NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047236

Metagenome / Metatranscriptome Family F047236

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047236
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 42 residues
Representative Sequence MPVEGRDLSSRQTQYVVRDLEIGQPINSEECSETADGVARES
Number of Associated Samples 136
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 61.33 %
% of genes near scaffold ends (potentially truncated) 94.00 %
% of genes from short scaffolds (< 2000 bps) 93.33 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.333 % of family members)
Environment Ontology (ENVO) Unclassified
(22.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.667 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF08388GIIM 6.67
PF10908DUF2778 2.00
PF04392ABC_sub_bind 1.33
PF02371Transposase_20 1.33
PF01548DEDD_Tnp_IS110 1.33
PF01614IclR 0.67
PF00078RVT_1 0.67
PF13801Metal_resist 0.67
PF05598DUF772 0.67
PF05443ROS_MUCR 0.67
PF13602ADH_zinc_N_2 0.67
PF07045DUF1330 0.67
PF01609DDE_Tnp_1 0.67
PF13385Laminin_G_3 0.67
PF12746GNAT_acetyltran 0.67
PF00589Phage_integrase 0.67
PF00296Bac_luciferase 0.67
PF13649Methyltransf_25 0.67
PF02518HATPase_c 0.67
PF05711TylF 0.67
PF16197KAsynt_C_assoc 0.67
PF13185GAF_2 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 2.67
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.33
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.67
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.67
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.67
COG3293TransposaseMobilome: prophages, transposons [X] 0.67
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.67
COG4957Predicted transcriptional regulatorTranscription [K] 0.67
COG5421TransposaseMobilome: prophages, transposons [X] 0.67
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.67
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.67
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.67

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.00 %
UnclassifiedrootN/A8.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZ032L002IOMBEAll Organisms → cellular organisms → Bacteria → Proteobacteria502Open in IMG/M
3300000890|JGI11643J12802_11249686All Organisms → cellular organisms → Bacteria → Proteobacteria692Open in IMG/M
3300001593|JGI12635J15846_10428657All Organisms → cellular organisms → Bacteria → Proteobacteria792Open in IMG/M
3300001870|JGI24129J20441_1019087All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.5121928Open in IMG/M
3300002568|C688J35102_118290249All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300002568|C688J35102_118319026All Organisms → cellular organisms → Bacteria → Proteobacteria548Open in IMG/M
3300003219|JGI26341J46601_10158464All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae629Open in IMG/M
3300003220|JGI26342J46808_1021856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. 9U621Open in IMG/M
3300003669|LSCM4E_1081892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha518Open in IMG/M
3300004016|Ga0058689_10166067All Organisms → cellular organisms → Bacteria → Proteobacteria519Open in IMG/M
3300004602|Ga0068960_1270905All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1515Open in IMG/M
3300004605|Ga0068952_1320275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1026Open in IMG/M
3300004633|Ga0066395_10556625All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1667Open in IMG/M
3300005163|Ga0066823_10070174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. OR444670Open in IMG/M
3300005168|Ga0066809_10167451All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae578Open in IMG/M
3300005332|Ga0066388_104403313All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1717Open in IMG/M
3300005332|Ga0066388_108519692All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512510Open in IMG/M
3300005440|Ga0070705_101254861All Organisms → cellular organisms → Bacteria → Proteobacteria612Open in IMG/M
3300005441|Ga0070700_101562786All Organisms → cellular organisms → Bacteria → Proteobacteria562Open in IMG/M
3300005445|Ga0070708_102054497All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1529Open in IMG/M
3300005829|Ga0074479_10513718All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium540Open in IMG/M
3300005938|Ga0066795_10213153All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005947|Ga0066794_10241935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi541Open in IMG/M
3300006050|Ga0075028_100212583All Organisms → cellular organisms → Bacteria → Proteobacteria1048Open in IMG/M
3300006050|Ga0075028_100815533All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae569Open in IMG/M
3300006052|Ga0075029_100492011All Organisms → cellular organisms → Bacteria → Proteobacteria808Open in IMG/M
3300006057|Ga0075026_100426261All Organisms → cellular organisms → Bacteria → Proteobacteria750Open in IMG/M
3300006086|Ga0075019_11105385All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae514Open in IMG/M
3300006102|Ga0075015_100570360All Organisms → cellular organisms → Bacteria → Proteobacteria659Open in IMG/M
3300006175|Ga0070712_100103512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2111Open in IMG/M
3300006572|Ga0074051_10011467All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae714Open in IMG/M
3300006638|Ga0075522_10554327All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300006806|Ga0079220_12008809All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1516Open in IMG/M
3300006893|Ga0073928_10560188All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. OR444812Open in IMG/M
3300006893|Ga0073928_11100303All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae538Open in IMG/M
3300007982|Ga0102924_1232627All Organisms → cellular organisms → Bacteria → Proteobacteria773Open in IMG/M
3300009030|Ga0114950_10732174All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512782Open in IMG/M
3300009038|Ga0099829_10477676All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300009088|Ga0099830_10518868All Organisms → cellular organisms → Bacteria → Proteobacteria973Open in IMG/M
3300009521|Ga0116222_1446242All Organisms → cellular organisms → Bacteria → Proteobacteria564Open in IMG/M
3300009553|Ga0105249_11752774All Organisms → cellular organisms → Bacteria → Proteobacteria694Open in IMG/M
3300009610|Ga0105340_1504788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi541Open in IMG/M
3300009672|Ga0116215_1472519All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300010043|Ga0126380_10862498Not Available748Open in IMG/M
3300010366|Ga0126379_10176607All Organisms → cellular organisms → Bacteria → Proteobacteria2025Open in IMG/M
3300010379|Ga0136449_100111313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales5556Open in IMG/M
3300010379|Ga0136449_103218698Not Available630Open in IMG/M
3300010379|Ga0136449_103418870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales607Open in IMG/M
3300010379|Ga0136449_104424201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi518Open in IMG/M
3300010430|Ga0118733_108734625All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1523Open in IMG/M
3300011057|Ga0138544_1011330All Organisms → cellular organisms → Bacteria → Proteobacteria584Open in IMG/M
3300011075|Ga0138555_1035217All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae550Open in IMG/M
3300011082|Ga0138526_1122194All Organisms → cellular organisms → Bacteria → Proteobacteria611Open in IMG/M
3300012206|Ga0137380_11674107All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300012207|Ga0137381_10229728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1610Open in IMG/M
3300012675|Ga0137337_1008256All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300012683|Ga0137398_10566081All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512784Open in IMG/M
3300012943|Ga0164241_10923278All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300013102|Ga0157371_11248866Not Available574Open in IMG/M
3300014320|Ga0075342_1136218All Organisms → cellular organisms → Bacteria → Proteobacteria661Open in IMG/M
3300014502|Ga0182021_12351449All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae641Open in IMG/M
3300014838|Ga0182030_11164307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi662Open in IMG/M
3300015265|Ga0182005_1152878All Organisms → cellular organisms → Bacteria → Proteobacteria673Open in IMG/M
3300016270|Ga0182036_10195198Not Available1480Open in IMG/M
3300016371|Ga0182034_10211741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS1911506Open in IMG/M
3300016387|Ga0182040_10064425All Organisms → cellular organisms → Bacteria2347Open in IMG/M
3300016404|Ga0182037_11830461All Organisms → cellular organisms → Bacteria → Proteobacteria543Open in IMG/M
3300017924|Ga0187820_1298948Not Available529Open in IMG/M
3300018067|Ga0184611_1020380Not Available2036Open in IMG/M
3300019879|Ga0193723_1189463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi521Open in IMG/M
3300020581|Ga0210399_10775052All Organisms → cellular organisms → Bacteria → Proteobacteria784Open in IMG/M
3300021402|Ga0210385_10756586Not Available744Open in IMG/M
3300021405|Ga0210387_11815029All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae513Open in IMG/M
3300021474|Ga0210390_11274188All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae590Open in IMG/M
3300021479|Ga0210410_10247552All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300022213|Ga0224500_10065343All Organisms → cellular organisms → Bacteria → Proteobacteria1427Open in IMG/M
3300022506|Ga0242648_1060617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi595Open in IMG/M
3300022528|Ga0242669_1002162Not Available1945Open in IMG/M
3300023274|Ga0247763_1178044All Organisms → cellular organisms → Bacteria → Proteobacteria599Open in IMG/M
(restricted) 3300024521|Ga0255056_10146297All Organisms → Viruses → Predicted Viral1011Open in IMG/M
3300025473|Ga0208190_1073037Not Available692Open in IMG/M
3300025479|Ga0208588_1036148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi1020Open in IMG/M
3300025500|Ga0208686_1105346All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300025854|Ga0209176_10145944All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300025919|Ga0207657_10963360All Organisms → cellular organisms → Bacteria → Proteobacteria655Open in IMG/M
3300025923|Ga0207681_11553843All Organisms → cellular organisms → Bacteria → Proteobacteria554Open in IMG/M
3300025929|Ga0207664_11669999All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300025932|Ga0207690_10926512All Organisms → cellular organisms → Bacteria → Proteobacteria723Open in IMG/M
3300025935|Ga0207709_10051979Not Available2514Open in IMG/M
3300026475|Ga0257147_1053560All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300027108|Ga0207946_108042All Organisms → cellular organisms → Bacteria → Proteobacteria548Open in IMG/M
3300027680|Ga0207826_1145486All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300027846|Ga0209180_10767677All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae519Open in IMG/M
3300027862|Ga0209701_10565830All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512608Open in IMG/M
(restricted) 3300027865|Ga0255052_10096097All Organisms → cellular organisms → Bacteria → Proteobacteria1446Open in IMG/M
3300027935|Ga0209870_107050All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1574Open in IMG/M
3300028020|Ga0265351_1005066All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300028600|Ga0265303_10994020All Organisms → cellular organisms → Bacteria → Proteobacteria694Open in IMG/M
3300028809|Ga0247824_10577404Not Available673Open in IMG/M
3300030494|Ga0310037_10113840All Organisms → cellular organisms → Bacteria → Proteobacteria1247Open in IMG/M
3300030494|Ga0310037_10437569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales537Open in IMG/M
3300030622|Ga0265391_10136889All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica → Dechloromonas aromatica RCB675Open in IMG/M
3300030659|Ga0316363_10067904All Organisms → cellular organisms → Bacteria → Proteobacteria1645Open in IMG/M
3300030969|Ga0075394_10120482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi527Open in IMG/M
3300031114|Ga0308187_10412443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium536Open in IMG/M
3300031122|Ga0170822_16933899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola503Open in IMG/M
3300031446|Ga0170820_14312390All Organisms → cellular organisms → Bacteria → Proteobacteria774Open in IMG/M
3300031543|Ga0318516_10061721All Organisms → cellular organisms → Bacteria → Proteobacteria2063Open in IMG/M
3300031544|Ga0318534_10620429All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae614Open in IMG/M
3300031545|Ga0318541_10423466All Organisms → cellular organisms → Bacteria → Proteobacteria744Open in IMG/M
3300031680|Ga0318574_10687064All Organisms → cellular organisms → Bacteria → Proteobacteria600Open in IMG/M
3300031708|Ga0310686_109053303All Organisms → cellular organisms → Bacteria → Proteobacteria795Open in IMG/M
3300031715|Ga0307476_11288542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi533Open in IMG/M
3300031719|Ga0306917_10464975All Organisms → cellular organisms → Bacteria → Proteobacteria991Open in IMG/M
3300031724|Ga0318500_10013109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2974Open in IMG/M
3300031726|Ga0302321_102118987All Organisms → cellular organisms → Bacteria → Proteobacteria654Open in IMG/M
3300031726|Ga0302321_102876773All Organisms → cellular organisms → Bacteria → Proteobacteria562Open in IMG/M
3300031744|Ga0306918_10923096All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512679Open in IMG/M
3300031747|Ga0318502_10810822All Organisms → cellular organisms → Bacteria → Proteobacteria567Open in IMG/M
3300031770|Ga0318521_10707896All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1611Open in IMG/M
3300031781|Ga0318547_11080149All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512502Open in IMG/M
3300031794|Ga0318503_10183641All Organisms → cellular organisms → Bacteria → Proteobacteria677Open in IMG/M
3300031805|Ga0318497_10408449All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae760Open in IMG/M
3300031831|Ga0318564_10104469Not Available1259Open in IMG/M
3300031846|Ga0318512_10579599All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512571Open in IMG/M
3300031890|Ga0306925_10776074All Organisms → cellular organisms → Bacteria → Proteobacteria996Open in IMG/M
3300031890|Ga0306925_12128516All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512524Open in IMG/M
3300031893|Ga0318536_10506758All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512606Open in IMG/M
3300031893|Ga0318536_10601113All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1550Open in IMG/M
3300031910|Ga0306923_10329333All Organisms → cellular organisms → Bacteria1743Open in IMG/M
3300031942|Ga0310916_10808878All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512789Open in IMG/M
3300031945|Ga0310913_10545325All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae823Open in IMG/M
3300031947|Ga0310909_10277841All Organisms → cellular organisms → Bacteria → Proteobacteria1401Open in IMG/M
3300031947|Ga0310909_11254946All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae597Open in IMG/M
3300031947|Ga0310909_11580067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi520Open in IMG/M
3300031981|Ga0318531_10500136All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1550Open in IMG/M
3300032035|Ga0310911_10711229All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae582Open in IMG/M
3300032174|Ga0307470_10854086All Organisms → cellular organisms → Bacteria → Proteobacteria710Open in IMG/M
3300032180|Ga0307471_103142240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium585Open in IMG/M
3300032205|Ga0307472_102032988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300032261|Ga0306920_100192702All Organisms → cellular organisms → Bacteria → Proteobacteria3042Open in IMG/M
3300032261|Ga0306920_101928887All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae829Open in IMG/M
3300032897|Ga0335071_11519979All Organisms → cellular organisms → Bacteria → Proteobacteria614Open in IMG/M
3300032954|Ga0335083_11059083All Organisms → cellular organisms → Bacteria → Proteobacteria635Open in IMG/M
3300033289|Ga0310914_11848084All Organisms → cellular organisms → Bacteria → Proteobacteria508Open in IMG/M
3300033417|Ga0214471_11395622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi527Open in IMG/M
3300033550|Ga0247829_11465198All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1564Open in IMG/M
3300033755|Ga0371489_0025085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4640Open in IMG/M
3300034236|Ga0334938_070475All Organisms → cellular organisms → Bacteria → Proteobacteria676Open in IMG/M
3300034818|Ga0373950_0154190All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1527Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.33%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil9.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.33%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.67%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.33%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.33%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.33%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.67%
Coalbed WaterEnvironmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water0.67%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.67%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.67%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.67%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.67%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.67%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.67%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.67%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.67%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.67%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.67%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.67%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.67%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.67%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.67%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.67%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.67%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.67%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001870Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300003220Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1EnvironmentalOpen in IMG/M
3300003669Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM4 Early Sample 3)EnvironmentalOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004602Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004605Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009030Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011057Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011075Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011082Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012675Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022506Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023274Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4EnvironmentalOpen in IMG/M
3300024521 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025479Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300027108Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300027935Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300028020Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300034236Biocrust microbial communities from Mojave Desert, California, United States - 34SMCEnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
E4A_040684102170459003Grass SoilMPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETTDGVARG
JGI11643J12802_1124968613300000890SoilMPVEERGLSSRLTQDVVRDLEIGQPSNSEECSETADGVARESEGR
JGI12635J15846_1042865723300001593Forest SoilMPVEGRDLSSRQTQYVVKDLEIGQPINSEECSETADGVARESEGVKSCPR
JGI24129J20441_101908713300001870Arctic Peat SoilVEGRDLSSRQTQYVVKDLEIGQPINSDECSETAEGV*
C688J35102_11829024913300002568SoilRVMPVEGRDLSSRQTQYVVKDLEIGQPINSEECSETADGVARES*
C688J35102_11831902623300002568SoilRGSRVTPVEGRDLSSRQTQDVARDQEIGSPINSEERPEAADGVARES*
JGI26341J46601_1015846413300003219Bog Forest SoilMPVEGRDLSSRQTQYVVKDMEIGQPINSKECSETADGVARES
JGI26342J46808_102185613300003220Bog Forest SoilMPGEGRDLSSRQTQDVARDLEIGQPINSEQRSETADGVARESEGRTRL
LSCM4E_108189223300003669Coalbed WaterMPVEGRGLSSRPTQHASKDLEIGQPINSDKSSETTDGVTRKSEG
Ga0058689_1016606713300004016AgaveMPVEGRDLSSRRTQYVVRDLEIGQPINSEECSETADGVARESEGRSRLSVL
Ga0068960_127090513300004602Peatlands SoilVEGRGLSSRQTQDVVRDLEIGQPINSDECSETADGVARESEGRS
Ga0068952_132027523300004605Peatlands SoilMPVEGRDLSSRQTQYVVKDLEIGQPINSKECSETADGVACESKA*
Ga0066395_1055662513300004633Tropical Forest SoilMPVEGRGLSSRPTQDVVRDLEIGQPSNSEKRSETADGVTRES
Ga0066823_1007017423300005163SoilVEGRDLSSRQTQYVVKDMEIGQPINSKECSETTDGVARESKA*
Ga0066809_1016745113300005168SoilMPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETAEGVARESEGRSR
Ga0066388_10440331313300005332Tropical Forest SoilMPVEGRGLGSRRTQHAVKDLEIGQPSNSEQCSETADGVTRESEGRTG
Ga0066388_10851969223300005332Tropical Forest SoilMPVEGRGLSSRRTQDVVRDLGIGQPINSEECSETADGVARESEG
Ga0070705_10125486113300005440Corn, Switchgrass And Miscanthus RhizosphereMPVEGRDLSSRRTQYVVRDLEIGQPINSEECSETADGVARESEGRSR
Ga0070700_10156278623300005441Corn, Switchgrass And Miscanthus RhizosphereMPAEGRGLSSRQTQDVVRDLGIGQPSNPEKCSETADGVTRES
Ga0070708_10205449713300005445Corn, Switchgrass And Miscanthus RhizosphereMPVEGRDLSSRPTQYVVRDLEIGQPINSDQCSETADGVARESEGRSRL
Ga0074479_1051371823300005829Sediment (Intertidal)MEGRNLSSRQTQDVVRDLEIGQPINSEKCSEAAEGVTRESEG
Ga0066795_1021315323300005938SoilEGRDLSSRQTQYVVKDLEIGQPINSDECSETAEGV*
Ga0066794_1024193513300005947SoilVEGRDLSSRQTQYVVKDLEIGKPINSNKCSEAADGVARE
Ga0075028_10021258323300006050WatershedsMPGEGRDLSSRQTQYVVRDLEIGQPINSEECSETADGVARE
Ga0075028_10081553313300006050WatershedsMPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETADGVTRESEG
Ga0075029_10049201113300006052WatershedsMPVEGRDLSSRQTHYVVKDMEIGQPINSEKCSETADGVARKKTNA*
Ga0075026_10042626113300006057WatershedsVMPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETTDRVARESKA*
Ga0075019_1110538513300006086WatershedsGRDLSSRQTQYVVRDLEIGQPINSEECSETADGVARES*
Ga0075015_10057036023300006102WatershedsMPVEGRDLSSRQTQYVVKDMEIGQPINSKKCSETADGVARE
Ga0070712_10010351223300006175Corn, Switchgrass And Miscanthus RhizosphereMPVEGRDLSSRQTQYVVKDMEIGQPINSKECSETTDGVARESEA*
Ga0074051_1001146723300006572SoilMPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETAEGVARESE
Ga0075522_1055432723300006638Arctic Peat SoilMPAEGRDLSSRRTQYVVRDLEIGQPINSEECSETADGVARES
Ga0079220_1200880913300006806Agricultural SoilMPVEGRGLSSRQTQDAVRDLEIGQPSNSEKCSETADGVTRESEGGGRL
Ga0073928_1056018813300006893Iron-Sulfur Acid SpringRQTQYVVKDMEIGQPINSEECSETTDGVARESKA*
Ga0073928_1110030323300006893Iron-Sulfur Acid SpringMPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETAD
Ga0102924_123262713300007982Iron-Sulfur Acid SpringMPAEGRDLSSRQTKYVVKDLEIGQPINSAECSETADGVARASKGVK
Ga0114950_1073217423300009030Deep SubsurfaceMPVEGRGLGSRQMDNVVRDVEIGQPINSEECSETT
Ga0099829_1047767643300009038Vadose Zone SoilDLSSRQTQYVVKDLEIGQPINSEECSEAADGVARAGGFPFEA*
Ga0099830_1051886823300009088Vadose Zone SoilMPVEARDLSSRQTQYVVKDLEIGQPINSEECSEAADGVARAGGFPFEA*
Ga0116222_144624213300009521Peatlands SoilMPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETTDGVARES
Ga0105249_1175277423300009553Switchgrass RhizosphereMPVEERDLSSRQTQDVVRDLEIGQPINSEECSETADG
Ga0105340_150478813300009610SoilVEGRDLSSRRTQHVVKDLEIGQPINSDECSETADGVARES
Ga0116215_147251913300009672Peatlands SoilMPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETAD
Ga0126380_1086249823300010043Tropical Forest SoilVEGRDLSSRRTQDVVRDLEIGQPINSEECSETADGVARESEGRSR
Ga0126379_1017660723300010366Tropical Forest SoilMPVEGRDLSSRLTQDGVRDLEIGRPSNSEKCSETADGVTRESEGRSRLSLLR
Ga0136449_10011131373300010379Peatlands SoilMPVEGRDLSSRQTHYAAKNLEIGQPINSDWCSAAADGVARDS*
Ga0136449_10321869813300010379Peatlands SoilMLGVAAAARGLSSGQTQDVVKDLEIGQPINSGQRSETADGVARESE
Ga0136449_10341887023300010379Peatlands SoilSRQTQYVVKDMEIGQPINSEECSETTDGVARESKA*
Ga0136449_10442420113300010379Peatlands SoilMPVEGRDLSSRQTQDAVRDLEIGQPINSEQCSETADGVARESEGRSR
Ga0118733_10873462523300010430Marine SedimentMPVEGRNLSSRQTHDVVRDREIGQPINSKICSEAAEGVARESEG
Ga0138544_101133013300011057Peatlands SoilMPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETTDG
Ga0138555_103521713300011075Peatlands SoilMPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETADGVARESKG
Ga0138526_112219423300011082Peatlands SoilMPVEGRDLSSRQTRQAVRDLEIGQPINSEQCSEIAEGVARKSE
Ga0137380_1167410713300012206Vadose Zone SoilMPVEGRDLSSRQTKYVVKDLEIGQPINSAECSEAADGVTRES
Ga0137381_1022972813300012207Vadose Zone SoilVEGRDLSSRQTQYVVKDLEIGKPINSNKCSEAADGVARESVK
Ga0137337_100825613300012675SoilMEGRGLSSRQTHDVVRDLEIGQPINSDECSETDGVARESTRKRKGVK
Ga0137398_1056608113300012683Vadose Zone SoilMPGEGRGLSSRQTQQAVKDQEIGQPNNSKKCSEAADGVT
Ga0164241_1092327813300012943SoilMPVEERDLSSRQTQDVVRDLEIGQPINSEECSETADGVARES
Ga0157371_1124886623300013102Corn RhizosphereMPVEGRSLSSRQTQEVARDPEIGQPINSRQSPEAAEGVARESEG
Ga0075342_113621813300014320Natural And Restored WetlandsMLVEGRGLGSRQTQHVVRDVEIGQPINSDQCSETADGVTRESE
Ga0182021_1235144923300014502FenMPVEGRDLSSGQTQYVAKDLEIGQPINSDECSETAEGVARE
Ga0182030_1116430723300014838BogMPVEGRDLSSKKTQQVVRDLEIGQPINSENCSETAEG
Ga0182005_115287813300015265RhizosphereMPVEGRDLSSRQTQDVARDQEIGPPINSEQCPEAADGVARES
Ga0182036_1019519823300016270SoilMPGEGKGLSSRPTQDVVRDLEIGQPSNSEKCSETADGVTRESEG
Ga0182034_1021174143300016371SoilMPVEGRGLSSRPTQDAVRDLEIGRPSNSEKCSETADG
Ga0182040_1006442513300016387SoilVEGRDLSSRRTQDVVRDLEIGQPINSEERSEAADGVARESEGRS
Ga0182037_1183046123300016404SoilMPAEGRGLSSRLTQDVVRDLEIGQPSNSEKRSEAADG
Ga0187820_129894823300017924Freshwater SedimentMPVEGRDLSSRQTQYVVRDLEIGQPINSEECSETADGVARES
Ga0184611_102038023300018067Groundwater SedimentMPVEERGLSSRRTQQVAKDLEIGQPNNSEKCSEAADGVARESEGIA
Ga0193723_118946313300019879SoilVEGRDLSSRQTQYVVKDLEIGKPINSNKCSEAADGVARAICLS
Ga0210399_1077505213300020581SoilMPGEGRGLSSRQTQDVVRDLEIGQPSNSEKCSETADG
Ga0210385_1075658623300021402SoilMPGEGRGLSSRQTQDVVRDLEIGQPSNSEKCSETAD
Ga0210387_1181502913300021405SoilMPVEGRDLSSRQTQYVVKDMEIGQPINSKECSETADGV
Ga0210390_1127418813300021474SoilMPAEGRGLSSGQTQRRSEGQEIGQPSNSEKRSADGGIPQ
Ga0210410_1024755223300021479SoilMLVEGRDLSSRQTQYVVKDMEIGQPINSKKCSETADGVARESK
Ga0224500_1006534313300022213SedimentMPAEERGLSSRQTQEVERDEEIGQPSNSDECSESAE
Ga0242648_106061713300022506SoilMPVEGRDLSSRQTHDAVRDLEIGQPINSEEGSETADGVTRESK
Ga0242669_100216213300022528SoilMPVEGRGLSSRQTQDVVRDLEIGQPSNSETCSETADGVTRES
Ga0247763_117804413300023274Plant LitterMPVEGRDLSSRQTQDVVRDLEIGQPINSDECSETAD
(restricted) Ga0255056_1014629723300024521SeawaterPMHEVEKDQEIGQPINSEKAFETTGSETAKGIARKSEG
Ga0208190_107303723300025473PeatlandMLVEGRDLSSRQTQYVVKDLEIGQPINSKECSETADGV
Ga0208588_103614813300025479Arctic Peat SoilMPVEGRGLSSRQTQQAMRDLEIGKPINSEKCSEIADGVARESE
Ga0208686_110534613300025500PeatlandMPVEGRDLSSRQTQYVVKDLEIGQPINSEECSETADGIARESK
Ga0209176_1014594413300025854Arctic Peat SoilEGRDLSSRQTQYVVKDLEIGQPINSDECSETAEGV
Ga0207657_1096336023300025919Corn RhizosphereMPVEGRDLSSRQTQYVVKDLEIGQPINSEECSETADGVARES
Ga0207681_1155384313300025923Switchgrass RhizosphereMPVEGRDLSSRRTQYVVRDLEIGQPINSEECSETAD
Ga0207664_1166999913300025929Agricultural SoilMPGEGRGLGSRQTQDVVRDLEIGQPSNSEKCSETAD
Ga0207690_1092651223300025932Corn RhizosphereAEGRGLSSRQTQDVVRDLGIGQPSNPEKCSETADGVTRES
Ga0207709_1005197943300025935Miscanthus RhizosphereMPVEERSLSSRRTQQVARDLEIGQPNNSEKCSEAAD
Ga0257147_105356013300026475SoilNLSSRQTQYVVKDMEIGKPINSDKCSEAADGVARESVPTSLLNRCI
Ga0207946_10804213300027108Forest SoilMPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETA
Ga0207826_114548613300027680Tropical Forest SoilMPVEGRDLSSRQTQQVMRDLEIGQPINSEQGSEIADGVTRKSEG
Ga0209180_1076767713300027846Vadose Zone SoilMEGRGLSSRQTHDVVRDLEIGQPINSEECSETTEGVTRESEG
Ga0209701_1056583013300027862Vadose Zone SoilEGRDLSSRQTQYVVKDLEIGQPINSEECSEAADGVARAGGFPFEA
(restricted) Ga0255052_1009609723300027865SeawaterMPVEGRGLGSRRTQEVEQDQEIGQPINSDKGSETTKS
Ga0209870_10705023300027935Groundwater SandMLVEGRGLGSRQTQHVVRDVEIGQPINSDQCSETADGV
Ga0265351_100506623300028020SoilMPVEGRDLSSRQTQYVVKDMEIGQPINSKECSETTDGVAR
Ga0265303_1099402023300028600SedimentMPVEERDLSSRQMHEVEKDQEIGQPINSEKCSETAKGIARKSEG
Ga0247824_1057740413300028809SoilRNLSSRQTQYVVKDLEIGQPINSEECSETADGVARES
Ga0310037_1011384013300030494Peatlands SoilMPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETTNGATLVSTLVTE
Ga0310037_1043756913300030494Peatlands SoilMPVEGRDLSSRQTQYVVKDMEIGQPINSKKCSETADGVARESKGVK
Ga0265391_1013688913300030622SoilMPVEGRDLSSRQTQYVVKDLEIGQPINSDECAETADGVARKSKGV
Ga0316363_1006790413300030659Peatlands SoilMPVEGRDLSSRQTHYVAKNLEIGQPINSAECSETADGVARKSKG
Ga0075394_1012048213300030969SoilMPGEGRGLSSRQTQDVVRDLEIGQPSNSEKCSETADGVTRESEGGGRLSLLR
Ga0308187_1041244313300031114SoilMPVEGRDLSSRQTQYVVKDLEIGKPINSDKCSEAA
Ga0170822_1693389913300031122Forest SoilMPVEGRGLSSRQTQQPVRDREIGQPNNSETCSETADGV
Ga0170820_1431239013300031446Forest SoilMPVEGRSLSSGPTQHVVRDRRLGNLSNSDKRSETADGVPRAGVT
Ga0318516_1006172123300031543SoilMPGEGRDLSSRRTQDVVKDLEIGQPINSEKCSETAEGVARES
Ga0318534_1062042913300031544SoilMPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETAGGV
Ga0318541_1042346613300031545SoilMPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVAGESEGRSRV
Ga0318574_1068706413300031680SoilPGEGRGLSSRPTQDVVRDLEIGQPSNSEKRSDTAGGVTREKA
Ga0310686_10905330313300031708SoilMKPVMPVEGRSLSSRLTQDVVRDLEIGQPSNSEECSKT
Ga0307476_1128854213300031715Hardwood Forest SoilVEGRDLSSRQTQYVVKDLEIGKPINSNKCPEAADG
Ga0306917_1046497523300031719SoilMPVEGRGLSSRPTQDAVRDLEIGQPSNSEKCSETADGVTRESEGG
Ga0318500_1001310943300031724SoilMPVEGRGLGSRQTQEVVRDLEIGQPINSEECSETADGV
Ga0302321_10211898713300031726FenMEGRDLSSRQTHDVVRDLEIGQPINSEKCSEAAEGVTRESEGRSRLSLLR
Ga0302321_10287677313300031726FenMPVEGRGLSSRQTQQAMRDLEIGQPINSEKCSEIADGVARESEGRSRLSILR
Ga0306918_1092309613300031744SoilMPGEGRGLSSRQTQEVVRDLEIGRPSNSEKCSETADGVTRESEGGSRL
Ga0318502_1081082213300031747SoilMPGEGRGLSSRPTQDAVRDLEIGRPSNSEKCSETA
Ga0318521_1070789613300031770SoilMPGEGRGLSSRQTQDVVRDLEIGQPSNSEKCSETADGV
Ga0318547_1108014913300031781SoilMPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVAGESEGR
Ga0318503_1018364123300031794SoilMPVEGRDLSSRQTQDVAKDLEIGQPINSDECSETAEGVARKS
Ga0318497_1040844923300031805SoilMPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVAG
Ga0318564_1010446913300031831SoilMKPGNAGEGRDLSSRQTQDVVKDLGIGQPINSGQCSE
Ga0318512_1057959913300031846SoilMPVEGRGLSSRPTQDVVRDLEIGQPSNSEKRSATAEGVTRERA
Ga0306925_1077607423300031890SoilMPGEGRGLSSRPTQDAVRDLEIGQPSNSEKCSATADGVTRD
Ga0306925_1212851613300031890SoilMPVEGRDLSSRQTQYVVTDPEIGQPINSNKCSETADGVARESKGVKSCP
Ga0318536_1050675813300031893SoilMPVEGRDLSSRQTHYVVTDPEIGQPINSNKCSEAADGVARE
Ga0318536_1060111313300031893SoilMLGEGRGLSSRPTQDVVRDLEIGQPSNSEKRSEAADGVTRESEGG
Ga0306923_1032933313300031910SoilMPVEGRGLSSRPTQDVVRDLEIGQPSNSEKCSDTADGERSVE
Ga0310916_1080887833300031942SoilMLVEGRGLSSRQTQQAVRDLEIGQPNNSKKCSEAADGVARE
Ga0310913_1054532513300031945SoilMPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVARESEGRSRVSLLRP
Ga0310909_1027784123300031947SoilMPGEGRDLSSRRTQDVVRDLEIGQPNNSEKCSETAE
Ga0310909_1125494613300031947SoilMPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVARES
Ga0310909_1158006713300031947SoilMPVEGRDLSSRQTQYVVTDPEIGQPINSNKCSETADGVARESKGVKSC
Ga0318531_1050013613300031981SoilMPVEGRGLSSRPTQDAVRDLEIGQPSNSEKCSEAADGVTRESEGGSRLS
Ga0310911_1071122913300032035SoilMPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETAGGVARE
Ga0307470_1085408613300032174Hardwood Forest SoilMPVEGRDLSSRQTQYVVKDLEIGQPINSEECSETADGV
Ga0307471_10314224013300032180Hardwood Forest SoilVEGRDLSSRQTQYVVKDLEIGKPINSNKCSEAADGAARESVT
Ga0307472_10203298813300032205Hardwood Forest SoilMPVEGRGLSSRQTQDVVRDLEIGQPNNSEKCSETADG
Ga0306920_10019270233300032261SoilMPVEGRDLSSRQTQDVAKDLEIGQPINSDECSETAEGVARKSKA
Ga0306920_10192888723300032261SoilMPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVA
Ga0335071_1151997913300032897SoilMPVEERDLSSRRTQDVVRDLEIGQPINSEECSETADG
Ga0335083_1105908313300032954SoilMPVEGRDLSSRRTQYVARDQEIGQPINSDQCSEAADGVARE
Ga0310914_1184808413300033289SoilMPGEGRGLSSRPTQDAVRDLEIGQPSNSEKCSETADGVTRESEGG
Ga0214471_1139562213300033417SoilMEGRGLSSRQTHDVVRDLEIGQPINSEECSETTEGGYT
Ga0247829_1146519813300033550SoilMPAEGRGLSSRQTQDVVRDLGIGQPSNPEKCSETADGV
Ga0371489_0025085_4340_44773300033755Peat SoilMPAEGRDLSSRLTQDVAKDMEIGKPINSGKRSEAAEGVARERRMA
Ga0334938_070475_3_1283300034236BiocrustMPVEGRSLSSRQTQDAVRDLEIGQPINSEECSETAKGVARES
Ga0373950_0154190_2_1273300034818Rhizosphere SoilMEGRGLSSGQTQDVVRDREIGQPNNSETCSEAADGVARESEG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.