Metagenome / Metatranscriptome Family F049863

Basic Information
Family ID	F049863
Family Type	Metagenome / Metatranscriptome
Number of Sequences	146
Average Sequence Length	43 residues
Representative Sequence	GVAAGAATAEDQAAANQFDKAGRTLLDVINRLTDVLLEMR
Number of Associated Samples	125
Number of Associated Scaffolds	146

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.69 %
% of genes near scaffold ends (potentially truncated)	97.26 %
% of genes from short scaffolds (< 2000 bps)	90.41 %
Associated GOLD sequencing projects	114
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.67

Most Common Taxonomy
Group	Bacteria (91.096 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (10.274 % of family members)
Environment Ontology (ENVO)	Unclassified (49.315 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (65.068 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 146 Family Scaffolds
PF00092	VWA	10.96
PF13519	VWA_2	10.96
PF00691	OmpA	6.16
PF00478	IMPDH	4.79
PF11199	DUF2891	2.74
PF00171	Aldedh	2.74
PF02817	E3_binding	0.68
PF00441	Acyl-CoA_dh_1	0.68
PF01936	NYN	0.68
PF00198	2-oxoacid_dh	0.68
PF03099	BPL_LplA_LipB	0.68
PF00903	Glyoxalase	0.68

COG ID	Name	Functional Category	% Frequency in 146 Family Scaffolds
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	2.74
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	2.74
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	2.74
COG0508	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component	Energy production and conversion [C]	1.37
COG0095	Lipoate-protein ligase A	Coenzyme transport and metabolism [H]	0.68
COG0321	Lipoate-protein ligase B	Coenzyme transport and metabolism [H]	0.68
COG0340	Biotin-protein ligase	Coenzyme transport and metabolism [H]	0.68
COG1432	NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation	General function prediction only [R]	0.68
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.68

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	91.10 %
Unclassified	root	N/A	8.90 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	91.10 %
Unclassified	root	N/A	8.90 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	91.10 %
Unclassified	root	N/A	8.90 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	82.88 %
Unclassified	root	N/A	8.90 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	21.23 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	13.01 %
Unclassified	root	N/A	8.90 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	21.23 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	11.64 %
Unclassified	root	N/A	8.90 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	1.37 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	21.23 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	11.64 %
Unclassified	root	N/A	8.90 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.37 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	21.23 %
Pyrinomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas	9.59 %
Unclassified	root	N/A	8.90 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	2.05 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.37 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	21.23 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	9.59 %
Unclassified	root	N/A	8.90 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	2.05 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.37 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2140918007\|ConsensusfromContig169983	Not Available	653	Open in IMG/M
3300000363\|ICChiseqgaiiFebDRAFT_14038122	All Organisms → cellular organisms → Bacteria → Acidobacteria	865	Open in IMG/M
3300000574\|JGI1357J11328_10084056	Not Available	1056	Open in IMG/M
3300000890\|JGI11643J12802_12262768	All Organisms → cellular organisms → Bacteria → Acidobacteria	2370	Open in IMG/M
3300002886\|JGI25612J43240_1046896	All Organisms → cellular organisms → Bacteria → Acidobacteria	632	Open in IMG/M
3300004157\|Ga0062590_102074245	All Organisms → cellular organisms → Bacteria → Acidobacteria	592	Open in IMG/M
3300005295\|Ga0065707_10216502	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1242	Open in IMG/M
3300005333\|Ga0070677_10104276	All Organisms → cellular organisms → Bacteria → Acidobacteria	1256	Open in IMG/M
3300005343\|Ga0070687_101443005	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	516	Open in IMG/M
3300005354\|Ga0070675_100336714	All Organisms → cellular organisms → Bacteria → Acidobacteria	1336	Open in IMG/M
3300005356\|Ga0070674_101231554	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	665	Open in IMG/M
3300005438\|Ga0070701_10109400	All Organisms → cellular organisms → Bacteria → Acidobacteria	1542	Open in IMG/M
3300005440\|Ga0070705_101380388	Not Available	587	Open in IMG/M
3300005444\|Ga0070694_101935069	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	504	Open in IMG/M
3300005544\|Ga0070686_100847963	All Organisms → cellular organisms → Bacteria → Acidobacteria	740	Open in IMG/M
3300005574\|Ga0066694_10535156	All Organisms → cellular organisms → Bacteria → Acidobacteria	546	Open in IMG/M
3300005577\|Ga0068857_101903411	Not Available	583	Open in IMG/M
3300005577\|Ga0068857_102491397	Not Available	508	Open in IMG/M
3300005617\|Ga0068859_100272962	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1783	Open in IMG/M
3300005617\|Ga0068859_100780565	All Organisms → cellular organisms → Bacteria → Acidobacteria	1044	Open in IMG/M
3300005617\|Ga0068859_101960812	All Organisms → cellular organisms → Bacteria → Acidobacteria	647	Open in IMG/M
3300005618\|Ga0068864_101474397	All Organisms → cellular organisms → Bacteria → Acidobacteria	683	Open in IMG/M
3300005841\|Ga0068863_100242822	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1738	Open in IMG/M
3300005843\|Ga0068860_101458708	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	706	Open in IMG/M
3300005844\|Ga0068862_100092151	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2641	Open in IMG/M
3300005844\|Ga0068862_100853348	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	893	Open in IMG/M
3300006049\|Ga0075417_10567765	All Organisms → cellular organisms → Bacteria → Acidobacteria	575	Open in IMG/M
3300006173\|Ga0070716_101048315	All Organisms → cellular organisms → Bacteria → Acidobacteria	647	Open in IMG/M
3300006794\|Ga0066658_10320221	All Organisms → cellular organisms → Bacteria → Acidobacteria	828	Open in IMG/M
3300006796\|Ga0066665_10203057	All Organisms → cellular organisms → Bacteria → Acidobacteria	1539	Open in IMG/M
3300006844\|Ga0075428_101278305	All Organisms → cellular organisms → Bacteria → Acidobacteria	772	Open in IMG/M
3300006846\|Ga0075430_101326302	All Organisms → cellular organisms → Bacteria → Acidobacteria	592	Open in IMG/M
3300006876\|Ga0079217_10705756	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	680	Open in IMG/M
3300006894\|Ga0079215_10027121	All Organisms → cellular organisms → Bacteria → Acidobacteria	2002	Open in IMG/M
3300006903\|Ga0075426_10724699	All Organisms → cellular organisms → Bacteria → Acidobacteria	746	Open in IMG/M
3300006954\|Ga0079219_10121702	All Organisms → cellular organisms → Bacteria → Acidobacteria	1332	Open in IMG/M
3300007076\|Ga0075435_101693825	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	555	Open in IMG/M
3300007265\|Ga0099794_10412701	All Organisms → cellular organisms → Bacteria	706	Open in IMG/M
3300007788\|Ga0099795_10560702	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	539	Open in IMG/M
3300009011\|Ga0105251_10118146	All Organisms → cellular organisms → Bacteria → Acidobacteria	1205	Open in IMG/M
3300009088\|Ga0099830_10738191	All Organisms → cellular organisms → Bacteria → Acidobacteria	811	Open in IMG/M
3300009089\|Ga0099828_11448357	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300009090\|Ga0099827_11471854	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	593	Open in IMG/M
3300009098\|Ga0105245_10853468	All Organisms → cellular organisms → Bacteria → Acidobacteria	951	Open in IMG/M
3300009100\|Ga0075418_11331799	All Organisms → cellular organisms → Bacteria → Acidobacteria	779	Open in IMG/M
3300009101\|Ga0105247_10796722	All Organisms → cellular organisms → Bacteria → Acidobacteria	720	Open in IMG/M
3300009147\|Ga0114129_13421112	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	510	Open in IMG/M
3300009148\|Ga0105243_10368174	All Organisms → cellular organisms → Bacteria → Acidobacteria	1325	Open in IMG/M
3300009162\|Ga0075423_12305351	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300009174\|Ga0105241_10813563	All Organisms → cellular organisms → Bacteria → Acidobacteria	862	Open in IMG/M
3300009176\|Ga0105242_10435298	All Organisms → cellular organisms → Bacteria	1232	Open in IMG/M
3300009545\|Ga0105237_10201191	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1992	Open in IMG/M
3300010042\|Ga0126314_10057446	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2546	Open in IMG/M
3300010044\|Ga0126310_11587221	All Organisms → cellular organisms → Bacteria → Acidobacteria	540	Open in IMG/M
3300010044\|Ga0126310_11852012	All Organisms → cellular organisms → Bacteria → Acidobacteria	503	Open in IMG/M
3300010045\|Ga0126311_10037457	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3034	Open in IMG/M
3300010045\|Ga0126311_11167543	All Organisms → cellular organisms → Bacteria → Acidobacteria	636	Open in IMG/M
3300010359\|Ga0126376_10412507	All Organisms → cellular organisms → Bacteria → Acidobacteria	1221	Open in IMG/M
3300010360\|Ga0126372_12924363	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300010375\|Ga0105239_10313524	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1768	Open in IMG/M
3300010375\|Ga0105239_13467061	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	513	Open in IMG/M
3300010397\|Ga0134124_10926138	All Organisms → cellular organisms → Bacteria → Acidobacteria	879	Open in IMG/M
3300010399\|Ga0134127_10187771	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1911	Open in IMG/M
3300010400\|Ga0134122_11232548	All Organisms → cellular organisms → Bacteria → Acidobacteria	751	Open in IMG/M
3300010400\|Ga0134122_11819837	All Organisms → cellular organisms → Bacteria → Acidobacteria	641	Open in IMG/M
3300010401\|Ga0134121_10689761	All Organisms → cellular organisms → Bacteria → Acidobacteria	967	Open in IMG/M
3300010401\|Ga0134121_10835046	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	888	Open in IMG/M
3300010401\|Ga0134121_11020558	All Organisms → cellular organisms → Bacteria → Acidobacteria	813	Open in IMG/M
3300011269\|Ga0137392_10884028	All Organisms → cellular organisms → Bacteria	736	Open in IMG/M
3300011332\|Ga0126317_10341802	All Organisms → cellular organisms → Bacteria → Acidobacteria	666	Open in IMG/M
3300012198\|Ga0137364_11264354	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	551	Open in IMG/M
3300012202\|Ga0137363_11046142	Not Available	694	Open in IMG/M
3300012362\|Ga0137361_11199114	All Organisms → cellular organisms → Bacteria → Acidobacteria	682	Open in IMG/M
3300012363\|Ga0137390_10255813	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1736	Open in IMG/M
3300012363\|Ga0137390_11358168	All Organisms → cellular organisms → Bacteria	656	Open in IMG/M
3300012469\|Ga0150984_113829632	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	502	Open in IMG/M
3300012681\|Ga0136613_10547419	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	624	Open in IMG/M
3300012925\|Ga0137419_10753537	All Organisms → cellular organisms → Bacteria	793	Open in IMG/M
3300012927\|Ga0137416_10803668	Not Available	832	Open in IMG/M
3300013297\|Ga0157378_11083810	All Organisms → cellular organisms → Bacteria → Acidobacteria	838	Open in IMG/M
3300013297\|Ga0157378_11678036	All Organisms → cellular organisms → Bacteria → Acidobacteria	682	Open in IMG/M
3300013308\|Ga0157375_11662860	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	755	Open in IMG/M
3300014325\|Ga0163163_10933311	All Organisms → cellular organisms → Bacteria → Acidobacteria	931	Open in IMG/M
3300014326\|Ga0157380_11105806	All Organisms → cellular organisms → Bacteria → Acidobacteria	832	Open in IMG/M
3300014326\|Ga0157380_11673561	All Organisms → cellular organisms → Bacteria → Acidobacteria	693	Open in IMG/M
3300014883\|Ga0180086_1003332	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3071	Open in IMG/M
3300014968\|Ga0157379_10372735	All Organisms → cellular organisms → Bacteria → Acidobacteria	1309	Open in IMG/M
3300015052\|Ga0137411_1202783	All Organisms → cellular organisms → Bacteria → Acidobacteria	967	Open in IMG/M
3300015371\|Ga0132258_10736655	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2483	Open in IMG/M
3300015371\|Ga0132258_11837134	All Organisms → cellular organisms → Bacteria → Acidobacteria	1526	Open in IMG/M
3300015373\|Ga0132257_100827398	All Organisms → cellular organisms → Bacteria	1157	Open in IMG/M
3300015374\|Ga0132255_100781631	All Organisms → cellular organisms → Bacteria → Acidobacteria	1422	Open in IMG/M
3300015374\|Ga0132255_103564604	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	662	Open in IMG/M
3300018054\|Ga0184621_10339718	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	528	Open in IMG/M
3300018061\|Ga0184619_10286145	All Organisms → cellular organisms → Bacteria → Acidobacteria	756	Open in IMG/M
3300018469\|Ga0190270_12294167	All Organisms → cellular organisms → Bacteria → Acidobacteria	601	Open in IMG/M
3300018476\|Ga0190274_12913995	Not Available	574	Open in IMG/M
3300019360\|Ga0187894_10366487	All Organisms → cellular organisms → Bacteria → Acidobacteria	648	Open in IMG/M
3300019767\|Ga0190267_11403438	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	530	Open in IMG/M
3300020016\|Ga0193696_1102297	All Organisms → cellular organisms → Bacteria → Acidobacteria	735	Open in IMG/M
3300021088\|Ga0210404_10562341	Not Available	647	Open in IMG/M
3300021445\|Ga0182009_10728150	All Organisms → cellular organisms → Bacteria → Acidobacteria	539	Open in IMG/M
3300025885\|Ga0207653_10228561	All Organisms → cellular organisms → Bacteria → Acidobacteria	708	Open in IMG/M
3300025893\|Ga0207682_10468426	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	597	Open in IMG/M
3300025903\|Ga0207680_10992088	All Organisms → cellular organisms → Bacteria → Acidobacteria	601	Open in IMG/M
3300025907\|Ga0207645_10066400	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2306	Open in IMG/M
3300025911\|Ga0207654_11235638	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	545	Open in IMG/M
3300025914\|Ga0207671_10049218	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3120	Open in IMG/M
3300025922\|Ga0207646_11534660	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300025922\|Ga0207646_11835904	Not Available	518	Open in IMG/M
3300025927\|Ga0207687_10044541	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3063	Open in IMG/M
3300025936\|Ga0207670_10564607	All Organisms → cellular organisms → Bacteria → Acidobacteria	931	Open in IMG/M
3300025942\|Ga0207689_10322654	All Organisms → cellular organisms → Bacteria → Acidobacteria	1282	Open in IMG/M
3300025942\|Ga0207689_10690394	All Organisms → cellular organisms → Bacteria → Acidobacteria	861	Open in IMG/M
3300025960\|Ga0207651_11627771	All Organisms → cellular organisms → Bacteria → Acidobacteria	582	Open in IMG/M
3300025981\|Ga0207640_12009518	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	524	Open in IMG/M
3300026023\|Ga0207677_10265926	All Organisms → cellular organisms → Bacteria → Acidobacteria	1400	Open in IMG/M
3300026041\|Ga0207639_10026092	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	4243	Open in IMG/M
3300026063\|Ga0208656_1020399	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300026088\|Ga0207641_12413537	All Organisms → cellular organisms → Bacteria → Acidobacteria	525	Open in IMG/M
3300026089\|Ga0207648_10512753	All Organisms → cellular organisms → Bacteria → Acidobacteria	1098	Open in IMG/M
3300026095\|Ga0207676_10393042	All Organisms → cellular organisms → Bacteria → Acidobacteria	1294	Open in IMG/M
3300026095\|Ga0207676_12287654	All Organisms → cellular organisms → Bacteria → Acidobacteria	538	Open in IMG/M
3300026118\|Ga0207675_102360482	Not Available	545	Open in IMG/M
3300026118\|Ga0207675_102381455	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	542	Open in IMG/M
3300026322\|Ga0209687_1096645	All Organisms → cellular organisms → Bacteria → Acidobacteria	960	Open in IMG/M
3300027678\|Ga0209011_1186873	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	570	Open in IMG/M
3300027716\|Ga0209682_10044960	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1066	Open in IMG/M
3300027778\|Ga0209464_10140943	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	843	Open in IMG/M
3300027831\|Ga0209797_10210923	Not Available	824	Open in IMG/M
3300027840\|Ga0209683_10336759	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	694	Open in IMG/M
3300027873\|Ga0209814_10051402	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1720	Open in IMG/M
3300028381\|Ga0268264_10277296	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1569	Open in IMG/M
3300028381\|Ga0268264_10446061	All Organisms → cellular organisms → Bacteria → Acidobacteria	1253	Open in IMG/M
3300028536\|Ga0137415_10381571	All Organisms → cellular organisms → Bacteria → Proteobacteria	1213	Open in IMG/M
3300028578\|Ga0272482_10177270	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	644	Open in IMG/M
3300031731\|Ga0307405_11783935	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	547	Open in IMG/M
3300031740\|Ga0307468_101693536	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	595	Open in IMG/M
3300031911\|Ga0307412_10969838	All Organisms → cellular organisms → Bacteria → Acidobacteria	749	Open in IMG/M
3300031949\|Ga0214473_10066886	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	4203	Open in IMG/M
3300032126\|Ga0307415_100043034	All Organisms → cellular organisms → Bacteria → Acidobacteria	3010	Open in IMG/M
3300033412\|Ga0310810_10997626	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	716	Open in IMG/M
3300034174\|Ga0334932_098208	All Organisms → cellular organisms → Bacteria → Acidobacteria	514	Open in IMG/M
3300034376\|Ga0334923_015430	All Organisms → cellular organisms → Bacteria → Acidobacteria	1576	Open in IMG/M
3300034376\|Ga0334923_131892	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	517	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	53.42%
Host-Associated	Host-Associated	46.58%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	46.58%
Plants	Host-Associated → Plants	46.58%
Aquatic	Environmental → Aquatic	6.85%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	45.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere	26.03%
Rhizoplane	Host-Associated → Plants → Rhizoplane	19.86%
Freshwater	Environmental → Aquatic → Freshwater	4.79%
Sediment	Environmental → Aquatic → Sediment	2.05%
Cave	Environmental → Terrestrial → Cave	0.68%
Roots	Host-Associated → Plants → Roots	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	36.30%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	20.55%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	16.44%
Loam	Environmental → Terrestrial → Soil → Loam	7.53%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.48%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.42%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.74%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.05%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.37%
Soil Crust	Environmental → Terrestrial → Soil → Soil Crust	1.37%
Ice	Environmental → Aquatic → Freshwater → Ice	0.68%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.68%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.68%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	24.66%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	20.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	16.44%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.48%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.42%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	2.74%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.74%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.05%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.37%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.37%
Unclassified	Environmental → Terrestrial → Soil → Soil Crust → Unclassified	1.37%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.68%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.68%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.68%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.68%
Desert	Environmental → Terrestrial → Soil → Unclassified → Desert	0.68%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.68%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.68%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.68%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.68%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.27%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	10.27%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.16%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.79%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.11%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.11%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.42%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.42%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.42%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	2.74%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.74%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.05%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.05%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.05%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.05%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.05%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.37%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.37%
Hypolithic Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust	1.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.37%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.68%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.68%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.68%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.68%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.68%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.68%
Sub-Biocrust Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.68%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.68%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.68%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.68%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.68%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.68%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.68%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2140918007	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all	Environmental	Open in IMG/M
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000574	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300002886	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011332	Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012681	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014883	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015052	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental	Open in IMG/M
3300019767	Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T	Environmental	Open in IMG/M
3300020016	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1	Environmental	Open in IMG/M
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026063	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)	Environmental	Open in IMG/M
3300027678	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)	Environmental	Open in IMG/M
3300027716	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)	Environmental	Open in IMG/M
3300027778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)	Environmental	Open in IMG/M
3300027831	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027840	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028578	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300034174	Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS	Environmental	Open in IMG/M
3300034376	Biocrust microbial communities from Mojave Desert, California, United States - 19HNC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
A_all_C_03469450	2140918007	Soil	GSAAGAATAEDQAAAGHFDQAGRTMLGVANRLTDVLLAMR
ICChiseqgaiiFebDRAFT_140381221	3300000363	Soil	AATAEEQAAANQFDAAGRTLLNVINRLTDVLLAMRS*
JGI1357J11328_100840562	3300000574	Groundwater	ATAEEQAADGHFDQAGRTMLGVVNRLTDVLLAMR*
JGI11643J12802_122627683	3300000890	Soil	AGAATAEQQAAANQFDPAGRTLLTVINRLADVLVIMRQ*
JGI25612J43240_10468962	3300002886	Grasslands Soil	AGVASGAANAEQQAAANQFDAAGRSLLNVVNRLTDVLLAMR*
Ga0062590_1020742451	3300004157	Soil	PFYIKLAGVAAGAATAEEQANANQFDAAGRTLLNVINRLADVLVIMRQ*
Ga0065707_102165021	3300005295	Switchgrass Rhizosphere	YIKLAGVAAGAATAEEQAAANQFDASGRTLLNVINRLTDVLLIMRTTA*
Ga0070677_101042762	3300005333	Miscanthus Rhizosphere	PDLRRYYTRLAGVAAGAAAAEQQAAANQFDRAGRSLLEVVNRLTDVLLEMQR*
Ga0070687_1014430051	3300005343	Switchgrass Rhizosphere	SPDLRRYYTRLAGVAAGAAAAEQQAAANQFDRAGRSLLEVVNRLTDVLLEMQR*
Ga0070675_1003367142	3300005354	Miscanthus Rhizosphere	TPELQRYYIKLAGVAARAANAEDLAAANQFDKAGRNLLEVVNQLTDVLLEMRNR*
Ga0070674_1012315542	3300005356	Miscanthus Rhizosphere	FSSSPDLRRYYTRLAGVAAGAAAAEQQAAANQFDRAGRSLLEVVNRLTDVLLEMQR*
Ga0070701_101094001	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	GVAAGAAAAEQQAAANQFDRAGRSLLEVVNRLTDVLLEMQR*
Ga0070705_1013803881	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	KLAGSAAGAATAEEQAAANQFGASGRTLLNVIYRLTDVLLIMR*
Ga0070694_1019350692	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	PALQRYYIKLAGVAAGAAKAEDLAAANQFDKAGRALLEVVNHLTDVLLAMR*
Ga0070686_1008479631	3300005544	Switchgrass Rhizosphere	KLAGVAAGAATAEEQANANQFDAAGRTLLSVINRLADVLVIMRQ*
Ga0066694_105351561	3300005574	Soil	AGVADGGSKAEQLAAAGQFDQAGRTLLSVINRLTDVLLDMK*
Ga0068857_1019034111	3300005577	Corn Rhizosphere	QPYYIKLAGVAAGAASAEEQAAANQFDAAGRTLLNVINRLTDVLLIMRTTT*
Ga0068857_1024913972	3300005577	Corn Rhizosphere	LQPYYIKLAGVAAGAATAEDLAAKNQFDAAGRQLLNVINRLTDVLLLMRTTA*
Ga0068859_1002729623	3300005617	Switchgrass Rhizosphere	VAAGAATAEEQAAANQFDASGRTLLNVINRLTDVLLLMRTTA*
Ga0068859_1007805651	3300005617	Switchgrass Rhizosphere	AAGAATAEEQANANQFDAAGRTLLNVINRLADVLVIMRQ*
Ga0068859_1019608121	3300005617	Switchgrass Rhizosphere	TAEEQAAANQFDAAGRSLLTVIGRLTDVLVIMRQ*
Ga0068864_1014743972	3300005618	Switchgrass Rhizosphere	GAATAEEQAAANQFDRAGRTLLDVIGRLADVLVIMRQ*
Ga0068863_1002428221	3300005841	Switchgrass Rhizosphere	GVAAGAADAEQKATTEQFDAAGRSLLGVVNRLTDVLLLMRY*
Ga0068860_1014587082	3300005843	Switchgrass Rhizosphere	LQPYYIKLAGVAAGAATAEEQAAANQFDASGRTLLNVINRLTDVLLLMRTTT*
Ga0068862_1000921511	3300005844	Switchgrass Rhizosphere	RYYTRLAGVAAGAAAAEEQAAANQFDRSGRTLIEVVNRLTDVLLEMR*
Ga0068862_1008533482	3300005844	Switchgrass Rhizosphere	SAAGAAKAEDLAAANQFDKAGRALLDVVNHLTDVLLAMR*
Ga0081540_11593082	3300005983	Tabebuia Heterophylla Rhizosphere	AKAEDLAAANQFDKAGRALLEVVNHLTDVLLEMR*
Ga0075417_105677651	3300006049	Populus Rhizosphere	ATAEEQAAANQFDRSGRTLLDVVNRLADVLVIMRQ*
Ga0070716_1010483152	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	ATAEEQAASNQFDAAGRSLLNVINRLTDVLLGMRE*
Ga0066658_103202211	3300006794	Soil	AGVAAGAATAEDQAAGGQYDQAGRSLLNVVNRLTDVLLEMR*
Ga0066665_102030572	3300006796	Soil	GAATAEDQAAAGHFDQAGRTLLGVVNRLTDVLLAMR*
Ga0075428_1012783052	3300006844	Populus Rhizosphere	AAAEERAAANQFDAAGRQLLNVVNRLTDVLLLMRTTE*
Ga0075430_1013263022	3300006846	Populus Rhizosphere	LAGVAAGAAAAEERAAANQFDAAGRQLLNVVNRLTDVLLLMRTTE*
Ga0079217_107057561	3300006876	Agricultural Soil	AAGAATAEEQAGANQFDAAGRSLLNVINRLTDVLLAMR*
Ga0079215_100271213	3300006894	Agricultural Soil	IKLAGVAAGAATADEQAAANQFDAAGRTLLTVINRLTDVLLIMRQ*
Ga0075426_107246992	3300006903	Populus Rhizosphere	IKLAGVAAGAATAEEQAANNQFDGAGRTLLNVVARLADVLVVMRQ*
Ga0079219_101217022	3300006954	Agricultural Soil	VAAGAATAEERAGANQFDAAGRQLLNVVNRLTDVLLLMRTTE*
Ga0075435_1016938251	3300007076	Populus Rhizosphere	PLAGVASGAAKAEEQAAANQFDQAGRTLLDVVNRLTDVLLEMSK*
Ga0099794_104127011	3300007265	Vadose Zone Soil	LEQYYLKLAGSAAGAATAEDQAAAGHFDQAGRTMLGVVNRLTDVLLAMR*
Ga0099795_105607021	3300007788	Vadose Zone Soil	AADAEQQAAANQFDRAGRSLLNVVNRLTDVLLAMRY*
Ga0105251_101181461	3300009011	Switchgrass Rhizosphere	EDLAAKNQFDAAGRQLLNVINRLTDVLLLMRTTA*
Ga0099830_107381911	3300009088	Vadose Zone Soil	KLAGVAAGAADAEQQAAANQFDRAGRSLLNVVNRLTDVLLAMR*
Ga0099828_114483572	3300009089	Vadose Zone Soil	EQYYLKLAGSAAGAATAEDQATAGHFDQAGRTMLGVVNRLTDVLLAMR*
Ga0099827_114718541	3300009090	Vadose Zone Soil	GVAAGAATAEDQAAANQFDKAGRTLLDVINRLTDVLLEMR*
Ga0105245_108534682	3300009098	Miscanthus Rhizosphere	LQPYYIKLAGVAAGAATAEEQANANQFDAGGRTLLNVINRLADVLVIMRQ*
Ga0075418_113317991	3300009100	Populus Rhizosphere	AATAEQQAANNQFDAAGRSLLGVINRLTDVLLIMR*
Ga0105247_107967222	3300009101	Switchgrass Rhizosphere	YYIKLAGVAAGAATAEEQANTNQFDAGGRTLLNVINRLADVLVIMRQ*
Ga0114129_134211121	3300009147	Populus Rhizosphere	KLAGVASGAATAEELAAKNQFDASGRQLLNVINRLTDVLLLIRTTT*
Ga0105243_103681743	3300009148	Miscanthus Rhizosphere	AGVAAGAAKAEELAARNQFDQAGRSLLGVVNQLTDVLVVMR*
Ga0075423_123053511	3300009162	Populus Rhizosphere	LAGSADGAANAENFAAAGQFDRAGRTLLDVVNRLTDTLAIMR*
Ga0105241_108135632	3300009174	Corn Rhizosphere	GAAAAEERANVNEYDAGGRTLLNVINRLADVLVIMRQ*
Ga0105242_104352982	3300009176	Miscanthus Rhizosphere	YLKLAGSAEGAAAAENLAASGRFDQAGRALLGVVNRLADTLVSMRQP*
Ga0105237_102011913	3300009545	Corn Rhizosphere	AAGAATAEEQANANQFDAAGRTLLSVINRLADVLVIMRQ*
Ga0126314_100574463	3300010042	Serpentine Soil	QPFYIKLAGVAAGAATAEEQANANQFDAGGRTLLNVINRLADVLVIMRQ*
Ga0126310_115872212	3300010044	Serpentine Soil	AATAEEQAAANQFDASGRTLLNVINRLTDVLVVMRQ*
Ga0126310_118520122	3300010044	Serpentine Soil	ADAEDQAAANRFDQAGRTLLNVVNRLTDVLLEMR*
Ga0126311_100374574	3300010045	Serpentine Soil	YYIKLAGVAAGAATAEERAAANQFDAAGRQLLNVVNRLTDVLLLMRTTE*
Ga0126311_111675432	3300010045	Serpentine Soil	AAGAAAAEDQAAANQFDQAGRSLLNVVNRLTDVLLEMR*
Ga0126376_104125071	3300010359	Tropical Forest Soil	QPYYIKLAGSAAGAATAEEQAAANQFDAAGRSLLNVINRLTDVLLIMRQ*
Ga0126372_129243631	3300010360	Tropical Forest Soil	GAADAEALANQGQFDRAGRALLGVVNRLTDVLVIMP*
Ga0105239_103135241	3300010375	Corn Rhizosphere	GAATAEERAAANQFDAAGRQLLNVVNRLTEVLLLMRTTE*
Ga0105239_134670611	3300010375	Corn Rhizosphere	GAAKAEDLAAANQFDKAGRALLDVVNHLTDVLLAMR*
Ga0134124_109261382	3300010397	Terrestrial Soil	QPYYIKLAGVAAGAAAAEERAAANKFDDAGRQLLNVVNRLTDVLLLMRTTE*
Ga0134127_101877711	3300010399	Terrestrial Soil	ATAEELANANQFDAAGRTLLNVINRLADVLVIMRQ*
Ga0134122_112325482	3300010400	Terrestrial Soil	VAAGAATAEQQATNNQFDAAGRQLLLVVNRLADVLVVMRM*
Ga0134122_118198371	3300010400	Terrestrial Soil	KLAGVAAGAATAEEQAAANQFDRAGRTLLDVIGRLADVLVIMRQ*
Ga0134121_106897612	3300010401	Terrestrial Soil	GVAARAASAEELAAANQFDKAGRSLLEVVNQLTDVLLEMR*
Ga0134121_108350462	3300010401	Terrestrial Soil	DFRTTPALQRYYIKLAGVAAGAAKAEDLAAANQFDKAGRALLDVVNHLTDVLLAMR*
Ga0134121_110205582	3300010401	Terrestrial Soil	KLAGVAAGAAAAEQQATNNQFDAAGRSLLLVVNRLADVLVVMRM*
Ga0137392_108840281	3300011269	Vadose Zone Soil	ANAEAQAAAGHFDQAGRTLLGVVNRLTDVLVLMR*
Ga0126317_103418022	3300011332	Soil	YIKLAGVAAGAATAEEQAAKNQFDASGRTLLNVINRLTDVLLLMRTTT*
Ga0137364_112643541	3300012198	Vadose Zone Soil	LNRYYIPLAGVASGAARAEEQAGANQFDQAGRTLLEVVNRLTDVLLEMTR*
Ga0137363_110461421	3300012202	Vadose Zone Soil	ATAEDQAAAGHFDQAGRTMLGVVNRLTDVLLVMR*
Ga0137361_111991141	3300012362	Vadose Zone Soil	AAGAADAEQQAAANQFDRAGRSLLNVVNRLTDVLLAMR*
Ga0137390_102558131	3300012363	Vadose Zone Soil	VAESAAIAEDQAAANKFDQAGRSLLGVVNRLTDVLLAMR*
Ga0137390_113581682	3300012363	Vadose Zone Soil	SGAADSEAQAGAGHFDQAGRTLLGVVNRLTDVLVLMR*
Ga0150984_1138296321	3300012469	Avena Fatua Rhizosphere	LRYYTTLAGVAAGAATAEDQAAAGQYEQAGRSLLGVVNRLTDVLLAMR*
Ga0136613_105474192	3300012681	Polar Desert Sand	DFRTKPELLRYYTKLAGAASGAAAAEEQAAASQFDQAGRSLLGVVNRLTDVLLEIGK*
Ga0137419_107535371	3300012925	Vadose Zone Soil	ERRRTRAAAAVSPADAEAQAAAGHFDQAGRTMLGVVNRLTDVLLVMR*
Ga0137416_108036681	3300012927	Vadose Zone Soil	GVAAEAAAAEEQAAQNQFDKAGRTLLGVVNHLTDALLEMH*
Ga0157378_110838101	3300013297	Miscanthus Rhizosphere	KLAGVAAGAATAEEQANAGQFDASGRTLLNVINRLADVLVVMRQ*
Ga0157378_116780361	3300013297	Miscanthus Rhizosphere	YYIKLAGVAAGAADAEQKATTEQFDAAGRSLLGVVNRLTDVLLLMRY*
Ga0157375_116628601	3300013308	Miscanthus Rhizosphere	IKLAGSAAGAAKAEDLAAANQFDKAGRALLDVVNHLTDVLLAMR*
Ga0163163_109333111	3300014325	Switchgrass Rhizosphere	AGTATAEQQAGNNQFDAAGRSLLNVVNRLTDVLFAMRQ*
Ga0157380_111058062	3300014326	Switchgrass Rhizosphere	PELQPFYIKLAGVAAGAATAEEQANANQFDAAGRTLLNVINRLADVLVIMRQ*
Ga0157380_116735611	3300014326	Switchgrass Rhizosphere	AGVAAGAADAEQKAAANQFDPAARSLLQVVNRLSDVLALM*
Ga0180086_10033323	3300014883	Soil	RTTPELQRHYIKLAGVALGAATAEDQAAADQFDKAGRTLLEVVNHLTDVLLEMR*
Ga0157379_103727351	3300014968	Switchgrass Rhizosphere	IKLAGVAAGAAAAEEQAAANQFDRSGRTLLDVVNRLADVLVIMRQ*
Ga0137411_12027832	3300015052	Vadose Zone Soil	TTPELQRYYIKLAGVAAGAATAEEEAAANQFDKAGRTLLEVVNHLTDVLLEMR*
Ga0132258_107366551	3300015371	Arabidopsis Rhizosphere	LAGVAAGTATAEQQAGNNQFDAAGRSLLNVVNRLTDVLFAMRQ*
Ga0132258_118371342	3300015371	Arabidopsis Rhizosphere	LQPYYIKLAGVADGAASAEQLAASNQFDAAGRQLLGVVNRLADVLVIMRQ*
Ga0132257_1008273981	3300015373	Arabidopsis Rhizosphere	AEGAATAENLAASGRFDQAGRTMLGVANRLTDVLLIMR*
Ga0132255_1007816311	3300015374	Arabidopsis Rhizosphere	AAGAATAEEQANGNQFDASGRTLLNVINRLTDVLVIMRQ*
Ga0132255_1035646042	3300015374	Arabidopsis Rhizosphere	GVAAGTAKAEDQAAANQFDQAGRTMLEVVNRLTDVLLEMP*
Ga0184621_103397182	3300018054	Groundwater Sediment	AGVAARAATAEDLAAANQFDKAGRTLLEVVNHLADVLLEMR
Ga0184619_102861452	3300018061	Groundwater Sediment	RYYIKLAGVAAGAASAEDQAAANQFDKAGRTLLDVVNHLTDVLLEMR
Ga0190270_122941671	3300018469	Soil	AAGAAKAEELAARNQFDQAGRTLLEVVNRLTDVLLDMR
Ga0190274_129139952	3300018476	Soil	AGVAAGAAKAEDLAARNQFDQAGRSLLEVVNRLTDVLLAMR
Ga0187894_103664872	3300019360	Microbial Mat On Rocks	QPYYIKLAGSAAGAAKAEEQAAAGQYDAGGRTLLTVINRLTDVLLAMRQ
Ga0190267_114034381	3300019767	Soil	TPELQRYYIKLAGSAAGASNADDQAAANQFDKAGRTLLEVVNRLTDVLLEMR
Ga0193696_11022971	3300020016	Soil	IDFRTTPELQRYYIKLAGVASGAANAEDLAAANQFDKAGRTLLGVVNQLTDVLLEMR
Ga0210404_105623412	3300021088	Soil	QYYLKLAGSAAGAAAAEDQAAAGHFDQAGRTMLGVVNRLTDVLLAMR
Ga0182009_107281502	3300021445	Soil	SASGAAAAEEQAAANQFDAAGRTLLNVINRLTDVLLVMRQ
Ga0207653_102285612	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	ATPELQRYYIKLAGVAAGAANAEDLAAANQFDKAGRALLEVVNHLTDVLLEMR
Ga0207682_104684261	3300025893	Miscanthus Rhizosphere	TRLAGVAAGAAAAEQQAAANQFDRAGRSLLEVVNRLTDVLLEMQR
Ga0207680_109920881	3300025903	Switchgrass Rhizosphere	GAANAEDQAAANQFDKAGRTLLEVVNRLTDVLLEMR
Ga0207645_100664003	3300025907	Miscanthus Rhizosphere	AAGAASAEEKAAANQFDEAGRLLLNVINRLADVLVVMRQ
Ga0207654_112356382	3300025911	Corn Rhizosphere	LAGVAAGAAKAEDLAAANQFDKAGRALLEVVNHLTDVLLAMR
Ga0207671_100492184	3300025914	Corn Rhizosphere	AGAAAAEEKAGANQFDAAGRQLLNVVNRLTDVLLLMRTTD
Ga0207646_115346602	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	GSAAGAATAEDQAAAGHFDQAGRTLLDVVTRLTDVLLAMR
Ga0207646_118359041	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	AATAEDQAAAGHFDQAGRTMLGVVNRLTDVLLVMR
Ga0207687_100445411	3300025927	Miscanthus Rhizosphere	AADAEQKATTEQFDAAGRSLLGVVNRLTDVLLLMRY
Ga0207670_105646071	3300025936	Switchgrass Rhizosphere	LQPYYIKLAGVAAGAADAEQKATTEQFDAAGRSLLGVVNRLTDVLLLMRY
Ga0207689_103226541	3300025942	Miscanthus Rhizosphere	GVAAGAATAADLAAKNQFDAAGRQLLNVINKLTDVLLLMRTTA
Ga0207689_106903942	3300025942	Miscanthus Rhizosphere	AGAATAEELAAANQFDRAGRSLLGVINRLTDVLLLMRTIE
Ga0207651_116277712	3300025960	Switchgrass Rhizosphere	YIKLAGVASGAATAEDLAAKNQFDAAGRQLLNVINRLTDVLLLMRTTT
Ga0207640_120095182	3300025981	Corn Rhizosphere	AAGAATAEEQAAANQFDASGRTLLNVINRLTDVLLLMRTTA
Ga0207677_102659261	3300026023	Miscanthus Rhizosphere	AAGAADAEQKATTEQFDAAGRSLLGVVNRLTDVLLLMRY
Ga0207639_100260921	3300026041	Corn Rhizosphere	ADGAATAEQQAAANQFDAAGRSLLNVISRLTDVLVVMRQ
Ga0208656_10203992	3300026063	Natural And Restored Wetlands	ATAEEQAAVNQFDAAGRSLLNVIGRLADVLVVMRQ
Ga0207641_124135371	3300026088	Switchgrass Rhizosphere	QPFYIKLAGVAAGAATAEEQANANQFDAAGRTLLNVINRLADVLVIMRQ
Ga0207648_105127532	3300026089	Miscanthus Rhizosphere	ATAEEQANANQFDAAGRTLLTVINRLADVLVIMRQ
Ga0207676_103930422	3300026095	Switchgrass Rhizosphere	PYYIKLAGVAAGAATAEEQANANQFDAAGRTLLSVINRLADVLVIMRQ
Ga0207676_122876542	3300026095	Switchgrass Rhizosphere	LAGSAAGAAKAEELAAGAQYDAGGRTLLTVINRLTDVLVIMRQ
Ga0207675_1023604821	3300026118	Switchgrass Rhizosphere	ELTIHYTQLAGVAAAAAKAEDLAARNQFDQAGRTLLGVVNQLTDVLLDMR
Ga0207675_1023814552	3300026118	Switchgrass Rhizosphere	LSGVALQAGNAEDQAASNQFDKAGRTLLEVVNQLTDALLDIR
Ga0209687_10966452	3300026322	Soil	AATAEQQAAANQFDASGRTLLNVINRLTDVLVVMRQ
Ga0209011_11868731	3300027678	Forest Soil	FRATPELQRYYIKLAGVAAGAASAEDQASANQFDKAGRTLLDVVNHLTDVLLEMR
Ga0209682_100449601	3300027716	Wetland Sediment	FRATPTLVAYYYKLAGVADGAAKAEQLAAANQFDQAGRTLLNVVNRLTDVLLDMK
Ga0209464_101409431	3300027778	Wetland Sediment	YYKLAGVADGAAKAEQLAAANQFDQAGRTLLNVVNRLTDVLLDMK
Ga0209797_102109231	3300027831	Wetland Sediment	LQRYYISLAGVAQGASTAEEQAAENKFDQAGRSLLSVVNRLTDVLLGMR
Ga0209683_103367591	3300027840	Wetland Sediment	RLAGSAQGAATAEDEAAAGQFDKSGRTLLTVVNRLTDVLLEMR
Ga0209814_100514023	3300027873	Populus Rhizosphere	LAGMAAGAATAEEQAAANQFDRSGRTLLDVVNRLADVLVIMRQ
Ga0268264_102772963	3300028381	Switchgrass Rhizosphere	AGAASAEEKAAANQFDEAGRLLLNVINRLADVLVVMRQ
Ga0268264_104460612	3300028381	Switchgrass Rhizosphere	AEEQAAANQFDRAGRSLLGVINRLTDVLLLMRTTE
Ga0137415_103815714	3300028536	Vadose Zone Soil	GVAAEAAAAEEQAAQNQFDKAGRTLLGVVNHLTDALLEMH
Ga0272482_101772701	3300028578	Soil	NLEIDFRTKPELLRYYTKLAGVAAGAAAAEEQAAANQFDQAGRLLLNVVNRLTDVLLEMR
Ga0307405_117839351	3300031731	Rhizosphere	AAGAATAETQAANNQFDAAGRTLLGVVNRLTDVLLIIR
Ga0307468_1016935361	3300031740	Hardwood Forest Soil	SGVALEAGNAEDQAAANQFDKAGRTLLEVVNQLTDTLLDMH
Ga0307412_109698382	3300031911	Rhizosphere	GSAAGAATAEEQAAQSQFERSGRTLLGVINRLTDVLLLMRTTE
Ga0214473_100668864	3300031949	Soil	AGVASGAATAEEQAAANQFDKAGRTLLEVVNHLTDVLLEMR
Ga0307415_1000430344	3300032126	Rhizosphere	GVAAGAASAEEQAAANQFDAAGRTLLNVINRLTDVLVVMRQ
Ga0310810_109976262	3300033412	Soil	YYIKLAGVAAGAAKAEDLAAANQFDKAGRALLDVVNHLTDVLLAMR
Ga0334932_098208_359_514	3300034174	Sub-Biocrust Soil	PDLLRYYTKLAGVAAGAANAEEQAAANQFDQAGRSLLGVVNRLTDVLLEMR
Ga0334923_015430_1406_1576	3300034376	Hypolithic Biocrust	HFRTTPELERFSLRLSGVALGAANAEQQASANRLDAAGRSLLEVINRLTDVLQEMH
Ga0334923_131892_2_115	3300034376	Hypolithic Biocrust	AGAATAEEQANAGRYDQAGRSLISVVNRLTDVLLEMR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.67
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.67
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F049863

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign