NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049975

Metagenome / Metatranscriptome Family F049975

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049975
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 59 residues
Representative Sequence TARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL
Number of Associated Samples 127
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 84.93 %
% of genes from short scaffolds (< 2000 bps) 90.41 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.041 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.973 % of family members)
Environment Ontology (ENVO) Unclassified
(20.548 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.041 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 24.42%    Coil/Unstructured: 75.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF11706zf-CGNR 13.70
PF02687FtsX 9.59
PF03704BTAD 6.85
PF00456Transketolase_N 4.79
PF06026Rib_5-P_isom_A 4.79
PF06224HTH_42 4.11
PF02366PMT 3.42
PF01872RibD_C 3.42
PF00892EamA 2.74
PF00486Trans_reg_C 2.74
PF00378ECH_1 1.37
PF03869Arc 1.37
PF13751DDE_Tnp_1_6 1.37
PF13561adh_short_C2 0.68
PF00196GerE 0.68
PF05598DUF772 0.68
PF04542Sigma70_r2 0.68
PF03473MOSC 0.68
PF04286DUF445 0.68
PF09656PGPGW 0.68
PF04264YceI 0.68
PF03176MMPL 0.68
PF02274ADI 0.68
PF08592Anthrone_oxy 0.68
PF07702UTRA 0.68
PF02779Transket_pyr 0.68
PF02133Transp_cyt_pur 0.68
PF13424TPR_12 0.68
PF07690MFS_1 0.68
PF04545Sigma70_r4 0.68
PF08282Hydrolase_3 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 6.85
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 6.85
COG0021TransketolaseCarbohydrate transport and metabolism [G] 4.79
COG0120Ribose 5-phosphate isomeraseCarbohydrate transport and metabolism [G] 4.79
COG3959Transketolase, N-terminal subunitCarbohydrate transport and metabolism [G] 4.79
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 4.11
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 3.42
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 3.42
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.68
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.68
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.68
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.68
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.68
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.68
COG1834N-Dimethylarginine dimethylaminohydrolaseAmino acid transport and metabolism [E] 0.68
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.68
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.68
COG2235Arginine deiminaseAmino acid transport and metabolism [E] 0.68
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.68
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.68
COG2733Uncharacterized membrane-anchored protein YjiN, DUF445 familyFunction unknown [S] 0.68
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.68
COG4399Uncharacterized membrane protein YheB, UPF0754 familyFunction unknown [S] 0.68
COG4874Uncharacterized conserved proteinFunction unknown [S] 0.68
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.04 %
UnclassifiedrootN/A10.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_147471All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300005179|Ga0066684_11128612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kyorinense500Open in IMG/M
3300005330|Ga0070690_100287690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1175Open in IMG/M
3300005344|Ga0070661_101101648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300005345|Ga0070692_11345357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300005434|Ga0070709_10848625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria719Open in IMG/M
3300005434|Ga0070709_11188534All Organisms → cellular organisms → Bacteria → Terrabacteria group612Open in IMG/M
3300005434|Ga0070709_11767938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae505Open in IMG/M
3300005435|Ga0070714_101599386All Organisms → cellular organisms → Bacteria → Terrabacteria group637Open in IMG/M
3300005436|Ga0070713_101429386Not Available671Open in IMG/M
3300005437|Ga0070710_10435518Not Available885Open in IMG/M
3300005457|Ga0070662_100231978All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300005459|Ga0068867_100863937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia811Open in IMG/M
3300005471|Ga0070698_101195281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300005542|Ga0070732_10745755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300005712|Ga0070764_10369974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura hibisca841Open in IMG/M
3300005719|Ga0068861_101836139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300005764|Ga0066903_101457088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1290Open in IMG/M
3300005764|Ga0066903_102233957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1056Open in IMG/M
3300006028|Ga0070717_10433897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1183Open in IMG/M
3300006028|Ga0070717_11339479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300006163|Ga0070715_10093502All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300006175|Ga0070712_101850204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300006175|Ga0070712_102030801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae503Open in IMG/M
3300006755|Ga0079222_12605635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300006854|Ga0075425_100393933All Organisms → cellular organisms → Bacteria1595Open in IMG/M
3300009137|Ga0066709_101743043Not Available879Open in IMG/M
3300009176|Ga0105242_10394780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1289Open in IMG/M
3300009177|Ga0105248_10890260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1005Open in IMG/M
3300009520|Ga0116214_1048444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1540Open in IMG/M
3300009520|Ga0116214_1436343Not Available513Open in IMG/M
3300009553|Ga0105249_12789478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300010303|Ga0134082_10069450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1369Open in IMG/M
3300010339|Ga0074046_10505640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium721Open in IMG/M
3300010359|Ga0126376_12288208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300010373|Ga0134128_11293287Not Available804Open in IMG/M
3300010375|Ga0105239_10364158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1633Open in IMG/M
3300010376|Ga0126381_104724425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300010397|Ga0134124_12830498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300010401|Ga0134121_10396969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1245Open in IMG/M
3300010401|Ga0134121_11709880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia653Open in IMG/M
3300011120|Ga0150983_11788462All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300012209|Ga0137379_11537161Not Available566Open in IMG/M
3300012351|Ga0137386_10493141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia882Open in IMG/M
3300012356|Ga0137371_10684837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia785Open in IMG/M
3300012357|Ga0137384_10190199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1718Open in IMG/M
3300012517|Ga0157354_1063832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300012961|Ga0164302_10522794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300012971|Ga0126369_11449842Not Available776Open in IMG/M
3300012987|Ga0164307_10101823All Organisms → cellular organisms → Bacteria1799Open in IMG/M
3300012988|Ga0164306_10215902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1355Open in IMG/M
3300013100|Ga0157373_10901373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300014969|Ga0157376_12626881All Organisms → cellular organisms → Bacteria → Terrabacteria group543Open in IMG/M
3300015372|Ga0132256_103674538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300016404|Ga0182037_11347526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300016445|Ga0182038_11906685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300017792|Ga0163161_10182429All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300017821|Ga0187812_1049982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1411Open in IMG/M
3300017821|Ga0187812_1074211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1127Open in IMG/M
3300017926|Ga0187807_1048228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1320Open in IMG/M
3300017926|Ga0187807_1121818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium826Open in IMG/M
3300017932|Ga0187814_10108983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1024Open in IMG/M
3300017942|Ga0187808_10469502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300017943|Ga0187819_10652434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii595Open in IMG/M
3300017974|Ga0187777_10885155All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300018060|Ga0187765_10104763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1546Open in IMG/M
3300018060|Ga0187765_11116809All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300020579|Ga0210407_10271060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1324Open in IMG/M
3300021088|Ga0210404_10442079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae731Open in IMG/M
3300021171|Ga0210405_10288958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1296Open in IMG/M
3300021178|Ga0210408_11064309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii623Open in IMG/M
3300021178|Ga0210408_11222281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300021388|Ga0213875_10178119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia998Open in IMG/M
3300021403|Ga0210397_10147675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1640Open in IMG/M
3300021405|Ga0210387_10543047All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300021474|Ga0210390_10394756All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300021478|Ga0210402_10719288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria922Open in IMG/M
3300021478|Ga0210402_11726072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae552Open in IMG/M
3300022529|Ga0242668_1046392All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300022718|Ga0242675_1039936All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300024331|Ga0247668_1028026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1159Open in IMG/M
3300025898|Ga0207692_10304225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia971Open in IMG/M
3300025898|Ga0207692_10338672All Organisms → cellular organisms → Bacteria → Terrabacteria group925Open in IMG/M
3300025898|Ga0207692_10354445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria905Open in IMG/M
3300025915|Ga0207693_10010775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba7422Open in IMG/M
3300025915|Ga0207693_10410300All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300025916|Ga0207663_11354843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300025917|Ga0207660_10504560Not Available982Open in IMG/M
3300025920|Ga0207649_10990662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300025922|Ga0207646_10414674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1216Open in IMG/M
3300025933|Ga0207706_10245484All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300026035|Ga0207703_11107486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300026118|Ga0207675_100390082All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300026308|Ga0209265_1054011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1233Open in IMG/M
3300026552|Ga0209577_10726793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300027029|Ga0208731_1001512All Organisms → cellular organisms → Bacteria1878Open in IMG/M
3300027030|Ga0208240_1001197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2728Open in IMG/M
3300027058|Ga0209111_1014500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300027855|Ga0209693_10569703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300027884|Ga0209275_10279429Not Available922Open in IMG/M
3300027905|Ga0209415_10091174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3416Open in IMG/M
3300030007|Ga0311338_11852911All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300030503|Ga0311370_11964789All Organisms → cellular organisms → Bacteria → Terrabacteria group586Open in IMG/M
3300031057|Ga0170834_109727830Not Available616Open in IMG/M
3300031236|Ga0302324_102741994All Organisms → cellular organisms → Bacteria → Terrabacteria group594Open in IMG/M
3300031525|Ga0302326_10423998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2051Open in IMG/M
3300031543|Ga0318516_10851041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300031545|Ga0318541_10592099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300031549|Ga0318571_10358019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300031573|Ga0310915_10522020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii843Open in IMG/M
3300031679|Ga0318561_10080856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1682Open in IMG/M
3300031681|Ga0318572_10035067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2633Open in IMG/M
3300031681|Ga0318572_10070955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1917Open in IMG/M
3300031682|Ga0318560_10022143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2921Open in IMG/M
3300031708|Ga0310686_101281445All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300031716|Ga0310813_12005286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300031718|Ga0307474_10512041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria942Open in IMG/M
3300031719|Ga0306917_11070379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300031751|Ga0318494_10844289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300031765|Ga0318554_10542197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia657Open in IMG/M
3300031768|Ga0318509_10109855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1494Open in IMG/M
3300031771|Ga0318546_10364006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinocorallia → Actinocorallia herbida1007Open in IMG/M
3300031795|Ga0318557_10209720All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300031821|Ga0318567_10087338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1671Open in IMG/M
3300031897|Ga0318520_10017878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3310Open in IMG/M
3300031910|Ga0306923_10350953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1682Open in IMG/M
3300031947|Ga0310909_10094323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2396Open in IMG/M
3300032001|Ga0306922_11888993Not Available585Open in IMG/M
3300032009|Ga0318563_10380302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium764Open in IMG/M
3300032043|Ga0318556_10739958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300032063|Ga0318504_10570700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300032066|Ga0318514_10639138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300032068|Ga0318553_10772794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300032261|Ga0306920_101416406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium996Open in IMG/M
3300032261|Ga0306920_103175823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300032783|Ga0335079_10036965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5609Open in IMG/M
3300032893|Ga0335069_10860614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1016Open in IMG/M
3300032954|Ga0335083_11509174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii510Open in IMG/M
3300033134|Ga0335073_11388088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M
3300033134|Ga0335073_11840563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii563Open in IMG/M
3300034819|Ga0373958_0116824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere13.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.74%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.05%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.05%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.05%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.05%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.68%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.68%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.68%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.68%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027029Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes)EnvironmentalOpen in IMG/M
3300027030Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes)EnvironmentalOpen in IMG/M
3300027058Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_027018602199352024SoilDNRVLTARGSRLLVQAPTDCIGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL
Ga0066684_1112861213300005179SoilQAPTDCTGSVSLLWYDPGTRAEQWLIRAPGNVIGVASAVPFYGRQNGNL*
Ga0070690_10028769023300005330Switchgrass RhizosphereTTDDNRVLTARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL*
Ga0070661_10110164813300005344Corn RhizosphereTARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL*
Ga0070692_1134535723300005345Corn, Switchgrass And Miscanthus RhizosphereRVLTARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL*
Ga0070709_1084862513300005434Corn, Switchgrass And Miscanthus RhizosphereTEGDNVVLTATGSRLLVQAPTSCVGSNSLLWYNPGTHAEQWLIRAPSKVIGVENAVPFYSRQNGTM*
Ga0070709_1118853423300005434Corn, Switchgrass And Miscanthus RhizosphereRVLTARGSRLLIQAPTDCTGSNSLLWYDPGTRAEQWLIRPKGNVIGVANAIPFYSRQNGNL*
Ga0070709_1176793823300005434Corn, Switchgrass And Miscanthus RhizosphereRVLTARGSRLLIQAPTDCTGSNSLLWYDPGTRAEQWLIRPKGNVIGVANAIPFYSRQNGDL*
Ga0070714_10159938623300005435Agricultural SoilVRHTSGDNRVLTARGSRLLVQAPTDCTGSVSLLWYDPGTRAEQWLIRAPGKVLGVANAVPFYSRQNGNL*
Ga0070713_10142938613300005436Corn, Switchgrass And Miscanthus RhizosphereHTNGDNRVLTARGSRLLVQAPTDCTGSVSLLWYDPAKRAEQWLIRAPGNVIGVAIAVPFYSRQNGDL*
Ga0070710_1043551823300005437Corn, Switchgrass And Miscanthus RhizosphereLLIQAPTDCTGSNSLLWYDPGTRAEQWLIRPKGNVIGVANAIPFYSRQNGNL*
Ga0066687_1037947613300005454SoilPTDCTGSVSLLWYNPGTQAEQWLIRPPGRVIGVTVAVPFYSRQNGNL*
Ga0070662_10023197813300005457Corn RhizosphereSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL*
Ga0068867_10086393713300005459Miscanthus RhizosphereSRLLVQAPSECTGSVSLLWFNPATRAEQWLIRSPAHVIGVTVAIPFYSRQNGNL*
Ga0070698_10119528123300005471Corn, Switchgrass And Miscanthus RhizosphereLLVQAPTDCIGSVSLLWYNPATQAEQWLIRPPAHVIGVTVAIPFYSRQNGNL*
Ga0070732_1074575523300005542Surface SoilARLLIQAPTSCTGSVSLLWFDPGTGAEQWLVRTPSTAHGVVVAVPFYSRENGNL*
Ga0070764_1036997423300005712SoilGSRLLIQAPTSCTGSVSLLWFNPATHAEQWLIRAPAKVNGVAIAIPFYAREDGSL*
Ga0068861_10183613913300005719Switchgrass RhizosphereHTSGDNRVLTARGSRLLVQAPSECTGSVSLLWFNPATRAEQWLIRPPAHVIGVTIAIPFYSRQNGNL*
Ga0066903_10145708823300005764Tropical Forest SoilGSRLLIQAPTSCTGSNSLLWFNPATHAEQWLIRAPHNVIGVAAAIPFYSRQNGNL*
Ga0066903_10223395723300005764Tropical Forest SoilVTHHPGGCRLLIQAPTDCTGSVSLLWYDPGKRTEQWLIRAPRNVLGVANAIPFYSRQNGNL*
Ga0070717_1043389713300006028Corn, Switchgrass And Miscanthus RhizosphereARGSRLLVEAPTDCTGSVSLLWYNPGTGAEQWLIRPKGNVLGVASAVPFYSRQNGDL*
Ga0070717_1133947913300006028Corn, Switchgrass And Miscanthus RhizosphereVLTARGSRLLVQAPTDCIGGVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGN
Ga0070715_1009350213300006163Corn, Switchgrass And Miscanthus RhizosphereRGSRLLVQAPTDCTGSVSLLWYNPATQGEQWLIRPPAHVIGVTVAIPFYSRQNGNL*
Ga0070712_10185020413300006175Corn, Switchgrass And Miscanthus RhizospherePHTSGDNRVLTARGSRLLVQAPSECTGSVSLLWYNPATRAEQWLIRPPAHVIGVTVAIPFYNRQNGNL*
Ga0070712_10203080123300006175Corn, Switchgrass And Miscanthus RhizosphereSGDNRVLTARGSRLLVQAPTDCIGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL*
Ga0079222_1260563513300006755Agricultural SoilTSGDNRVLTARGSRLLVQAPTDCIGGVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL*
Ga0075425_10039393333300006854Populus RhizosphereQAPTDCTGSVSLLWYNPGTQAEQWLIRPPAHVIGVTVAVPFYSRQNGNL*
Ga0066709_10174304323300009137Grasslands SoilVPHTNGDNRVLTARGSGLLVQAPTDCTGSVSLLWYDPGTRAEQWLIRAPGNVLGVASAVPFYTRQNGNL*
Ga0105242_1039478013300009176Miscanthus RhizosphereNRVLTARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL*
Ga0105248_1089026013300009177Switchgrass RhizosphereSGDNRVLSARGFRLLVQAPTDCTGSVSLLWYNPATEAEQWLIRPPAHVIGVTVAIPFYSRQNGNL*
Ga0116214_104844433300009520Peatlands SoilVLTTLGSRLLIQAPTSCTGSVSLVWFNPATQAEQWLIRAPANVTGAAIAIPFYSRENGNL
Ga0116214_143634313300009520Peatlands SoilTMGDNRVLTALGSRLLIQAPTSCTGSVSLVWFDPATRAEQWLIRAPGNATGAAIAIPFYSRENGNL*
Ga0105249_1278947813300009553Switchgrass RhizosphereTAPHTSGDNRVLTARGSRLLVQAPSECTGSVSLLWYNPATRAEQWLIRPPAHVIGVTIAIPFYSRQNGNL*
Ga0134082_1006945013300010303Grasslands SoilTARGSRLLVEAPTDCTGSVSLLWYDPGTRAEQWLIRAPGNVIGVANAVPFYSRQNGDL*
Ga0074046_1050564023300010339Bog Forest SoilMGDNRVLTALGSRLLIQAPTSCTGSVSLLWLDPATRAEQWLIRAPGNVTGAAIAIPFYSRENGNL*
Ga0126376_1228820823300010359Tropical Forest SoilASASRLLIQAPTSCVGSNSLLWYNPATHAEQWLIRAPSNVIGVENAVPFYSRQNGNM*
Ga0134128_1129328723300010373Terrestrial SoilSRLLIQAPTDCTGSNSLLWYDPGTRAEQWLIRPKGNVIGVANAIPFYSRQNGNL*
Ga0105239_1036415813300010375Corn RhizosphereNRVLTARGSRLLVQAPSECTGSVSLLWYNPATRAEQWLIRPPAHVIGVTIAIPFYSRQNGNL*
Ga0126381_10472442513300010376Tropical Forest SoilQGSRLLIQAPTSCLGSNSLLWFDPATRAEQWLIRAPANELGAAIAIPFYSRENGNL*
Ga0134124_1283049823300010397Terrestrial SoilVRHTSGDNRVLTARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNG
Ga0134121_1039696913300010401Terrestrial SoilLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL*
Ga0134121_1170988023300010401Terrestrial SoilGSRLLIQAPTSCVGSNSLLWYNPGTHAEQWLIRAPSKVIGVENAVPFYSRQNGNM*
Ga0150983_1178846213300011120Forest SoilGDNDVLTAFGARLLIQAPTSCIGSNSLLWFNPATHAEQWLIRAPANQIGVTVAIPFYSREDGNL*
Ga0137379_1153716113300012209Vadose Zone SoilTARGSRLLIQAPTDCTGSNSLLWYDPGTHAEQWLIQPKGNVIGVANAIPFYSRQNGDL*
Ga0137378_1022029433300012210Vadose Zone SoilTDCTGSVSLLWYDPGTRAEPWLIRAPGNVLGVANAVPFYTRQNGNL*
Ga0137386_1049314113300012351Vadose Zone SoilGDNRVLTARGSRLLVEAPTDCTGSVSLLWYDPGTRAEQWLIRPKGNVLGVADAVPFYSRQNGDL*
Ga0137371_1068483713300012356Vadose Zone SoilARGSRLLVEAPTECTGSVSLLWYDPGTRAEQWLIRPKGNVLGVANAVPFYSRQNGDL*
Ga0137384_1019019933300012357Vadose Zone SoilRLLVEAPTDCTGSVSLLWYDPGTRAEQWLIRPKGNVLGVANAVPFYSRQNGDL*
Ga0157354_106383213300012517Unplanted SoilRGSRLLVQAPTDCIGSVSLLWYNPATQAEQWLIRPPARAIGVTVAIPFYSRQNGNL*
Ga0164302_1052279433300012961SoilVLTARGSRLLVQAPTDCIGGVSLLWYNPATQAEQWLIRPPAHVIGVTIAIPFYSRQNGNL
Ga0126369_1144984223300012971Tropical Forest SoilARGPRLLIQAPTECTSGVSLLWYDPGKRAEQWLIRARGNVIGVENAVPFYSRENGNL*
Ga0164307_1010182323300012987SoilVLTARGSRLLVQAPTDCIGGVSLLWYNPATQAEQWLIRPPGHVIGVTVAVPFYSRQNGNL
Ga0164306_1021590243300012988SoilVLTARGSRLLVQAPTDCIGGVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYNRQNGNL
Ga0157373_1090137323300013100Corn RhizosphereTARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHATGVTVAIPFYSRQNGNL*
Ga0157376_1262688113300014969Miscanthus RhizosphereHTTDDNRVLTARGSRLLVQAPTDCTGSNSLLWYDPGTRAEQWLIRPKGNVIGVANAIPFYSRQNGNL*
Ga0132256_10367453813300015372Arabidopsis RhizosphereRLLVQAPSDCTGSVSLLWYNPGTQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL*
Ga0182037_1134752623300016404SoilGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVVGAAVAIPFYSRENANL
Ga0182038_1190668513300016445SoilGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVIGAANAIPFYSRENGNL
Ga0163161_1018242933300017792Switchgrass RhizosphereQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL
Ga0187812_104998223300017821Freshwater SedimentGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPSNAIGVASAIPFYSRENGNL
Ga0187812_107421113300017821Freshwater SedimentRVLTALGSRLLIQAPTSCAGSVSLLWFNPATRAEQWLIRAPGNVAGASIAIPFYSRENGN
Ga0187807_104822823300017926Freshwater SedimentVLTALGSGLLLQAPTSCAGSVSLLWFNPATRAEQWLIRAPGNVAGATIAIPFYSRANGNL
Ga0187807_112181813300017926Freshwater SedimentNHVLTALGSRLLIQAPTSCTGSVSLLWFNPATRAEQWLVRAPANVAGASIAIPFYSREDGNL
Ga0187814_1010898323300017932Freshwater SedimentVLTALGSRLLIQAPTSCAGSVSLLWFNPATRAEQWLIRAPGNVAGATIAIPFYSRANGNL
Ga0187808_1046950213300017942Freshwater SedimentVLTALGSRLLIQAPTSCTGSVSLLWFNPATRAEQWLVRAPANVAGASIAIPFYSREDGNL
Ga0187819_1065243413300017943Freshwater SedimentVPNRVLTALGSRLLIQAPTSCAGSVSLLWFNPATRAEQWLIQAPGNVVGASIAIPFYSRENGNL
Ga0187777_1088515523300017974Tropical PeatlandGSRLLIQAPTSCVGSVSLLWFNPGTRAEQWLIRAPADMTGAAIAIPFYSRENGSL
Ga0187765_1010476313300018060Tropical PeatlandVLTALGSRLLIQAPTSCAGRVSLLSFNPATRAGQWLIRAPGNVVGASIAIPFYSRENGNL
Ga0187765_1111680923300018060Tropical PeatlandPHTMGDNHVLTALGSRLLIQAPTSCIGSVSLLWFNPATRAEQWLIRAPANVTGAAIAIPFYSRENGNL
Ga0210407_1027106043300020579SoilLTARGSRLLVEAPTDCTGSVSLLWYDPGTRAEQWLIRAPGNVIGVANAVPFYSRQNGDL
Ga0210404_1044207913300021088SoilRLLVQAPTDCTGSVSLLWYDPAKRAEQWLIRAPGNVIGVAIAVPFYSRQNGNL
Ga0210405_1028895823300021171SoilEGDNDVLTALGARLLIRAPTSCIGSNSLLWFNPGTGAEQWLIRAPANQAGVTAALPFYSRQDGSL
Ga0210408_1106430923300021178SoilVQAPTDCTGSVSLLWYDPGTRAEQWLIRPPANVIGVANAIPFYSRQNGDL
Ga0210408_1122228123300021178SoilHTNGDNRVLTARGSRLLVQAPTDCTGSVSLLWYDPATRAEQWLIRPPANVIGVANAIPFYSRQNGDL
Ga0213875_1017811913300021388Plant RootsSRLLVQAPTSCVGSNSLLWYNPGTHAEQWLVRAPSNVIGVENAVPFYNRLNGDM
Ga0210397_1014767533300021403SoilSGDNRVLTARGSRLLVQAPTDCIGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL
Ga0210387_1054304713300021405SoilTKGENDVLTALGARLLIRAPTSCIGSNSLLWFNPGTGAEQWLIRAPANQAGVTAALPFYSRQDGSL
Ga0210390_1039475613300021474SoilQAPTSCTGSNSLLWYNPGTGAEQWLIRAPANEVGVAAAIPFYSRQDGSL
Ga0210402_1071928813300021478SoilGDNQVLTAHGSRLLIQAPTECTGSVSLLWYDPGKRAEQWLIRAPGNVTGVASAVPFYSRENGNL
Ga0210402_1172607213300021478SoilARLLVQAPTDCTGSVSLLWYDPAKRAEQWLIRAPGNVIGVAIAVPFYSRQNGNL
Ga0242668_104639223300022529SoilPSGRQRTCWRSGAPTSCIGSNSLLWFNPATHAEQWLIRAPANQIGVTVAIPFYSREDGNL
Ga0242675_103993623300022718SoilVLTALGARLLIRAPTSCISSNSLLWFNPGTGAEQWLIGAPANQAGVTAAVPFYSRQDGNL
Ga0247668_102802613300024331SoilIPPHTTDDNRVLTARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL
Ga0207692_1030422513300025898Corn, Switchgrass And Miscanthus RhizosphereVLTARGSRLLVQAPTDCIGGVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL
Ga0207692_1033867223300025898Corn, Switchgrass And Miscanthus RhizosphereLLIQAPTDCTGSNSLLWYDPGTRAEQWLIRPKGNVIGVANAIPFYSRQNGNL
Ga0207692_1035444513300025898Corn, Switchgrass And Miscanthus RhizosphereATGSRLLVQAPTSCVGSNSLLWYNPGTHAEQWLIRAPSKVIGVENAVPFYSRQNGNM
Ga0207693_1001077593300025915Corn, Switchgrass And Miscanthus RhizosphereSRLLIQAPTDCTGSNSLLWYDPGTRAEQWLIRPKGNVIGVANAIPFYSRQNGNL
Ga0207693_1041030033300025915Corn, Switchgrass And Miscanthus RhizosphereSRLLIQAPTDCTGSNSLLWYDPGTRAEQWLIRPKGNVLGVANAIPFYSRQNGDL
Ga0207663_1135484313300025916Corn, Switchgrass And Miscanthus RhizosphereGSRLLVEAPTDCTGSVSLLWYNPGTGAEQWLIRPKGNVLGVASAVPFYSRQNGDL
Ga0207660_1050456023300025917Corn RhizosphereTTDDDRVLTARGSRLLIQAPTDCTGSNSLLWYDPGTRAEQWLIRPKGNVIGVANAIPFYSRQNGNL
Ga0207649_1099066223300025920Corn RhizosphereLTATGSRLLVQAPTSCVGSNSLLWYNPGTHAEQWLIRAPSKVIGVENAVPFYSRQNGNM
Ga0207646_1041467433300025922Corn, Switchgrass And Miscanthus RhizosphereTNGDNRVLTARGSRLLVQAPTDCTGSVSLLWYDPGTRAEQWLIRAPGKVLGVANAVPFYSRQNGNL
Ga0207706_1024548413300025933Corn RhizosphereNRVLTARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL
Ga0207703_1110748613300026035Switchgrass RhizosphereRGSRLLVQAPSECTGSVSLLWFNPATRAEQWLIRSPAHVIGVTVAIPFYSRQNGNL
Ga0207675_10039008233300026118Switchgrass RhizosphereTARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL
Ga0209265_105401123300026308SoilVLTARGSRLLVEAPTDCTGSVSLLWYDPGTRAEQWLIRPQGHVLGVAFAVPFYSRQNGDL
Ga0209577_1072679323300026552SoilARGSRLLVEAPTDCTGSVSLLWYDPGTRAEQWLIRAPGNVIGVANAVPFYSRQNGDL
Ga0208731_100151223300027029Forest SoilHTNGDNDVLTALGARLLIQAPTSCIGSNSLLWFNPATHAEQWLIRAPANQIGVTVAIPFYSREDGNL
Ga0208240_100119713300027030Forest SoilALGARLLIQAPTSCIGSNSLLWFNPATHAEQWLIRAPANQIGVTVAIPFYSREDGNL
Ga0209111_101450013300027058Forest SoilVLTARGSRLLVQAPTDCIGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL
Ga0209693_1056970323300027855SoilTLGDNHVLTALGSRLLIQAPTSCEGSNSLLWFNPGTRAEQWLIRAPANVTGVAVAIPFYSKENGNL
Ga0209275_1027942923300027884SoilGDNRVLTARGSRLLVEAPTDCTGSVSLLWYDPGTRAEQWLIRAPANVTGVAVAIPFYSKENGNL
Ga0209415_1009117413300027905Peatlands SoilNRVLTALGSRLLIQAPTSCTGSVSLVWFDPATRAEQWLIRAPGNATGAAIAIPFYSRENGNL
Ga0311338_1185291113300030007PalsaNRVLTAAGSRLLIQAPTSCTGSVSLLWFNPGTRAEQWLVRTPANMSGVAIAIPFYSRENGNL
Ga0311370_1196478913300030503PalsaGSRLLIQAPTSCTGSVSLLWFNPGTRAEQWLVRTPANMSGVAIAIPFYSRENGNL
Ga0170834_10972783023300031057Forest SoilVPHTLGDNHVLTALGSRLLVQAPTSCTGSNSLLWFDPGTRSEQYLIKSPGNVIGVSMAIPFYSRQNASF
Ga0302324_10274199413300031236PalsaGSRLLIQAPTSCTGSVSLLWFNPGTRAEQWLVRTPANVSGVAIAIPFYSRENGNL
Ga0302326_1042399813300031525PalsaAAGSRLLIQAPTSCTGSVSLLWFNPGTRAEQWLVRTPANMSGVAIAIPFYSRENGNL
Ga0318516_1085104113300031543SoilSGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPHNVIGVAAAIPFYSRQNGNL
Ga0318541_1059209923300031545SoilVLTAFGSRLLIQAPTSCTGSNSLLWFNPATHAEQWLIRAPHNVIGVAAAIPFYSRQNGNL
Ga0318571_1035801913300031549SoilDNRVLTAFGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVIGAANAIPFYSRENGNL
Ga0310915_1052202013300031573SoilGSRLLIQAPTDCTGSVSLLWYDPGTRAEQWLIRPPAHTIGVSIAIPFYSRENGNL
Ga0318561_1008085623300031679SoilRVLTAFGSRLLIQAPTSCTGSNSLLWFNPATHAEQWLIRAPHNVIGVAAAIPFYSRQNGN
Ga0318572_1003506733300031681SoilSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVIGAANAIPFYSRENGNL
Ga0318572_1007095513300031681SoilGSRLLIQAPTDCTGSVSLLWYDPGTRAEQWLIRPPAHTIGVTIAIPFYSRENGNL
Ga0318560_1002214333300031682SoilLTALGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVIGAANAIPFYSRENGNL
Ga0310686_10128144523300031708SoilARLLIQAPTSCIGSNSLLWFNPGTGAEQWLIRAPANQIGVTVAIPFYSRQDGHI
Ga0310813_1200528613300031716SoilTSGDNRVLTARGSRLLVQAPTDCTGSVSLLWYNPATQAEQWLIRPPAHVIGVTVALPFYSRQNGNL
Ga0307474_1051204123300031718Hardwood Forest SoilVLTARGSRLLVQAPTDCIGSVSLLWYNPATQAEQWLIRPPARAIGVTVAIPFYSRQNGNL
Ga0306917_1107037923300031719SoilGSRLLIQAPTSCTGSNSLLWFNPATHAEQWLIRAPHNVIGVAAAIPFYSRQNGNL
Ga0306918_1088731813300031744SoilAPTSCTGSNSLLWFNPATHAEQWLIRAPHNVIGVAAAIPFYSRQNGNL
Ga0318494_1084428923300031751SoilAFGSRLLIQAPTSCTGSDSLLWFNPATRAEHWLIRAPRNVIGVAAAIPFYSRQNGNL
Ga0318554_1054219723300031765SoilLGDNHVLTALGSRLLIQAPTSCTGSVSLLWFDPATHAEQWLIRAPQNVIGAAMAIPFYSRENGNL
Ga0318509_1010985513300031768SoilPHTASDNRVLTAFGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPRNVIGVAAAIPFYSRQNGNL
Ga0318546_1036400613300031771SoilLTARGSRLLIQAPTDCTGSVSLLWYDPGTRAEQWLIRPPAHTIGVTIAIPFYSRENGNL
Ga0318546_1132234923300031771SoilAPTSCVGSNSLLWYNPGTHAEQWLIRAPAKVVGVENAVPFYSRQNGNM
Ga0318557_1020972013300031795SoilDNRVLTALGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVIGAANAIPFYSRENGNL
Ga0318567_1008733823300031821SoilDNRVLTALGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVVGAAVAIPFYSRENANL
Ga0318520_1001787833300031897SoilTASDNRVLTAFGSRLLIQAPTSCTGSNSLLWFNPATHAEQWLIRAPHNVIGVAAAIPFYSRQNGNL
Ga0306923_1035095323300031910SoilNRVLTAFGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVVGAAVAIPFYSRENANL
Ga0310909_1009432333300031947SoilVLTALGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVIGAANAIPFYSRENGNL
Ga0306922_1188899313300032001SoilLVQAPTDCTGSVSLLWYDPGKRAEQWLIRAPRNALGVTIAVPFYSRQNGNL
Ga0318563_1038030213300032009SoilLTAFGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVAGAAVAIPFYSRENANL
Ga0318556_1073995813300032043SoilHTASDNRVLTAFGSRLLIQAPTSCTGSNSLLWFNPATHAEQWLIRAPHNVIGVAAAIPFYSRQNGNL
Ga0318504_1057070013300032063SoilHTASDNRVLTALGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVVGAAVAIPFYSRENANL
Ga0318514_1063913813300032066SoilSDNRVLTASGSRLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPRNVIGVAAAIPFYSRQNGNL
Ga0318553_1077279413300032068SoilLLIQAPTSCTGSDSLLWFNPATHAEQWLIRAPDNVIGAANAIPFYSRENGNL
Ga0306920_10141640613300032261SoilSDNRVLTAFGSRLLIQAPTSCTGSNSLLWFNPATHAEQWLIRAPHNVIGVAAAIPFYSRQNGNL
Ga0306920_10317582313300032261SoilPHTASINRVLTAFGSRLLIQAPTSCTGADSLLWFNPVTHAEQWLIRAPGNVIGAASAIPFYSRQDGNL
Ga0335079_1003696543300032783SoilVPHTNGDNQVLTARGSRLLIQAPTECTGSVSLLWYDPGKRAEQWLIRAPRNALGVANAIPFYSRQNGNL
Ga0335070_1199152323300032829SoilAPTDCVGSNSLLWYNPGTHAEQWLIRAPSKVIGVESAVPFYSRQNGNM
Ga0335069_1086061413300032893SoilDNVVLTASASRLLIQAPTDCVGSNSLLWYNPGTHAEQWLIRAPSKVIGVESAVPFYSRQNGNM
Ga0335083_1150917413300032954SoilARGSRLLIQAPTECTGSVSLLWYDPGKRAEQWLIRAPGNVTGVASAVPFYSRENGNL
Ga0335073_1138808813300033134SoilMRLRRTALIAIATAVLVQAPTDCVGSVSLLWYNPATQAEQWLIRPPAHAIGVTVAVPFYSRQNGNL
Ga0335073_1184056313300033134SoilQAPTDCTGSVSLLWYDPGKRSEQWLIRAPRNALGVANAVPFYSRQNGNL
Ga0373958_0116824_1_2043300034819Rhizosphere SoilDTSGDNRVLTARGSRLLVQAPTDCIGGVSLLWYNPATQAEQWLIRPPAHAIGVTVAIPFYSRQNGNL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.