NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F049389

Metatranscriptome Family F049389

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049389
Family Type Metatranscriptome
Number of Sequences 146
Average Sequence Length 144 residues
Representative Sequence TCKLVLVVAMIGAMKTAWMFILVGTVVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGDNDA
Number of Associated Samples 83
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 7.53 %
% of genes near scaffold ends (potentially truncated) 79.45 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(52.055 % of family members)
Environment Ontology (ENVO) Unclassified
(95.205 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(58.219 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 52.63%    β-sheet: 1.17%    Coil/Unstructured: 46.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF00113Enolase_C 0.68
PF13365Trypsin_2 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG0148EnolaseCarbohydrate transport and metabolism [G] 0.68

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008998|Ga0103502_10121223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum939Open in IMG/M
3300008998|Ga0103502_10399470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum510Open in IMG/M
3300009022|Ga0103706_10144626All Organisms → cellular organisms → Eukaryota → Sar584Open in IMG/M
3300009028|Ga0103708_100294104All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300017503|Ga0186372_1056935All Organisms → cellular organisms → Eukaryota → Sar532Open in IMG/M
3300017503|Ga0186372_1058298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum514Open in IMG/M
3300017506|Ga0186373_1059325All Organisms → cellular organisms → Eukaryota → Sar537Open in IMG/M
3300018683|Ga0192952_1038606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum514Open in IMG/M
3300018683|Ga0192952_1040113All Organisms → cellular organisms → Eukaryota → Sar506Open in IMG/M
3300018704|Ga0192954_1056486All Organisms → cellular organisms → Eukaryota → Sar534Open in IMG/M
3300018704|Ga0192954_1056488All Organisms → cellular organisms → Eukaryota → Sar534Open in IMG/M
3300018704|Ga0192954_1061009All Organisms → cellular organisms → Eukaryota → Sar512Open in IMG/M
3300018706|Ga0193539_1075724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum510Open in IMG/M
3300018740|Ga0193387_1065045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum515Open in IMG/M
3300018741|Ga0193534_1071997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum503Open in IMG/M
3300018769|Ga0193478_1063845All Organisms → cellular organisms → Eukaryota → Sar590Open in IMG/M
3300018769|Ga0193478_1077440All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300018770|Ga0193530_1103103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum515Open in IMG/M
3300018771|Ga0193314_1086778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum504Open in IMG/M
3300018777|Ga0192839_1076944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum514Open in IMG/M
3300018777|Ga0192839_1080354All Organisms → cellular organisms → Eukaryota → Sar501Open in IMG/M
3300018793|Ga0192928_1091830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum517Open in IMG/M
3300018793|Ga0192928_1094557All Organisms → cellular organisms → Eukaryota → Sar508Open in IMG/M
3300018793|Ga0192928_1095493All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300018802|Ga0193388_1074578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum529Open in IMG/M
3300018802|Ga0193388_1075035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum527Open in IMG/M
3300018802|Ga0193388_1079532All Organisms → cellular organisms → Eukaryota → Sar509Open in IMG/M
3300018802|Ga0193388_1080304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum506Open in IMG/M
3300018819|Ga0193497_1086632All Organisms → cellular organisms → Eukaryota → Sar567Open in IMG/M
3300018845|Ga0193042_1152574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum520Open in IMG/M
3300018847|Ga0193500_1083378All Organisms → cellular organisms → Eukaryota → Sar538Open in IMG/M
3300018847|Ga0193500_1090047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum513Open in IMG/M
3300018854|Ga0193214_1101607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum518Open in IMG/M
3300018854|Ga0193214_1106568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum502Open in IMG/M
3300018854|Ga0193214_1106844All Organisms → cellular organisms → Eukaryota → Sar501Open in IMG/M
3300018879|Ga0193027_1123296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum503Open in IMG/M
3300018882|Ga0193471_1111959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum507Open in IMG/M
3300018882|Ga0193471_1112293All Organisms → cellular organisms → Eukaryota → Sar506Open in IMG/M
3300018882|Ga0193471_1114169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum501Open in IMG/M
3300018883|Ga0193276_1100294All Organisms → cellular organisms → Eukaryota → Sar589Open in IMG/M
3300018883|Ga0193276_1111827All Organisms → cellular organisms → Eukaryota → Sar551Open in IMG/M
3300018883|Ga0193276_1126239All Organisms → cellular organisms → Eukaryota → Sar511Open in IMG/M
3300018883|Ga0193276_1129400All Organisms → cellular organisms → Eukaryota → Sar503Open in IMG/M
3300018898|Ga0193268_1206856All Organisms → cellular organisms → Eukaryota → Sar519Open in IMG/M
3300018926|Ga0192989_10161436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum536Open in IMG/M
3300018926|Ga0192989_10174184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum509Open in IMG/M
3300018930|Ga0192955_10190758All Organisms → cellular organisms → Eukaryota → Sar528Open in IMG/M
3300018941|Ga0193265_10262027All Organisms → cellular organisms → Eukaryota → Sar507Open in IMG/M
3300018961|Ga0193531_10328036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum515Open in IMG/M
3300018971|Ga0193559_10280190All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300018976|Ga0193254_10140205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum553Open in IMG/M
3300018976|Ga0193254_10161918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum506Open in IMG/M
3300018989|Ga0193030_10273982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum550Open in IMG/M
3300018989|Ga0193030_10303195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum516Open in IMG/M
3300018997|Ga0193257_10216244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum549Open in IMG/M
3300018997|Ga0193257_10225973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum532Open in IMG/M
3300019000|Ga0192953_10191698All Organisms → cellular organisms → Eukaryota → Sar520Open in IMG/M
3300019000|Ga0192953_10195466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum515Open in IMG/M
3300019012|Ga0193043_10294928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum590Open in IMG/M
3300019012|Ga0193043_10334066All Organisms → cellular organisms → Eukaryota → Sar535Open in IMG/M
3300019012|Ga0193043_10362850All Organisms → cellular organisms → Eukaryota → Sar501Open in IMG/M
3300019012|Ga0193043_10362883All Organisms → cellular organisms → Eukaryota → Sar501Open in IMG/M
3300019013|Ga0193557_10263236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum537Open in IMG/M
3300019013|Ga0193557_10277547All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300019016|Ga0193094_10291985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum511Open in IMG/M
3300019017|Ga0193569_10409672All Organisms → cellular organisms → Eukaryota → Sar520Open in IMG/M
3300019017|Ga0193569_10414558All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300019017|Ga0193569_10415438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum514Open in IMG/M
3300019017|Ga0193569_10419537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum510Open in IMG/M
3300019019|Ga0193555_10273263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum534Open in IMG/M
3300019019|Ga0193555_10277347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum528Open in IMG/M
3300019019|Ga0193555_10288063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum513Open in IMG/M
3300019024|Ga0193535_10269048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum522Open in IMG/M
3300019029|Ga0193175_10238299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum541Open in IMG/M
3300019038|Ga0193558_10369281All Organisms → cellular organisms → Eukaryota → Sar516Open in IMG/M
3300019038|Ga0193558_10381790All Organisms → cellular organisms → Eukaryota → Sar503Open in IMG/M
3300019120|Ga0193256_1075501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum557Open in IMG/M
3300019131|Ga0193249_1145882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum507Open in IMG/M
3300019131|Ga0193249_1147758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum502Open in IMG/M
3300019139|Ga0193047_1135293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum507Open in IMG/M
3300019151|Ga0192888_10257156All Organisms → cellular organisms → Eukaryota → Sar500Open in IMG/M
3300021876|Ga0063124_105779All Organisms → cellular organisms → Eukaryota → Sar500Open in IMG/M
3300021885|Ga0063125_1002371All Organisms → cellular organisms → Eukaryota → Sar502Open in IMG/M
3300021896|Ga0063136_1015488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum502Open in IMG/M
3300021902|Ga0063086_1059220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum507Open in IMG/M
3300030752|Ga0073953_11473635All Organisms → cellular organisms → Eukaryota → Sar527Open in IMG/M
3300030961|Ga0151491_1263809All Organisms → cellular organisms → Eukaryota → Sar531Open in IMG/M
3300032463|Ga0314684_10639813All Organisms → cellular organisms → Eukaryota → Sar616Open in IMG/M
3300032463|Ga0314684_10771545All Organisms → cellular organisms → Eukaryota → Sar549Open in IMG/M
3300032470|Ga0314670_10651776All Organisms → cellular organisms → Eukaryota → Sar541Open in IMG/M
3300032470|Ga0314670_10710934All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300032470|Ga0314670_10711797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum513Open in IMG/M
3300032481|Ga0314668_10617983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum547Open in IMG/M
3300032481|Ga0314668_10694650All Organisms → cellular organisms → Eukaryota → Sar505Open in IMG/M
3300032481|Ga0314668_10700612All Organisms → cellular organisms → Eukaryota → Sar502Open in IMG/M
3300032491|Ga0314675_10171073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum1049Open in IMG/M
3300032491|Ga0314675_10516539All Organisms → cellular organisms → Eukaryota → Sar590Open in IMG/M
3300032491|Ga0314675_10637021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum520Open in IMG/M
3300032491|Ga0314675_10664943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum506Open in IMG/M
3300032492|Ga0314679_10473384All Organisms → cellular organisms → Eukaryota → Sar565Open in IMG/M
3300032517|Ga0314688_10330765All Organisms → cellular organisms → Eukaryota → Sar817Open in IMG/M
3300032517|Ga0314688_10752059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum521Open in IMG/M
3300032517|Ga0314688_10793959All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300032518|Ga0314689_10560533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum594Open in IMG/M
3300032519|Ga0314676_10531455All Organisms → cellular organisms → Eukaryota → Sar698Open in IMG/M
3300032519|Ga0314676_10864230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum517Open in IMG/M
3300032519|Ga0314676_10880456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum510Open in IMG/M
3300032520|Ga0314667_10649769All Organisms → cellular organisms → Eukaryota → Sar580Open in IMG/M
3300032520|Ga0314667_10794975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum511Open in IMG/M
3300032540|Ga0314682_10490729All Organisms → cellular organisms → Eukaryota → Sar676Open in IMG/M
3300032615|Ga0314674_10474867All Organisms → cellular organisms → Eukaryota → Sar647Open in IMG/M
3300032615|Ga0314674_10693573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum515Open in IMG/M
3300032615|Ga0314674_10705210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum509Open in IMG/M
3300032616|Ga0314671_10666291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum559Open in IMG/M
3300032616|Ga0314671_10761186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum516Open in IMG/M
3300032650|Ga0314673_10711642All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300032651|Ga0314685_10476514All Organisms → cellular organisms → Eukaryota → Sar688Open in IMG/M
3300032651|Ga0314685_10492282All Organisms → cellular organisms → Eukaryota → Sar675Open in IMG/M
3300032651|Ga0314685_10649228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum571Open in IMG/M
3300032707|Ga0314687_10842268All Organisms → cellular organisms → Eukaryota → Sar506Open in IMG/M
3300032708|Ga0314669_10837809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum500Open in IMG/M
3300032709|Ga0314672_1333022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum562Open in IMG/M
3300032709|Ga0314672_1389935All Organisms → cellular organisms → Eukaryota → Sar511Open in IMG/M
3300032711|Ga0314681_10754698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum534Open in IMG/M
3300032713|Ga0314690_10632530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum522Open in IMG/M
3300032713|Ga0314690_10670113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum502Open in IMG/M
3300032714|Ga0314686_10364388All Organisms → cellular organisms → Eukaryota → Sar720Open in IMG/M
3300032714|Ga0314686_10655288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum505Open in IMG/M
3300032726|Ga0314698_10546329All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300032727|Ga0314693_10775001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum513Open in IMG/M
3300032728|Ga0314696_10692049All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300032729|Ga0314697_10423794All Organisms → cellular organisms → Eukaryota → Sar590Open in IMG/M
3300032729|Ga0314697_10554847All Organisms → cellular organisms → Eukaryota → Sar500Open in IMG/M
3300032732|Ga0314711_10632713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum541Open in IMG/M
3300032733|Ga0314714_10396707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum777Open in IMG/M
3300032733|Ga0314714_10738397All Organisms → cellular organisms → Eukaryota → Sar536Open in IMG/M
3300032733|Ga0314714_10747744All Organisms → cellular organisms → Eukaryota → Sar531Open in IMG/M
3300032733|Ga0314714_10809472All Organisms → cellular organisms → Eukaryota → Sar505Open in IMG/M
3300032743|Ga0314707_10438189All Organisms → cellular organisms → Eukaryota → Sar681Open in IMG/M
3300032747|Ga0314712_10576939All Organisms → cellular organisms → Eukaryota → Sar521Open in IMG/M
3300032748|Ga0314713_10480119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum525Open in IMG/M
3300032749|Ga0314691_10429584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum546Open in IMG/M
3300032751|Ga0314694_10519950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum507Open in IMG/M
3300032755|Ga0314709_10525306All Organisms → cellular organisms → Eukaryota723Open in IMG/M
3300032755|Ga0314709_10546026All Organisms → cellular organisms → Eukaryota → Sar706Open in IMG/M
3300032755|Ga0314709_10641864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum639Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine52.05%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater40.41%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.11%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.05%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.37%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300017503Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in f/2 medium with seawater, no silicate, 15 C, 29.4 psu salinity and 472 ?mol photons light - Neoceratium fusus PA161109 (MMETSP1074)Host-AssociatedOpen in IMG/M
3300017506Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in f/2 medium with seawater, no silicate, 15 C, 29.4 psu salinity and 148 ?mol photons light - Neoceratium fusus PA161109 (MMETSP1075)Host-AssociatedOpen in IMG/M
3300018683Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782475-ERR1712204)EnvironmentalOpen in IMG/M
3300018704Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782253-ERR1711956)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018740Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789647-ERR1719307)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018771Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001658 (ERX1789535-ERR1719438)EnvironmentalOpen in IMG/M
3300018777Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000589 (ERX1789605-ERR1719349)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018802Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789649-ERR1719297)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018845Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809760-ERR1740122)EnvironmentalOpen in IMG/M
3300018847Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003005 (ERX1789704-ERR1719166)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018898Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789568-ERR1719317)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018941Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001288 (ERX1789482-ERR1719320)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018971Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003148EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019013Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003089EnvironmentalOpen in IMG/M
3300019016Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789509-ERR1719322)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019029Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000313 (ERX1789463-ERR1719383)EnvironmentalOpen in IMG/M
3300019038Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003141EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300021876Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-18 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030752Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030961Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103502_1012122323300008998MarineTGIPGGSSLPEQQDSIKALARREMGAMKPVVFCALAVVSATGLAQNPCTGCDGTLAQAYQVCAKDHGNPCAETNEKGLVSSGAGTKKDIGCCMKKEKHDRCLECKSMDCSYKTCHVNKQYYSEYSSVTEAKKWTKKANKEHSAKAMKAAGWGDNKA*
Ga0103502_1039947013300008998MarineSIGTCKLVLLVAMICAMKSASIFVLVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGDNDA*
Ga0103706_1014462623300009022Ocean WaterMKSVAALALMMAVASATLLQQEQDPCAGCDVGQAQSYQTCAMKYGNPCAETNDKGLVIKGPGTKKDISCCMKKEKHDRCLECKSMDCEYKTCNVNKVYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGDNNA*
Ga0103708_10029410413300009028Ocean WaterHKTTISCIALPMKFPWVLALTVTCVNADVQNPCTGCDGALAQAYQTCAMKYGNPCAETNDKGLVIKGPGTKKDISCCMKKEKHDRCMECKSMDCEYKTCHVNKVYYSKYGSIEEAKKWTKKANQEFSTKAMKAAGWGENHAGE*
Ga0186372_105693513300017503Host-AssociatedLKPFTLKQPTRASSQHQSTCKGEMGAMKIAVLCALAGVSATGLTQDPCTGCDSALAQAYQVCAKDHGNPCAETNDAGLVISGAGKKKDVSCCLKKEKHDRCMECISMDCQFKTCHVNKQYYSEYGSITEAKKWTKKANKEHSAKAMKAAGWGDNKA
Ga0186372_105829813300017503Host-AssociatedLKPFTLKQPTRASSQHQSTCKGEMGAMKIAVLCALAGVSATGLTQDPCTGCDSALAQAYQVCAKDHGNPCAETNDAGLVISGAGKKKDVSCCLKKEKHDRCMECISMDCQFKTCHVNKQYYSEYGSITEAKKWTKKANKEFSKKSMKAAGWGDNDA
Ga0186373_105932513300017506Host-AssociatedWLKPFTLKQPTRASSQHQSTCKGEMGAMKIAVFCALAGVSATGLTQDPCTGCDSALAQAYQVCAKDHGNPCAETNDAGLVISGAGKKKDVSCCLKKEKHDRCMECISMDCQFKTCHVNKQYYSEYGSITEAKKWTKKANKEHSAKAMKAAGWGDNKA
Ga0192952_103860613300018683MarineGGSRASRHLDSKETSGAMKISVLLVLASSAVEAIVQNPCTGCDGTLSQAYQTCAMKYGNPCAETNDKGLVSKGPGTKKDISCCMKKEKHDRCMECKSMDCQYKTCNVNKVYYSEYGSVEEAKKWTKKANKQFSKKSMKAAGWG
Ga0192952_104011313300018683MarineHGHVKNITSKTGLLTKFSWVLVLAVTSVNADLQNPCTGCDEALAQSYQACAMKYGNPCAERNDKGLVSKAPGTKKDVSCCMKKEKHDRCLECKSMDCQYKTCNVNKVYYSEYGSVEEAKKWTKKANKQFSKKSMKAAGWG
Ga0192954_105648613300018704MarineMKISVLLFLASTAAEAIVQNPCTGCDGSLAQAYQTCAMKYGNPCAETNDKGLVSKGPGTKKDISCCMKKEKHDRCMECKSMDCAYKTCNVNKVYYSEYGSVEEKKKWSKENQKKFATKGMKAAGWGPNNAA
Ga0192954_105648813300018704MarineMKISVLLVLASTAAEAIVQNPCTGCDGSLAQAYQTCAMKYGNPCAETNDKGLVSKGPGTKKDISCCMKKEKHDRCMECKSMDCAYKTCNVNKVYYSEYGSVEEKKKWSKENQKKFATKGMKAAGWGPNNAA
Ga0192954_106100923300018704MarineAQGYHHHVKNITSKTGLLMKFSWVLVLAVTSVNADLQNPCTGCDEALAQSYQACAMKYGNPCAERNDKGLVSKAPGTKKDVSCCMKKEKHDRCLECKSMDCQYKTCNVNKVYYNKYGNVEEAKKWTKEANQKFSKKSMKAAGWG
Ga0193539_107572413300018706MarineGSSIGTCKLVLLVAMICAMKIASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0193387_106504513300018740MarineMAAMKTVLVLALTVPAARALVQDPCSGCNDGLAQTYQTCAMKHGNPCAEMNEAGLVSDGPGTKKDVSCCLKKEKHDRCMECKSMDCQYKTCNVNKQYYSHYGSIEEAKKWTKEANKQFSKKSMKAAGWGL
Ga0193534_107199713300018741MarineSSIGTCKLVLLVAMICAMKIASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0193478_106384513300018769MarineMKISALLVLASTAAEAIVQNPCTGCDGSLAQAYQTCAMKYGNPCAETNDKGLVIKGPGTKKDISCCMKKEKHDRCMECKSMDCEYKTCNVNKVYYSEYGSIEEAKKWTKKANQEFSTKAMKAAGWGENHAGEE
Ga0193478_107744013300018769MarineSRHLDSKEASGAMKISVLLVLASSAVEAIVQNPCTGCDGALAQAYQTCAMKYGNPCAETNEAGLVIKGPGTKKDISCCMKKEKHDRCMECKSMDCEYKTCNVNKVYYSEYGSVEEAKKWTKKANKEFSKKSMKAAGWG
Ga0193530_110310313300018770MarineTCKLVLLVAMICAMKIASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0193314_108677813300018771MarineSIGTCKLVLLVAMMCAMKIASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0192839_107694413300018777MarineCILVLPVAMICAMKIASLFVLVGTTVHAELQDPCTGCDTTLAQAYQTCAMKHGNPCAELNDAGLVGSGPGTKKDVGCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKAANKEYSKKSMKAAGWGDNDA
Ga0192839_108035413300018777MarineSSPSSGSRHRHLQLFLDICLAMKISLLLALAGTAVKAIVQNPCTGCDSGLAQSYQTCAMKYGNPCAEQNEAGLVIKGPGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGENKA
Ga0192928_109183013300018793MarineSIGTWKLVLVVAMIGAMKTAWIFILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0192928_109455713300018793MarinePRGTSCWDCNKGIAAMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0192928_109549313300018793MarineSSPSFGSRHWHLQLFLDICLAMKISLLLALAGTAVKAIVQNPCTGCDSGLAQSYQTCAMKYGNPCAEQNEAGLVIKGPGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGENKA
Ga0193388_107457813300018802MarineGTCKLVLIVAMIGAMKTAWMFILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKAANKEYSKKSMKAAGWGDNDA
Ga0193388_107503513300018802MarineRCILVLPVAMICAMKIASLFVLVGTTVHAELQDPCTGCDTTLAQAYQTCAMKHGNPCAELNDAGLVGSGPGTKKDVGCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKAANKEYSKKSMKAAGWGDNDA
Ga0193388_107953213300018802MarineMKISVLFVLASTAAEAIVQNPCTGCDGSLAQAYQTCAMKYGNPCAETNDKGLVIKGPGTKKDISCCMKKEKHDRCMECKSMDCEYKTCNVNKVYYSEYGSVEEKKKWSKENQKKFASKGMKAAGWGPNNAA
Ga0193388_108030413300018802MarineQAFGTCKLVLLVAMICAMKIASLFVLVGTVVRAELQDPCTGCDSTLAQSYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCMKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKAANKEFSKKSMKAAGWGDNDA
Ga0193497_108663213300018819MarineMKTAFLLAFAGAIVTAIVQNPCTGCDEGLAQTYQTCAMKFGNPCAEMNEAGLVIKGEGTKKDVSCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYSNTMEAKKWTKEANQAYSKKSMKAAGWGD
Ga0193042_115257413300018845MarineSSIGTCKLLLVVAMIGAMKTAWLFILIGTVVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGDNDA
Ga0193500_108337813300018847MarineRIKLLSLALHCIALPMKFSWVLALTVTCVNADVQNPCTGCDGALAQAYQTCAMKYGNPCAETNDKGLVIKGPGTKKDISCCMKKEKHDRCMECKSMDCEYKTCNVNKVYYSEYGAVEEKKKWSKENQKKFASKGMKAAGWGKNNA
Ga0193500_109004713300018847MarineCILVLPVAMICAMKIASLFVLVGTTVYAELQDPCTGCDTTLAQAYQTCAMKHGNPCAELNDAGLVGSGPGTKKDVGCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKAANKEYSKKSMKAAGWGDNDA
Ga0193214_110160713300018854MarineCILVLPVAMICAMKIASLFVLVGTTVHAELQDPCTGCDTTLAQAYQTCAMKHGNPCAELNDAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKAANKEYSKKSMKAAGWGDNDA
Ga0193214_110656813300018854MarineSNGICKLVLFFTMIGAMKTAWVFVLVGTIVHAEFQDPCTGCDETLAQAYQTCAMIHGNPCAELNEKGLVGSGPGTKKDISCCMKKEKHDRCLECKSMDCAYKTCHVNKQYYSKYGSIEEAKKWTKQANKEYSQKSMEAAGWGKNDA
Ga0193214_110684413300018854MarineQAIYGRHRHTQLFVDICLPMKISLLLAFAGTAVNAIVQNPCTGCDSALAQAYQTCAMKYGNPCAEQNDAGLVIKGPGTKKDVGCCLKKEKHDTCMECKSMDCQYKTCNVNKKYYSEYHSVQEAKKWTKEANKKFSKESMKAAGWGDNDA
Ga0193027_112329613300018879MarineMAAMKTVLVLALTVPAARALVQDPCSGCNDGLSQSYQTCAMKHGNPCAETNEAGLVSDGPGTKKDVSCCLKKEKHDRCMECKSMDCQYKTCNVNKQYYSHYGSIEEAKKWTKEANKQFSKKSMKAAGWGL
Ga0193471_111195923300018882MarineRGTSCWDCNKGIAAMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0193471_111229313300018882MarineMKISALLVLASTAAEAIVQNPCTGCDGSLAQAYQTCAMKYGNPCAETNDKGLVIKGPGTKKDISCCMKKEKHDRCMECKSMDCEYKTCNVNKVYYSEYGSVEEKKKWSKENQKKFASKGMKAAGWGPNNAA
Ga0193471_111416913300018882MarineMKISLLLALAGSVADALLQDPCTGCTSGLAQSYQTCAMKHGNPCAELNEAGLVTTGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHTIQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0193276_110029413300018883MarineRIKLLSLALHCIALHCIALPMKFSWVLALTVTCVNADVQNPCTGCDGALAQAYQTCAMKYGNPCAETNDKGLVIKGPGTKKDISCCMKKEKHDRCMECKSMDCEYKTCNVNKVYYSEYGSIEEAKKWTKKANQEFSTKAMKAAGWGENHAGE
Ga0193276_111182713300018883MarineRIKLLSLALHCIALHCIALPMKFSWVLALTVTCVNADVQNPCTGCDGALAQAYQTCAMKYGNPCAETNDKGLVIKGPGTKKDISCCMKKEKHDRCMECKSMDCEYKTCNVNKVYYSEYGAVEEKKKWSKENQKKFASKGMKAAGWGKNNA
Ga0193276_112623913300018883MarineSSNKASSRTCLRDCREMGAMKVALLFAVAGATVTALIQDPCTGCDEGLAQTYQTCAMKHGDPCAETNKAGLVIDGPGEKKDVSCCLKKQKHDRCLECKSMDCAYKTCHVNKQYYSKYTSITEAKKWTKEANKQYSKKAMKAAGWGDNDA
Ga0193276_112940013300018883MarineSSPRSGSRHRHLQLFLNICLAMKISLLLALAGTAVKAIVQNPCTGCDSGLAQSYQTCAMKYGNPCAEQNEAGLVIKGPGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGENKA
Ga0193268_120685613300018898MarineRLGARKTLYATHFTLDTMKISLLLAWAGTAVKAILQNPCTGCDSGLAQSYQTCAMKYGNPCAETNEAGHVISGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSIQEAKKWTKEANKEFSKKSMKAAGWGENDA
Ga0192989_1016143613300018926MarineFHGSSIGTCKLVLLVAMICAMKTASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0192989_1017418413300018926MarineSIGTCKLVLVVAMIGAMKTAWIFILVGTVVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGDNDA
Ga0192955_1019075813300018930MarineKIKKQACVNVSRASRHLDSKEASGAMKISVLLVLASSAVEAIVQNPCTGCDGTLSQAYQTCAMKYGNPCAETNDKGLVSKGPGTKKDISCCMKKEKHDRCMECKSMDCQYKTCNVNKVYYSEYGSVEEAKKWTKKANKQFSKKSMKAAGWG
Ga0193265_1026202713300018941MarineATHFTLDTMKISLLLAWAGTAVKAILQNPCTGCDSGLAQSYQTCAMKYGNPCAETNEAGHVISGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSIQEAKKWTKEANKEFSKKSMKAAGWGENDA
Ga0193531_1032803613300018961MarineKLVLLGAMICAMKIASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0193559_1028019013300018971MarinePELRGTRCWDCRRGIAAMKISVLVVFVGASVNALVQDPCTGCNEGLAQNYQQCAMKHGNPCAETNKAGLVIDGPGTKKDYGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYTSIEEAKKWTKESNKKFSKKAMKAAGWGENHA
Ga0193254_1014020513300018976MarineLSFRTHALGSSIGTCKLVLLVAMICAMKTASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0193254_1016191813300018976MarineTCKLVLVVAMIGAMKTAWIFILVGTVVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGDNDA
Ga0193030_1027398213300018989MarineHGSSIGTCKLVLLVAMICAMKIASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0193030_1030319513300018989MarineMKTVLVLALTVPAARALVQDPCSGCNDGLSQSYQTCAMKHGNPCAETNEAGLVSDGPGTKKDVSCCLKKEKHDRCMECKSMDCQYKTCNVNKQYYSHYGSIEEAKKWTKEANKQFSKKSMKAAGWGL
Ga0193257_1021624413300018997MarineLAQGLTSIGTCKLVLLVAMICAMKTASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0193257_1022597313300018997MarineTCKLVLVVAMIGAMKTAWIFILVGTVVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGDNNA
Ga0192953_1019169813300019000MarineTWAQGYHHHVKNITSKTGLLMKFSWVLVLAVTSVNADLQNPCTGCDEALAQSYQACAMKYGNPCAERNDKGLVSKAPGTKKDVSCCMKKEKHDRCLECKSMDCQYKTCNVNKVYYSEYGSVEEAKKWTKKANKQFSKKSMKAAGWG
Ga0192953_1019546613300019000MarineHGGSRASRHLDSKEASGAMKISVLLVLASSAVEAIVQNPCTGCDGTLSQAYQTCAMKYGNPCAETNDKGLVSKGPGTKKDISCCMKKEKHDRCMECKSMDCQYKTCNVNKVYYSEYGSVEEAKKWTKKANKQFSKKSMKAAGWG
Ga0193043_1029492813300019012MarineSSIGTCKLLLVVAMIGAMKTAWLFILIGTVVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGDNNA
Ga0193043_1033406613300019012MarineKLSEPKLLEKAAVKMKISLLALAGVAVNAIVQNPCTGCDSGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0193043_1036285013300019012MarineSRVPPPRETYYFNTGLPMKFSWVLVLAVTSVNADLQNPCTGCTEDHAQSYQTCAMKYGNPCAETNAKGLVSKAPGTKKDIGCCMKKEKHDRCIQCKSMDCAYKTCNVNKQYYNKYGGIEEAKKWTKEANQKFSKKAMKAAGWGENNAGK
Ga0193043_1036288313300019012MarineLPEQQDSIKALARGEMGAMKPVVFCALAVVSATGLAQNPCTGCDGTLAQAYQVCAKDHGNPCAETNGKGLVTSGAGTKKDIGCCMKKEKHDRCLECKSMDCAHKTCHVNKQYYSEYSSVTEAKKWTKKANKEHSAKAMKAAGWGDNKA
Ga0193557_1026323613300019013MarineVKRMQNTTCYFRSFLDPSWSMKVSLLLALAGTAVDAILQNPCTGCDSGLAQSYQTCASKHGNPCAELNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCAYKTCNVNKQYYSEYDSVQEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0193557_1027754713300019013MarineERLSARRTLLNISTNSWSMKISLLLALAGTAVDAILQNPCTGCDAGLAQSYQTCAMKHGNPCAELNEAGLVIKGAGTKKDYGCCLKKEKHDRCMECKSMDCAYKTCNVNKQYYSEYHSIQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0193094_1029198513300019016MarineLAQAFGTCKLVLLVAMICAMKIASLFVLVGTVVRAELQDPCTGCDSTLAQSYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCMKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKAANKEFSKKSMKAAGWGDNDA
Ga0193569_1040967213300019017MarineLAQVAYQSSKTASKHLQGKMVAMKPVVFCALAVVSATGLAQNPCTGCDGTLAQAYQVCAKDHGNPCAETNGKGLVTSGAGTKKDIGCCMKKEKHDRCLECKSMDCAHKTCHVNKQYYSEYSSVTEAKKWTKKANKEHSAKAMKAAGWGDNKA
Ga0193569_1041455813300019017MarineWLKPFTLKQPTRASSQHQSTCKGEMGAMKIAVFCALAGVSATGLTQNPCTGCDSALAQAYQVCAKDHGNPCAETNEAGLVIKGAGTKKDVGCCMKKNKHDRCMECKSMDCKFKTCHVNKQYYSEYGSITEAKKWTKKANKEFSKKSMKAAGWGDNDA
Ga0193569_1041543813300019017MarineWLKPFTLKQPTRASSQHQSTCKGEMGAMKIAVFCALAGVSATGLTQNPCTGCDSALAQAYQVCAKDHGNPCAETNDAGLVISGAGKKKDVSCCLKKEKHDRCMECISMDCQFKTCHVNKQYYSEYGSITEAKKWTKKANKEFSKKAMKAAGWGDNKA
Ga0193569_1041953713300019017MarineGTCKLVLVVAMIGAMKIAWMFILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGENDA
Ga0193555_1027326313300019019MarineQGRCILVLPVAMICAMKIASLFVLVGTTVHAELQDPCTGCDTTLAQAYQTCAMKHGNPCAELNDAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKAANKEYSKKSMKAAGWGDNDA
Ga0193555_1027734713300019019MarineTCKLVLVVAMIGAMKTAWMFILVGTVVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKAANKEYSKKSMKAAGWGDNDA
Ga0193555_1028806313300019019MarineTCKLVLVVAMIGAMKTAWMFILVGTVVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGDNDA
Ga0193535_1026904813300019024MarineNEGSSIGTCKLVLLVAMICAMKIASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWCENNA
Ga0193175_1023829913300019029MarineMKLVVFCALAGVPASGLIQNPCTGCDSTLAQAYQVCAKDHGNPCAETDGAGLVISGPGKKKDVGCCMKKEKHDRCLECKSMDCQYKTCNVNKQYYSEYGSITEAKKWTKKANKEFSKKSMKAAGWGDNNA
Ga0193558_1036928113300019038MarineTMAGEVCACAAGAVRLRWIAAMKISVLVVFVGASVNALVQDPCTGCNEGLAQNYQQCAMKHGNPCAETNKAGLVIDGPGTKKDYGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYTSIEEAKKWTKESNKKFSKKAMKAAGWGENHA
Ga0193558_1038179013300019038MarineARRTLLNISTNSWSMKISLLLALAGTAVDAILQNPCTGCDAGLAQSYQTCAMKHGNPCAELNEAGLVIKGAGTKKDYGCCLKKEKHDRCMECKSMDCAYKTCNVNKQYYSEYHSIQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0193256_107550113300019120MarineNNVAVFIGSSIGTCKLVLLVAMICAMKTASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0193249_114588213300019131MarineGSSSLPEQQDSIKALARGEMGAMKPVVFCALAVVSATGLAQNPCTGCDGTLAQAYQVCAKDHGNPCAETNEKGLVSSGAGTKKDIGCCMKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYSSVTEAKKWTKKANKEHSAKAMKAAGWGDNKA
Ga0193249_114775813300019131MarineKLVLVVAMIGAMKTAWMFILVGTVVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMKAAGWGDNDA
Ga0193047_113529313300019139MarineASRHLDSKQASGAMKISLLLVLASSAVEAIVQNPCTGCDGTLAQSYQTCAMKYGDPCAETNEEGLVIKGPGTKKDVSCCLKKEKHDRCMECKSMDCQYKTCNVNKKYYSEYGSVQEAKKWTKEANKDYAAKEMKKAGWG
Ga0192888_1025715613300019151MarineMKISVLLVLASTTAEAIVQNPCTGCDGSLAQAYQTCAMKYGNPCAETNDKGLVIKGPGTKKDISCCMKKEKHDRCMECKSMDCEYKTCNVNKVYYSEYGVVEEKKKWSKENQKKFASKGMKAAGWGKNNA
Ga0063124_10577913300021876MarineSNRVPPRRETYYFNTGLPMKFSWVLVLAVTSVNADLQNPCTGCTEDHAQSYQTCAMKYGNPCAETNAKGLVSKAPGTKKDIGCCMKKEKHDRCIQCKSMDCAYKTCNVNKQYYNKYGSIEEAKKWTKEANQKFSKKAMKAAGWGENNAGK
Ga0063125_100237113300021885MarineGSNRVPPRRETYYFNTGLPMKFSWVLVLAVTSVNADLQNPCTGCTEDHAQSYQTCAMKYGNPCAETNAKGLVSKAPGTKKDIGCCMKKEKHDRCIQCKSMDCAYKTCNVNKQYYNKYGSIEEAKKWTKEANQKFSKKAMKAAGWGENNAGK
Ga0063136_101548813300021896MarineIGTCKLVLLVAMICAMKIASLFVLVGTMVRAELQDPCTGCDSTLAQTYQTCAMKHGNPCAEMNEAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTKKANKEFSKKSMAAAGWGENNA
Ga0063086_105922013300021902MarineCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0073953_1147363513300030752MarineMKISVLLVLASTAAEAIVQNPCTGCDGSLAQAYQTCAMKYGNPCAETNDKGLVIKGPGTKKDISCCMKKEKHDRCMECKSMDCEYKTCNVNKVYYSEYGAVEEKKKWSKENQKKFASKGMKAAGWGKNNA
Ga0151491_126380913300030961MarineRARHYYLFDMCSSMKISFLVALAGVAVNGNVQNPCTGCDSGLAQSYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314684_1063981313300032463SeawaterVNANIQNPCTGCDPGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314684_1077154513300032463SeawaterRRPLPSPLPTRPSAIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314670_1065177623300032470SeawaterSMKISFLLALAGTAVNANVQNPCTGCDSGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314670_1071093413300032470SeawaterKPRGTSCWDCNKGIAAMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0314670_1071179713300032470SeawaterIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314668_1061798313300032481SeawaterHFGSSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314668_1069465013300032481SeawaterLAQAIQSKHRHAQFLLICSSMKISVLLVLAGTTVNAIVQNPCTGCDSGLAQTYQTCAMKYGNPCAEQNEAGLVIKGAGTKKDVSCCLKKGKHDRCMDCKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSQKSMKKAGWGDNDA
Ga0314668_1070061213300032481SeawaterPRGTNCWDCNKGIAAMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0314675_1017107313300032491SeawaterMTYRNLPILKSKHLQGKMGAMKPVVFCALAVVSATGLAQNPCTGCDGTLAQAYQVCAKDHGNPCAETNEKGLVSSGAGTKKDIGCCMKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYSSVTEAKKWTKKANKEHSAKAMKAAGWGDNKA
Ga0314675_1051653923300032491SeawaterMKISFLLALAGTAVNANVQNPCTGCDSGLAQTYQTCAMKYGNPCAETNGAGLVIKGAGTKKDVSCCFKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314675_1063702113300032491SeawaterSSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314675_1066494323300032491SeawaterGTSCWDCNKGIAAMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0314679_1047338413300032492SeawaterQALARTRHYYFFDICLSMKISFLLALAGTAVNANIQNPCTGCDSGLAQTYQTCAMKYGNPCAKTNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314688_1033076513300032517SeawaterMKISFLLALAGTAVNANIQNPCTGCDSGLAQTYQTCAMKYGNPCAKTNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314688_1075205913300032517SeawaterSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314688_1079395923300032517SeawaterWDCNKGIAAMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0314689_1056053313300032518SeawaterMSMAFRSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314676_1053145513300032519SeawaterMKISFLLALAGTAVNANVQNPCTGCDSGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314676_1086423013300032519SeawaterFCITCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314676_1088045613300032519SeawaterAQVAYQSSKTASKHLQGKMGAMKPVVFCALAVVSATGLAQNPCTGCDGTLAQAYQVCAKDHGNPCAETNEKGLVSSGAGTKKDIGCCMKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYSSVTEAKKWTKKANKEHSAKAMKAAGWGDNKA
Ga0314667_1064976923300032520SeawaterMKISFLLALAGTAVNANVQNPCTGCDSGLAQTYQTCAMKYGNPCAKTNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314667_1079497513300032520SeawaterLKPRGTSCWDCNKGIAAMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKQANKKFSKKSMKAAGWGDNDA
Ga0314682_1049072913300032540SeawaterMKISFLLALAGTAVNANVQNPCTGCDSGLAQTYQTCAMKYGNPCAKTNEAGLVIKGAGTKKDVSCCFKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314674_1047486713300032615SeawaterQALARTRHYYFFDICLSMKISFLLALAGTAVNANVQNPCTACDSGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314674_1069357313300032615SeawaterSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEGKKWTKKANKEFSKKSMKAAGWGDNNA
Ga0314674_1070521013300032615SeawaterLKPFTLKQPTRSSSQHQSTCKGEMGAMKIAVFCALAGVSATGLTQNPCTGCDSALAQAYQVCAKDHGNPCAETNDAGLVISGAGKKKDVSCCLKKEKHDRCMECISMDCQFKTCHVNKQYYSEYGSITEAKKWTKKANKEFSKKAMKAAGWGDNKA
Ga0314671_1066629113300032616SeawaterMALRSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314671_1076118613300032616SeawaterLAQAAVAYQSSKTASKHLQGKMGAMKPVVFCALAVVSATGLAQNPCTGCDGTLAQAYQVCAKDHGNPCAETNEKGLVSSGAGTKKDIGCCMKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYSSVTEAKKWTKKANKEHSAKAMKAAGWGDNKA
Ga0314673_1071164213300032650SeawaterMKISFLLALAGTAVNANIQNPCTGCDSGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314685_1047651413300032651SeawaterQGWDLHTLFIFDIYSSMKLSLLLALAGTVVKAIFQDPCTGCDSGLAQSYQTCAMKYGNPCAELNDAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCQYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314685_1049228213300032651SeawaterMKISFLLALAGTAVNANVQNPCTGCDSGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDGSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314685_1064922813300032651SeawaterMGAMKPVVFCALAVVSATGLAQNPCTGCDGTLAQAYQVCAKDHGNPCAETNEKGLVSSGAGTKKDIGCCMKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYSSVTEAKKWTKKANKEHSAKAMKAAGWGDNKA
Ga0314687_1084226813300032707SeawaterLALACTAVRANVQDPCTGCDPGLAQSYQTCAMKYGNPCAELNDAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCQYKTCNVNKKYYSEYHSVQQAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314669_1083780913300032708SeawaterVFSSVFLVTNTVHFRNYREKMGAMKLVLFCALAGVSATGLTQDPCTGCDSALAQAYQVCAKDHGNPCAETNDAGLVISGAGKKKDVSCCLKKEKHDRCMECISMDCQFKTCHVNKQYYSEYGTITEAKKWTKKANKEFSKKAMKAAGWGDNKA
Ga0314672_133302213300032709SeawaterMSMALRSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314672_138993513300032709SeawaterLKPRGTSCWDCNKGIAAMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0314681_1075469813300032711SeawaterSSHFGSSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314690_1063253013300032713SeawaterCFSARVSMVFCTYLAQVTNTVHFRNYREKMGAMKLVLFCALAGVSATGLTQDPCTGCDSALAQAYQVCAKDHGNPCAETNDAGLVISGAGKKKDVSCCLKKEKHDRCMECISMDCQFKTCHVNKQYYSEYGSITEAKKWTKKANKEFSKKAMKAAGWGDNKA
Ga0314690_1067011313300032713SeawaterTNCWDCNKGIAAMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0314686_1036438813300032714SeawaterQGQALARTRHYYFFDICLSMKISFLLALAGTAVNANIQNPCTGCDSGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314686_1065528813300032714SeawaterAYQSSKTASKHLQGKMGAMKPVVFCALAVVSATGLAQNPCTGCDGTLAQAYQVCAKDHGNPCAETNEKGLVSSGAGTKKDIGCCMKKEKHDRCLECKSMDCSYKTCHVNKQYYSEYSSVTEAKKWTKKANKEHSAKAMKAAGWGDNKA
Ga0314698_1054632913300032726SeawaterILAQATQGRHLHTQFIFDICSSMKLSLLLALAGTVVNAIVQDPCTGCDSGLAQSYQTCAMKYGNPCAELNDAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCQYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314693_1077500113300032727SeawaterGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314696_1069204913300032728SeawaterFWLKPRGTSCWDCNKGIAAMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0314697_1042379423300032729SeawaterMKISFLLALAGTAVNANVQNPCTACDSGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314697_1055484713300032729SeawaterHDRHRHTQLFLDICSSMKISLLLALAGTAVKAIVQNPCTGCDSGLAQSYQTCAMKHGNPCAELNDAGLVTKGAGTKKDISCCLKKEKHDRCIQCKSMDCEYNTCNVNKKYYSEYHSIQEAKKWTKEANKEFSQKSMKKAGWGDNDA
Ga0314711_1063271313300032732SeawaterSMSMALRSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314714_1039670723300032733SeawaterMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314714_1073839713300032733SeawaterRGLYQEMPTATQLSAANRQRLIHMVKIVALKQPTRTSSQHQSTCKEEMGAMKIAVFCALAGVSATGLTQNPCTGCDSALAQAYQVCAKDHGNPCAETNEAGLVIKGAGTKKDVGCCMKKNKHARCMECKSMDCKFKTCHVNKQYYSEYGSITEAKKWTKKANKEFSKKSMKAAGWGDN
Ga0314714_1074774413300032733SeawaterGWDLHTLFIFDIYSSMKLSLLLALAGTVVKAIFQDPCTGCDSGLAQSYQTCAMKYGNPCAELNDAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCQYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314714_1080947213300032733SeawaterQALARTRHYYFFDICLSMKISFLLALAGTAVNANIQNPCTGCDSGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314707_1043818913300032743SeawaterQVETILVQAIHCRHRHVQLFFICSSMKISLCLALVGTAVNAIVQNPCTGCDSGLAQTYQTCAMKYGNPCAEQNDAGLVIKGAGTKKDVSCCVKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314712_1057693913300032747SeawaterAQAIQSKHRHAQFLLICSSMKISVLLVLAGTTVNAIVQNPCTGCDSGLAQTYQTCAMKYGNPCAEQNEAGLVIKGAGTKKDVSCCLKKGKHDRCMDCKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSQKSMKKAGWGDNDACLGWRLILQGLK
Ga0314713_1048011913300032748SeawaterFGSSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314691_1042958413300032749SeawaterSSMSMALRSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314694_1051995013300032751SeawaterTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA
Ga0314709_1052530623300032755SeawaterMKISVLVVLVGASVNALVQDPCTGCDEGLAQNYQKCAMKHGNPCAETNKAGLVIDGPGTKKDVGCCLKKEKHDRCMECKSMDCAYKTCHVNKQYYSKYGNVEEAKKWTKEANKKFSKKSMKAAGWGDNDA
Ga0314709_1054602613300032755SeawaterQGQALARTRHYYFFDICLSMKISFLLALAGTAVNANVQNPCTACDSGLAQTYQTCAMKYGNPCAETNEAGLVIKGAGTKKDVSCCLKKEKHDRCMECKSMDCEYKTCNVNKKYYSEYHSVQEAKKWTKEANKEFSKKSMKAAGWGDNDA
Ga0314709_1064186413300032755SeawaterSHFGSSIGTCKLVLVVAMICAMKTASMLILVGTIVRAELQDPCTGCDTGLAQAYQTCAMKHGNPCAELNKAGLVGSGPGTKKDVSCCLKKEKHDRCLECKSMDCAYKTCHVNKQYYSEYGSIEEAKKWTNKANKEFSKKSMKAAGWGDNNA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.