in IMG/M
3300031099|Ga0308181_1160566All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla533Open in IMG/M
3300031561|Ga0318528_10469532Not Available676Open in IMG/M
3300031572|Ga0318515_10498355All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium650Open in IMG/M
3300031640|Ga0318555_10608645Not Available592Open in IMG/M
3300031770|Ga0318521_10489488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi738Open in IMG/M
3300031858|Ga0310892_11343713Not Available512Open in IMG/M
3300031873|Ga0315297_10579986All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300031890|Ga0306925_12049937Not Available538Open in IMG/M
3300031908|Ga0310900_11046820Not Available673Open in IMG/M
3300031947|Ga0310909_10483321All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300032001|Ga0306922_11132039Not Available800Open in IMG/M
3300032068|Ga0318553_10572664Not Available591Open in IMG/M
3300032159|Ga0268251_10325331Not Available645Open in IMG/M
3300032180|Ga0307471_102620260All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium639Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere24.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil20.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.33%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.67%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.67%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.67%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012391Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300030563Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031081Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10201589423300000559SoilMARGRITSLTISLTPTERQTLLAWQRATTIAAGRARRG
JGI10213J12805_1047701323300000858SoilMARGRKTSLTISLTPEERQTLRAWQRATIVPSGVS
JGI10213J12805_1094736313300000858SoilMPRGRPTALTIRLTPAERQTLLAWQRATTIPAGRARRGRMIL
JGI1027J12803_10271446613300000955SoilMPRGRRTSLTIRLTPAERLTLLAWQRATSIPAGLARRARIILLL
Ga0066388_10226105913300005332Tropical Forest SoilMARGRTTALTLTLTPAERRTLLAWQRATTIAAGRARRGRMILLIA
Ga0066388_10297830213300005332Tropical Forest SoilMARGRKTALTIRLASDERHTLMAWQRSTTIPAGRARRGRI
Ga0066388_10462441823300005332Tropical Forest SoilMVLFPKGVCMPRGRKTSLTIRLTPTQRQALRAWQRALTIPAGMA
Ga0070706_10192926213300005467Corn, Switchgrass And Miscanthus RhizosphereMARGRHTALTMQLTADERQTLLAWQRSTTIPAGSVRRGQIM
Ga0066698_1070697523300005558SoilMGQGRTTSLTLRLTPAERRTLLAWQRATTTISAGRARR
Ga0066700_1098581723300005559SoilMARGRKTSLTIRLTPAERLTLLTWQRATTIPAGLARRARLLVL
Ga0066708_1068179723300005576SoilMPRGRTTALTIRLTPAQRQTLLAWESSTTIPAGLARR
Ga0066691_1034174333300005586SoilMARGRTTSLTIRLTPTERQTLLTWQRATTIAAGRARRG
Ga0068859_10211493913300005617Switchgrass RhizosphereMARGRKTSLMIRLTPAERQTLLTWQRATTISAGRAR
Ga0068861_10051637233300005719Switchgrass RhizosphereMARGRKTALTIRLAADERHTLMAWQRSTTIPAGRARRGR
Ga0066903_10422371623300005764Tropical Forest SoilMARGRKTALTIRLAADERHTLMAWQRSTTIPAGRAR
Ga0066903_10882905413300005764Tropical Forest SoilMPRGRKTALRISLTADEYQTLRAWQRSTTMPAGQARRGRI
Ga0075427_1002590713300006194Populus RhizosphereMARGRKSSFTIRLTPAERLTLLTWQRATTISAGVARRARLLLL
Ga0075422_1016545523300006196Populus RhizosphereMARGRKTSLSIRLTPAVRQTLLAWQRAPTIPAGRV
Ga0066658_1078045113300006794SoilMARGRKTSFTIRLTPAERQTLLAWQRATTIPAGIARRGR
Ga0066665_1150556113300006796SoilMARGRKTALTIRLTADQRRTLLALQRSTTIRAGRARRGR
Ga0066659_1039748233300006797SoilMALGRRTSFTITLTDEERQTLLAWQPSTSIPAGIARRGRIIL
Ga0075428_10010904643300006844Populus RhizosphereMARKTSLTIHLTPADRQTLRAWQWSTTLRPGLGRRARMILLRA
Ga0075428_10119300833300006844Populus RhizosphereMAQRRKTSLIIRLTPEERQTLLAWQRAPTIRAGLVRRARMILLLAD
Ga0075428_10131601333300006844Populus RhizosphereMARGRKTALTIRLTPAERLTLLTWQRATTISAGVARRARLLLL
Ga0075421_10208664923300006845Populus RhizosphereMARGRKTSLTIRLTPAERQTLLAWQRATAIPAGLAR
Ga0075430_10058409533300006846Populus RhizosphereMARGRTTTLTISLTPAQQQTLLGWQHARTVTARHARRAGSSS
Ga0075431_10016033053300006847Populus RhizosphereMARGRKTALHIHLTPADRQTLLAWQRSTTMPAGRARR
Ga0075431_10039959813300006847Populus RhizosphereMAHGRKTSLTIELTLEERQTLLAWQRSTTMPAGRA
Ga0075431_10077770813300006847Populus RhizosphereMARKTSLTIHLTPADRQTLRAWQWSTTLRPGLGRRARMILLRAD
Ga0075431_10150888023300006847Populus RhizosphereCMARGRTTSLTIRLTPTERQTLLAWQRATTISAGPDYFWL*
Ga0075433_1084519123300006852Populus RhizosphereMARGRKTSFTIRLTPAQRQTLLMWQRATSVPAGLARRARMIL
Ga0075420_10024798113300006853Populus RhizosphereMARGRTTSLTISLTPTERQTLLAWQRATTIAAGRARRG
Ga0075425_10213367013300006854Populus RhizosphereMARGRRTSLTICLMPAERQTLLAWQGATTIAAGRTRRGRII
Ga0075434_10186683723300006871Populus RhizosphereMPCGRKTSLIIRLTPAQRLTLLTWQRSTSIPAGLARRA
Ga0075429_10061079513300006880Populus RhizosphereMARGRRTSFTISLTPAQRQTLLAWQRAPTTPAGLARRAR
Ga0075429_10113760123300006880Populus RhizosphereMASGRKTALTIRLTPAQRQLLLVRQRATGIPAGDARR
Ga0075426_1064725213300006903Populus RhizosphereMPRGRKTALSVLSVQLTPAQRQTLLAWQRSTAIPAGLAR
Ga0075419_1048846613300006969Populus RhizosphereMARGRKTSLSIRLTPAVHQTLLAWQRATTIPAGRVRRGR
Ga0075419_1119726713300006969Populus RhizosphereMARGRTTSLTVRLTPMERQTLLAWQRATTIGAGRARRGRI
Ga0075419_1152678023300006969Populus RhizosphereMARGRKTALTIRLAADERHTLMAWQRSTTIPAGRARR
Ga0099791_1023897523300007255Vadose Zone SoilMILFLKKSHMPRGRKTSLTIRLTPAQRQTLLAWQRATTIPAGQAR
Ga0099794_1006585313300007265Vadose Zone SoilMARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARRGRI
Ga0066710_10281622613300009012Grasslands SoilMRRGRRTSLTIRLTDDARQPLLAWQRSTTIPAGIARRGGALVLMA
Ga0066710_10427694913300009012Grasslands SoilMAGGRKTALTICFTQEEQQSLRSWQRSTTIPAGRAQRGRIILL
Ga0099828_1023291613300009089Vadose Zone SoilMARGRKTSLTIRLTPAERQTLLAWQRATTISAGRARR
Ga0099827_1110705113300009090Vadose Zone SoilMARGRKTSLSVPLTPAERRTLLAWQRATTISAGRAR
Ga0099827_1113823323300009090Vadose Zone SoilMARGRTTSLTIRLTLAQRQTLLAWQRSATTISAGRARRGRI
Ga0111539_1282522913300009094Populus RhizosphereMTRGRKTSLTITLTPAERQTLLAWQRATTIAAGRA
Ga0105245_1076028713300009098Miscanthus RhizosphereMARGRKTSFTIRLTPAERRTLLTWQRATTVPAGLARRARLLLLLAD
Ga0075418_1030307153300009100Populus RhizosphereMAQRRKTSLIIRLTPEERQTLLAWQRAPTIRAGLVRRARMILLLADGV
Ga0075418_1051153513300009100Populus RhizosphereMEEYSMAQGRKTSLTIRLTPAERQTLLAWQRATTIRAGL
Ga0075418_1063054213300009100Populus RhizosphereMTRGRKTSLTLTLTPEERQTLLAWQRSTTMPAGRARRGRI
Ga0075418_1248845223300009100Populus RhizosphereMARGRKTALTIRLTPEERRTLLGWQRATTISAGRAR
Ga0075418_1276259913300009100Populus RhizosphereMARGRKTSLTIRLTPAERQTLLAWQRATAIPAGLARR
Ga0066709_10094766613300009137Grasslands SoilMARGRTTSLTIRLTEAERRTLQAWQRATTISAGRARRG
Ga0066709_10100939913300009137Grasslands SoilMTRGRRTSLTIRLTPAERRTLLTWQRATTVPAGLARRARLL
Ga0099792_1050852823300009143Vadose Zone SoilMARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARRG
Ga0111538_1049052313300009156Populus RhizosphereMARGRKTLLTIRLTPAERLTLLTWQRVTTISVGVARRARLLLL
Ga0111538_1325005913300009156Populus RhizosphereMARGRRTSFTIRLTPAERRTLLTWQRATTIPAGLARRA
Ga0075423_1216414313300009162Populus RhizosphereMARGRKTSLTIRLTPPECQTLLMWQRLTTIPAGQARRARLL
Ga0075423_1301136213300009162Populus RhizosphereMARGRRTSFTIRLTPAERRTLLTWQRATTVPAGLARRA
Ga0126380_1110397313300010043Tropical Forest SoilMAQGCKTSVTIRLTPAQRQTLMAWQRATTISAGLARRGRMI
Ga0126384_1116504413300010046Tropical Forest SoilMARGRTTALTLRLTPTQRRTLLTWQRATTIHAGLARRGR
Ga0126384_1208936113300010046Tropical Forest SoilMARGRTTSFTIRLTPAQRQTLLAWQRATSVSAGLARRARLIL
Ga0126373_1018699733300010048Tropical Forest SoilMVQGRKTALTIRLTPAERLTLLAWQRATAIPAGQARQ
Ga0126370_1118145823300010358Tropical Forest SoilMVSGRKTSFSIRLTPVERQTLLAWQCATTLSAGLARRA
Ga0126376_1035973433300010359Tropical Forest SoilMPRGRTTSFTIRLTPAQRQTLRTWQQATTLPAGLARRA
Ga0126376_1127076613300010359Tropical Forest SoilMARGRTTSLTIRLTPAERRTLLAWQRATTIAAGRAR
Ga0126372_1057104523300010360Tropical Forest SoilMARGRRTALTIRLAADERHTLMAWQRSTTIPAGRARR
Ga0126372_1310375913300010360Tropical Forest SoilMARGRKTSLMIRLTPAERHTLLAWQRATTISAGRAR
Ga0126377_1176738213300010362Tropical Forest SoilMAQGRTTSLTIRLTPAQRRTLLAWQRATTISAGRARRGRL
Ga0126379_1010139713300010366Tropical Forest SoilMREGEIGMPRGRTTSLTITLTDAERQTLMAWQRSTTIRAG*
Ga0126379_1329233913300010366Tropical Forest SoilMARGRKTSLRIRLTPAQRQTLLAWQRATTIPAGQARR
Ga0137364_1144695023300012198Vadose Zone SoilMARGRHPSFRIRLTPDDRQTLRSWQRSTTIPAGRARRGRSIVQLADG
Ga0137383_1091754213300012199Vadose Zone SoilMVLFLKGLTMARGRKTSFTIRLTPGQRQTLLAWQRATTIPAGQARRGRMV
Ga0137383_1094474723300012199Vadose Zone SoilMARGRRTSLTIRLTPAQRQTLLAWQRATTIHAGQARRGRILLLLADGV
Ga0137399_1007847613300012203Vadose Zone SoilMARGRKTALTIRLTPAERRTLLAWQRATTLSAGRARRGRI
Ga0137399_1064668513300012203Vadose Zone SoilMARGRKTSLTIRLTPAQRQTLLAWQRATTISAGRAR
Ga0137399_1118146913300012203Vadose Zone SoilMAQGRPTALVIRLTPAERLTLLTWQRGTTLSAGLARRARLILLRAE
Ga0137362_1114233723300012205Vadose Zone SoilMARGRKTSLTICLTLSQRQTLLAWQRATTVPAGLARRARMISLLADGV
Ga0137380_1038192823300012206Vadose Zone SoilMARGRKTSFIIRLTLAQRQTLLVWQRATNISAGLARRARIILLLADGM
Ga0137380_1174661823300012206Vadose Zone SoilMPRGRETALTIRLTVEERQTLMAWQRSTTIPAGRA
Ga0137379_1016311313300012209Vadose Zone SoilMARGRRTSLTICLTPAQRQTLLAWQRATTITAGLAR
Ga0137379_1108690613300012209Vadose Zone SoilMARGRKTALTIHLTPGERWTLLVWQRATTIAAGRARRGRILLLVAEGMP
Ga0137379_1129149413300012209Vadose Zone SoilMARGRKTALTIRLTAEERHTLLAWQRSTTIPAGRARR
Ga0137378_1127222813300012210Vadose Zone SoilMARGRTTALTIRLTPAERRTLVAWQRATTFSAGRARRG
Ga0137377_1029546813300012211Vadose Zone SoilMARGRITALTIRLTPAERRTLLAWQRATTISAGRARR
Ga0137387_1084854913300012349Vadose Zone SoilMARGRSTSLTIRLTPAERLTLLAWQRATTISAGRARRGRI
Ga0137367_1049260613300012353Vadose Zone SoilMARGRRTSLTIRLTPEERQTLLAWHRSMTIPASIARRGQVI
Ga0137384_1093957813300012357Vadose Zone SoilMARGRKTSLTIRLTPAERRTLQAWQRATTISAGRAR
Ga0137385_1045634523300012359Vadose Zone SoilMARGRKTALTIRLASDERHTLMAWQRSTTIPAGRARRG
Ga0137360_1051461913300012361Vadose Zone SoilMARGRTTSLTIRLTAEERQTLLAWQRATTISAGRARRGRMILLIADRV
Ga0137360_1110919423300012361Vadose Zone SoilMARGRTTSLTIRLTPAERQTLLAWQRAKTITAGRA
Ga0137390_1146622013300012363Vadose Zone SoilMARGRKTSLSIRLTPAERLTLLAWQRATTIPAGLARRAR
Ga0134035_112098523300012391Grasslands SoilMARGRTTSLTIRLTPTERQTLLTWQRATTIAAGRAR
Ga0157286_1044420313300012908SoilMILFLKKSRMPRGRTTSLTIRLTPAQRQTLLAWQRATTIPAGQ
Ga0126375_1007158043300012948Tropical Forest SoilMARGRKTTLTIYLTPAQRQMLLAWQRATTISAGRA
Ga0126369_1138013313300012971Tropical Forest SoilMARGRKTALTIRLTPAQRHTLLAWQRSTTIAAGRVR
Ga0126369_1217494113300012971Tropical Forest SoilMLEGEIGMPRGRTTSLTITLTDAERQTLMAWQRSTTIRAG*
Ga0157378_1099236623300013297Miscanthus RhizosphereMARGRTTSLTVCLTPAQRQFLLARQRAITTPAGLARRARIIILMA
Ga0163162_1035414913300013306Switchgrass RhizosphereMILFLKKSRMPSGRKTSLTIRLTPAQRQTLLAWQHATTIPAGQARR
Ga0134075_1044697013300014154Grasslands SoilMPRGRTTALTIRLTPAQRQTLLAWERSTTIPAGLARRARMVLL
Ga0157380_1197687913300014326Switchgrass RhizosphereMILFLKKSRMPRGRTTSLTIRLTPAQRQTLLAWQLATTIPAGQA
Ga0157380_1354348513300014326Switchgrass RhizosphereMARGRKTALILHLTPAQRQTLLAWQRATTISAGRARR
Ga0137403_1027224953300015264Vadose Zone SoilMARGRVTSLTIRLTSAERQTLLAWQRATTISAGRARRGRMILL
Ga0132258_1303378823300015371Arabidopsis RhizosphereMARGRKTSLSIRLTPAVRQTLLAWQRAPTIPAGRVRRGRMILL
Ga0132258_1334823513300015371Arabidopsis RhizosphereMARGRKTSFTIRLTPAERRTLLTWQRATTVPAGLARRARL
Ga0132256_10034980313300015372Arabidopsis RhizosphereMARGRTTSFTLRLTPTQRRTLLAWQRATRIPAGLARRGRIILL
Ga0132257_10088346623300015373Arabidopsis RhizosphereMARGRRTSFTIRLTPAERLTLLTWQRATTVPAGLA
Ga0132257_10109276323300015373Arabidopsis RhizosphereMARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARR
Ga0132255_10131980213300015374Arabidopsis RhizosphereMARGRTTSLTIHLTPAERQTLVAWQRATTIPAGLARRSRIILLAAD
Ga0184639_1021224623300018082Groundwater SedimentMARGWKTLLTIDLTAEQRETLTAWQRSTTIPAGHAKRGRIILLI
Ga0207684_1104876413300025910Corn, Switchgrass And Miscanthus RhizosphereMARGRKTSLTISLTVEEPQTLMAWQRSTTIRAGRA
Ga0207670_1034350933300025936Switchgrass RhizosphereMARGRTTSLTVCLTPAERQLLVARQRATNIPAGLA
Ga0207712_1089691023300025961Switchgrass RhizosphereMARGRKTSFTIRLTPAERRTLLTWQRATTVPAGLAR
Ga0207712_1135004023300025961Switchgrass RhizosphereMARGRKTALTIRLANDERHTLMAWQRSTTIPAGRA
Ga0207712_1213943113300025961Switchgrass RhizosphereMARGRTTSLTVCLTPAERQLLVARQRAITTPAGLAR
Ga0209761_119256213300026313Grasslands SoilMARGRKTSLSIQLTPAQRQMLLVWQRSTTTISAGHARRGRM
Ga0209471_110368813300026318SoilMGQGRTTSLTIRLTPAERRTLLAWQRSTTTISAGRARRGRIIVLV
Ga0209471_130201813300026318SoilMARGRTTSLTIYLTPAERRTLLAWQRSTTTISAGR
Ga0209577_1071050223300026552SoilMGQGRTTSLTLRLTPAERRTLLAWQRATTTISAGRARRGRILLLVA
Ga0209874_105818623300027577Groundwater SandMARGRRTSLTIRLTPAERETLLAWQRATTISAGRARR
Ga0209388_116954213300027655Vadose Zone SoilMILFLKKSRMPRGRKTSLTIRLTPAQRQTLLAWQRATTIPAGQARR
Ga0209814_1052976613300027873Populus RhizosphereMARGRTTAFIIRLTPAERLTLLTWQRATTISAGVARRARLLLL
Ga0209481_1046133713300027880Populus RhizosphereMARGRTTSLTIRLTPTERQTLLAWQRATTIAAGRARRG
Ga0209590_1080954713300027882Vadose Zone SoilMARGRRTSLTIRLTPAERRTLQAWQRTTTLSAGLA
Ga0209382_1042351223300027909Populus RhizosphereMPRGRKTSLLIRLTPAERLTLLTWQRSTTIPAGLA
Ga0209382_1149550523300027909Populus RhizosphereMASGRKTALTIRLTPAQRQLLLVRQRATGIPAGDARRARIILLLAD
Ga0209382_1152236723300027909Populus RhizosphereMARGRKTSLTIHLTPAQRQTLLAWQRATNIPAGLARRARIV
Ga0247828_1025176813300028587SoilMAHGRKSALTMHVTPAQRHTLLAWQRATTVSAGLARRGRLIFLVAD
Ga0247828_1044302123300028587SoilMARGRKTSLSIRLTPAVRQTLLAWQRATTIPAGRVRRGRMILL
Ga0247828_1098894413300028587SoilMARGRKTSLTIRLTPAERQTLRAWQRATTIAAGRARR
Ga0307296_1054926213300028819SoilMARGRHTASHICLTPEDRHTPLAWQRSTTIRAAPDRF
Ga0247653_104135213300030563SoilMAHGRQTALTLTLNLTPEERQTLQAWQRSPTMPAGPARRGRMIVRVA
Ga0308185_103354313300031081SoilMARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARRGRILLLM
Ga0308204_1015975133300031092SoilMARGRTTSLTIRLTLSERRTLLAWQRATTIPAGQARRGRIMLLRAD
Ga0308181_116056613300031099SoilMARGRKTSLMIRLTPAERRTLLAWQRATIISAGRARRGRIL
Ga0318528_1046953213300031561SoilMARGRKTSLAIRLTPAVRQTLLAWQRATTMPAGRARRGRI
Ga0318515_1049835513300031572SoilMARGRKTSLVIRLTPAVRQTLLAWQRATTIPAGRAR
Ga0318555_1060864523300031640SoilMARGRKTSFTIRLTPAERLTLLTWQRATTLSAGVARRARLLLLL
Ga0318521_1048948823300031770SoilMARGRKTSLAIRLTPAVRQTLLAWQRATTIPAGRARRGRLILLV
Ga0310892_1134371313300031858SoilMPRERTTSLTIRLMPAERLTLMTWQRSVTLSAGLARRARIRLLRAD
Ga0315297_1057998633300031873SedimentMARGRKTSLTVTLTAEERDELEFWQRCTTLPVGLV
Ga0306925_1204993713300031890SoilMASGRKTSFSIRLTPAERQTLLAWQRTTTISAGLFRISRII
Ga0310900_1104682013300031908SoilMARGRKTSLTIRLTSAERQTLRAWQRATTIAAGRARRGRI
Ga0310909_1048332123300031947SoilMARGRKTALKIPLTPAERRTLLAWQRATTISAGRA
Ga0306922_1113203923300032001SoilMARGRKTSRTLRLTPAERQTLLAWQRASLIPAGLARRGRIV
Ga0318553_1057266413300032068SoilMARGRKTSLVVRLTPAERQTLLAWQRATTIAAGRARRGRLIVLVA
Ga0268251_1032533123300032159AgaveMARGRKTSLTITLTPEERRTLLAWQRSTTIHAGML
Ga0307471_10262026023300032180Hardwood Forest SoilMPRGRKTSLMIRLTADDRQTLTRWQRSTTIRAGDA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.