NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F050127

Metatranscriptome Family F050127

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050127
Family Type Metatranscriptome
Number of Sequences 145
Average Sequence Length 132 residues
Representative Sequence FGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Number of Associated Samples 104
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.56 %
% of genes near scaffold ends (potentially truncated) 87.59 %
% of genes from short scaffolds (< 2000 bps) 99.31 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.310 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(90.345 % of family members)
Environment Ontology (ENVO) Unclassified
(96.552 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(95.862 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 11.36%    β-sheet: 15.91%    Coil/Unstructured: 72.73%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF00687Ribosomal_L1 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG0081Ribosomal protein L1Translation, ribosomal structure and biogenesis [J] 0.69

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.31 %
UnclassifiedrootN/A0.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10674357All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex564Open in IMG/M
3300008998|Ga0103502_10360464All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex538Open in IMG/M
3300008998|Ga0103502_10371040All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex530Open in IMG/M
3300009022|Ga0103706_10220813All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex504Open in IMG/M
3300009022|Ga0103706_10223770All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex501Open in IMG/M
3300009025|Ga0103707_10174467All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex527Open in IMG/M
3300018581|Ga0193079_1015147All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex508Open in IMG/M
3300018590|Ga0193114_1026849All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex559Open in IMG/M
3300018600|Ga0192851_1015630All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex557Open in IMG/M
3300018600|Ga0192851_1016008All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex551Open in IMG/M
3300018604|Ga0193447_1026435All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex524Open in IMG/M
3300018612|Ga0193121_1047775All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex530Open in IMG/M
3300018616|Ga0193064_1026782All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex534Open in IMG/M
3300018637|Ga0192914_1019447All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex532Open in IMG/M
3300018638|Ga0193467_1052857All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex526Open in IMG/M
3300018641|Ga0193142_1059410All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex540Open in IMG/M
3300018648|Ga0193445_1051912All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis515Open in IMG/M
3300018657|Ga0192889_1061254All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex503Open in IMG/M
3300018658|Ga0192906_1041672All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex509Open in IMG/M
3300018658|Ga0192906_1041677All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex509Open in IMG/M
3300018660|Ga0193130_1049046All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex542Open in IMG/M
3300018662|Ga0192848_1042911All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex530Open in IMG/M
3300018666|Ga0193159_1051356All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex524Open in IMG/M
3300018673|Ga0193229_1039859All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex564Open in IMG/M
3300018678|Ga0193007_1054837All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex534Open in IMG/M
3300018686|Ga0192840_1051167All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex513Open in IMG/M
3300018686|Ga0192840_1051396All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex512Open in IMG/M
3300018698|Ga0193236_1047921All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis571Open in IMG/M
3300018699|Ga0193195_1044282All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex536Open in IMG/M
3300018706|Ga0193539_1045749All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex724Open in IMG/M
3300018713|Ga0192887_1057422All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex518Open in IMG/M
3300018715|Ga0193537_1104523All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex511Open in IMG/M
3300018726|Ga0194246_1074443All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis522Open in IMG/M
3300018727|Ga0193115_1074697All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis530Open in IMG/M
3300018731|Ga0193529_1066761All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex638Open in IMG/M
3300018731|Ga0193529_1093007All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex506Open in IMG/M
3300018733|Ga0193036_1057480All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis574Open in IMG/M
3300018733|Ga0193036_1064409All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex544Open in IMG/M
3300018741|Ga0193534_1063451All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex547Open in IMG/M
3300018741|Ga0193534_1070120All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex512Open in IMG/M
3300018751|Ga0192938_1095863All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex542Open in IMG/M
3300018751|Ga0192938_1098476All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex531Open in IMG/M
3300018764|Ga0192924_1046409All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex537Open in IMG/M
3300018764|Ga0192924_1046562All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex536Open in IMG/M
3300018765|Ga0193031_1078432All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex558Open in IMG/M
3300018767|Ga0193212_1061475All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex564Open in IMG/M
3300018769|Ga0193478_1071763All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex551Open in IMG/M
3300018769|Ga0193478_1076247All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex531Open in IMG/M
3300018769|Ga0193478_1077905All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex524Open in IMG/M
3300018770|Ga0193530_1059058All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex743Open in IMG/M
3300018770|Ga0193530_1067414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex686Open in IMG/M
3300018770|Ga0193530_1103132All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex515Open in IMG/M
3300018780|Ga0193472_1037778All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex529Open in IMG/M
3300018780|Ga0193472_1040168All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis512Open in IMG/M
3300018795|Ga0192865_10080187All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis558Open in IMG/M
3300018808|Ga0192854_1097411All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex541Open in IMG/M
3300018821|Ga0193412_1080842All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex506Open in IMG/M
3300018834|Ga0192877_1160855All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex500Open in IMG/M
3300018858|Ga0193413_1078978All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex548Open in IMG/M
3300018861|Ga0193072_1100252All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex552Open in IMG/M
3300018865|Ga0193359_1111069All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex508Open in IMG/M
3300018865|Ga0193359_1113163All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex502Open in IMG/M
3300018867|Ga0192859_1089443All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex508Open in IMG/M
3300018872|Ga0193162_1115640All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex501Open in IMG/M
3300018879|Ga0193027_1117845All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex517Open in IMG/M
3300018879|Ga0193027_1119283All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex513Open in IMG/M
3300018888|Ga0193304_1113683All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex515Open in IMG/M
3300018897|Ga0193568_1117448All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis836Open in IMG/M
3300018897|Ga0193568_1202173All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis522Open in IMG/M
3300018905|Ga0193028_1113668All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex521Open in IMG/M
3300018905|Ga0193028_1120248All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex503Open in IMG/M
3300018919|Ga0193109_10189869All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex573Open in IMG/M
3300018929|Ga0192921_10241000All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis507Open in IMG/M
3300018935|Ga0193466_1165446All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex518Open in IMG/M
3300018935|Ga0193466_1171048All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex504Open in IMG/M
3300018941|Ga0193265_10266332All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex500Open in IMG/M
3300018947|Ga0193066_10196536All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis577Open in IMG/M
3300018953|Ga0193567_10223095All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex570Open in IMG/M
3300018953|Ga0193567_10229433All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex558Open in IMG/M
3300018957|Ga0193528_10311054All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis520Open in IMG/M
3300018957|Ga0193528_10316316All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis513Open in IMG/M
3300018959|Ga0193480_10218867All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex548Open in IMG/M
3300018961|Ga0193531_10302198All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex551Open in IMG/M
3300018961|Ga0193531_10306326All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex545Open in IMG/M
3300018961|Ga0193531_10313268All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex535Open in IMG/M
3300018965|Ga0193562_10210045All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex538Open in IMG/M
3300018966|Ga0193293_10103614All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex556Open in IMG/M
3300018969|Ga0193143_10229126All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex527Open in IMG/M
3300018969|Ga0193143_10233609All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex520Open in IMG/M
3300018974|Ga0192873_10440893All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex510Open in IMG/M
3300018975|Ga0193006_10060201All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex1118Open in IMG/M
3300018979|Ga0193540_10104829All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis784Open in IMG/M
3300018979|Ga0193540_10183713All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis580Open in IMG/M
3300018988|Ga0193275_10296269All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis509Open in IMG/M
3300018989|Ga0193030_10266784All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex559Open in IMG/M
3300018989|Ga0193030_10291688All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex529Open in IMG/M
3300018990|Ga0193126_10226331All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis520Open in IMG/M
3300018990|Ga0193126_10232503All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis509Open in IMG/M
3300018993|Ga0193563_10257908All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex536Open in IMG/M
3300018993|Ga0193563_10270478All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis516Open in IMG/M
3300018995|Ga0193430_10174542All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex525Open in IMG/M
3300018998|Ga0193444_10177215All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis560Open in IMG/M
3300018999|Ga0193514_10272784All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex584Open in IMG/M
3300018999|Ga0193514_10276193All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex579Open in IMG/M
3300018999|Ga0193514_10290936All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex558Open in IMG/M
3300019000|Ga0192953_10150838All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis584Open in IMG/M
3300019004|Ga0193078_10160295All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis569Open in IMG/M
3300019004|Ga0193078_10193238All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex531Open in IMG/M
3300019005|Ga0193527_10402203All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis521Open in IMG/M
3300019006|Ga0193154_10275637All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis564Open in IMG/M
3300019006|Ga0193154_10280114All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex557Open in IMG/M
3300019006|Ga0193154_10284748All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex550Open in IMG/M
3300019018|Ga0192860_10357993All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex512Open in IMG/M
3300019019|Ga0193555_10230495All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex606Open in IMG/M
3300019020|Ga0193538_10288816All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex512Open in IMG/M
3300019024|Ga0193535_10223266All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex592Open in IMG/M
3300019024|Ga0193535_10236215All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex570Open in IMG/M
3300019030|Ga0192905_10215931All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex520Open in IMG/M
3300019033|Ga0193037_10282002All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis581Open in IMG/M
3300019033|Ga0193037_10317397All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex548Open in IMG/M
3300019040|Ga0192857_10317697All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex535Open in IMG/M
3300019044|Ga0193189_10168582All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex519Open in IMG/M
3300019052|Ga0193455_10437043All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex527Open in IMG/M
3300019052|Ga0193455_10450668All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex515Open in IMG/M
3300019055|Ga0193208_10732433All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex509Open in IMG/M
3300019111|Ga0193541_1077122All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex582Open in IMG/M
3300019111|Ga0193541_1082026All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex560Open in IMG/M
3300019120|Ga0193256_1068325All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex593Open in IMG/M
3300019133|Ga0193089_1140716All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex539Open in IMG/M
3300019134|Ga0193515_1078170All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex570Open in IMG/M
3300019144|Ga0193246_10267632All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex515Open in IMG/M
3300019148|Ga0193239_10297561All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex559Open in IMG/M
3300019148|Ga0193239_10336173All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex509Open in IMG/M
3300021896|Ga0063136_1013005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex520Open in IMG/M
3300021908|Ga0063135_1002696All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex507Open in IMG/M
3300021908|Ga0063135_1005399All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex537Open in IMG/M
3300021908|Ga0063135_1027707All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex525Open in IMG/M
3300021912|Ga0063133_1002315All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex506Open in IMG/M
3300031522|Ga0307388_10278280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda1049Open in IMG/M
3300031738|Ga0307384_10063863All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda1397Open in IMG/M
3300031742|Ga0307395_10521145All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex520Open in IMG/M
3300031750|Ga0307389_11075899All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex535Open in IMG/M
3300032481|Ga0314668_10645542All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex531Open in IMG/M
3300032726|Ga0314698_10513826All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex534Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine90.34%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.21%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water2.07%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.38%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300018581Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782098-ERR1712053)EnvironmentalOpen in IMG/M
3300018585Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000269 (ERX1782265-ERR1712044)EnvironmentalOpen in IMG/M
3300018590Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782335-ERR1712116)EnvironmentalOpen in IMG/M
3300018600Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000535 (ERX1782170-ERR1711950)EnvironmentalOpen in IMG/M
3300018604Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002362 (ERX1782200-ERR1712077)EnvironmentalOpen in IMG/M
3300018612Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782446-ERR1711922)EnvironmentalOpen in IMG/M
3300018616Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)EnvironmentalOpen in IMG/M
3300018637Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000837 (ERX1782121-ERR1712056)EnvironmentalOpen in IMG/M
3300018638Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002175 (ERX1789495-ERR1719505)EnvironmentalOpen in IMG/M
3300018641Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782156-ERR1711909)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018660Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000589 (ERX1782392-ERR1711993)EnvironmentalOpen in IMG/M
3300018662Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018673Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_048 - TARA_N000000115 (ERX1782433-ERR1712189)EnvironmentalOpen in IMG/M
3300018678Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782149-ERR1712036)EnvironmentalOpen in IMG/M
3300018686Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000593 (ERX1789430-ERR1719415)EnvironmentalOpen in IMG/M
3300018698Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001473 (ERX1809465-ERR1739846)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018715Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789494-ERR1719339)EnvironmentalOpen in IMG/M
3300018726Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000618 (ERX1782150-ERR1711887)EnvironmentalOpen in IMG/M
3300018727Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782136-ERR1711928)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018733Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782259-ERR1711890)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018751Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001514 (ERX1789607-ERR1719173)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018767Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000075 (ERX1782420-ERR1711944)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018795Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782279-ERR1712192)EnvironmentalOpen in IMG/M
3300018808Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000925 (ERX1782319-ERR1711931)EnvironmentalOpen in IMG/M
3300018821Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789489-ERR1719145)EnvironmentalOpen in IMG/M
3300018834Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789722-ERR1719319)EnvironmentalOpen in IMG/M
3300018858Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789628-ERR1719293)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018865Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001824 (ERX1789688-ERR1719211)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018897Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002777EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018919Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003043 (ERX1789401-ERR1719342)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018935Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002175 (ERX1789599-ERR1719494)EnvironmentalOpen in IMG/M
3300018941Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001288 (ERX1789482-ERR1719320)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018953Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018959Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789530-ERR1719318)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018990Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001334 (ERX1782458-ERR1711911)EnvironmentalOpen in IMG/M
3300018993Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002703EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019005Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_148 - TARA_N000002119 (ERX1789730-ERR1719193)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019018Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000981 (ERX1789537-ERR1719348)EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019030Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789399-ERR1719153)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019044Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789478-ERR1719328)EnvironmentalOpen in IMG/M
3300019052Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789503-ERR1719228)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019144Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001503 (ERX1789695-ERR1719376)EnvironmentalOpen in IMG/M
3300019148Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001477 (ERX1789676-ERR1719431)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1067435713300008832MarineMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR*
Ga0103502_1036046413300008998MarineMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR*
Ga0103502_1037104013300008998MarineMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR*
Ga0103706_1022081313300009022Ocean WaterTMLTLAALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR*
Ga0103706_1022377013300009022Ocean WaterMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR*
Ga0103707_1017446713300009025Ocean WaterGADGQLQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR*
Ga0193079_101514713300018581MarineMGQYHLATMLTLAALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193221_101151213300018585MarinePQPGALPIPRPGADGSYGGDYAGQYFQYINVPAPKEFEWGYRRGNNPGHYREEYLSQKDHAFKAKVKWGDEYGGYGEHFYDINHIPLYKEEPHYAPEPHYAPKPAPYAPPHSSS
Ga0193114_102684913300018590MarineMGQLQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0192851_101563013300018600MarineHGELQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192851_101600813300018600MarineHGELQFGAMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193447_102643513300018604MarineMGQLQFGAMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193121_104777513300018612MarineHGELQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193064_102678213300018616MarineQYHLATMLTLAALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0192914_101944713300018637MarineHGEYHLATMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193467_105285713300018638MarineHLPPQYHLATMLTLAALTTCLVAVSGFPMPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193142_105941013300018641MarineHGELQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193445_105191213300018648MarineTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0192889_106125413300018657MarineMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192906_104167213300018658MarineLATMLTLAALSTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0192906_104167713300018658MarineAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193130_104904613300018660MarineLQFGAMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192848_104291113300018662MarineTWELQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193159_105135613300018666MarineMGQLQFGAMLTLAALSACLVAVSGFPHPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193229_103985913300018673MarineHGELQFGAMLTLAALSTCLVAVSGYPRPQGPPGAAAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193007_105483713300018678MarineTWELQFGATLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192840_105116713300018686MarineFGAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192840_105139613300018686MarineFGAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193236_104792113300018698MarineMGELQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193195_104428213300018699MarineHGEYRLATMLTLAALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193539_104574913300018706MarineLGTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192887_105742213300018713MarineHGELQFGAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193537_110452313300018715MarineAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0194246_107444323300018726MarineLSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193115_107469713300018727MarineMGRVHGELQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193529_106676113300018731MarineMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193529_109300713300018731MarineLTLAALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNYFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193036_105748013300018733MarineHGELQFGAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGADGSYTGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193036_106440913300018733MarineHGELQFGAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGADGSYTGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193534_106345113300018741MarineSHLPAQLQFGAMLTLAALGTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193534_107012013300018741MarineAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192938_109586313300018751MarineGYNHLPPQYHLATMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0192938_109847613300018751MarineFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0192924_104640913300018764MarineTWGQYHLATMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0192924_104656213300018764MarineTWGQLQFGAMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193031_107843213300018765MarineMGQLQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193212_106147513300018767MarineTWGQLQFGAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193478_107176313300018769MarineHHPTQSHANTMLPLVTLIACLAAASAYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGDAYKEPVHAAPAYAPPAPAYDAGRR
Ga0193478_107624713300018769MarinePPQYHLATMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193478_107790513300018769MarineFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193530_105905813300018770MarineLSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193530_106741413300018770MarineMNRLGTALLVVGTVSAFPRPFPDGPGGHGGAPGPLPIPRPGTDGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGAAYKEPVHAAPAYAPPAPAYDAGRR
Ga0193530_110313213300018770MarineLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193472_103777813300018780MarineTMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193472_104016823300018780MarineLATMLTLAALTTCLVAVSGFPMPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192865_1008018713300018795MarineHGELQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPEPAYAPPKPAYGPARR
Ga0192854_109741113300018808MarineHGDLPAQLQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193412_108084213300018821MarineMLTLVALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0192877_116085513300018834MarineMNRLGTALLVVGTVSAFPRAFPDGPGGHGGSPGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGDSYQEPAHAAPAYAPPAPAYDAGRR
Ga0193413_107897813300018858MarineVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193072_110025213300018861MarineMLTLAALGTCLVAVSGYPRPQGPGPALPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193359_111106913300018865MarineLATMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPAKR
Ga0193359_111316313300018865MarineAMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192859_108944313300018867MarineLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193162_111564013300018872MarineGAMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193027_111784513300018879MarineQFGAMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193027_111928313300018879MarineFGAMLTLAALGTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193304_111368313300018888MarineAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193568_111744823300018897MarineMVNLPPNRPFQNAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193568_120217323300018897MarineQLQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193028_111366813300018905MarineAQLQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193028_112024813300018905MarineLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193109_1018986913300018919MarineMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0192921_1024100023300018929MarineVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193466_116544613300018935MarineLATMLTLAALTTCLVAVSGFPMPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193466_117104813300018935MarineAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193265_1026633213300018941MarineLATMLTLAALTTCLVAVSGFPMPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDIKHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193066_1019653613300018947MarineMGQLQFGAMLTLAALSTCLVAVSGYPRPQGPPGAAAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193567_1022309513300018953MarineHLPAQLQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193567_1022943313300018953MarineHLPAQLQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193528_1031105413300018957MarineHGELQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193528_1031631613300018957MarineHGELQFGAMLNLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193480_1021886713300018959MarineTAMNRLGTALLVVGTVSAFPRPFPDGPGGHGGAPGPLPIPRPGTDGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGDAYKEPVHAAPAYAPPAPAYDAGRR
Ga0193531_1030219813300018961MarineHLPAQLQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193531_1030632613300018961MarineHLPAQLQFGAMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193531_1031326813300018961MarineQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193562_1021004513300018965MarineRVHGELQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193293_1010361413300018966MarineTWELQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193143_1022912613300018969MarineAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193143_1023360913300018969MarineAALGTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192873_1044089313300018974MarineTWGHANTMLPLVTLTACLAAASAYPRPQGPGPAGPLPIPRPGADGSYTGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGAAYKEPVHAAPAYAPPAPAYDAGRR
Ga0193006_1006020113300018975MarineTWELQFGAMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193540_1010482923300018979MarineVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193540_1018371323300018979MarineHGELQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193275_1029626923300018988MarineMGQLQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193030_1026678413300018989MarineTWGQLQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193030_1029168813300018989MarineTWEFQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193126_1022633113300018990MarineHGELQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193126_1023250323300018990MarineMGELQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193563_1025790813300018993MarineAQFQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193563_1027047813300018993MarinePGIAAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193430_1017454213300018995MarineHGEYHLATMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNYFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193444_1017721523300018998MarineHGEYHLATMLTLAALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYGGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193514_1027278413300018999MarineYNHLPPQYHLATMLTLAALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193514_1027619313300018999MarineHGELQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193514_1029093613300018999MarineHGVVSTQSTWELQFGAMLTLAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192953_1015083823300019000MarineHGTHTNTMLPLVTLSACLAAASAYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGDSYQEPAHAAPAYAPPAPAYDAGRR
Ga0193078_1016029523300019004MarineHGEYHLATMLTLAALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193078_1019323813300019004MarineHGEYHLATMLTLAALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193527_1040220313300019005MarineQLQFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPIHHEPAYAPPKPAYGSARR
Ga0193154_1027563723300019006MarineMGQYHLATMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNYFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193154_1028011413300019006MarineHGELQFGAMLTLVALSVCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193154_1028474813300019006MarineGELQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0192860_1035799313300019018MarineTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193555_1023049513300019019MarineMLTLAALTTCLVAVSGLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193538_1028881613300019020MarineTAMNRLGTALLVVGTVSAFPRPFPDGPGGHGGAPGPLPIPRPGTDGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGAAYKEPVHAAPAYAPPAPAYDAGRR
Ga0193535_1022326613300019024MarineGGIAFPKSRITTMNKLVSVACLVASVSAFPRPQAPGPGGPGGIAFPKPGADGAYAGDNYFQYINVPAPHTFEWGYRRGNPDHNREQYLSQKDHTFKAKLKWHDGYEGHGEHYFDYNHVGPKEPVHHAPAPYAPPKPTYGGPALTN
Ga0193535_1023621513300019024MarineMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGR
Ga0192905_1021593113300019030MarineVGEMHTLGAALLFVGSASAFPMAFPDGPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193037_1028200223300019033MarineMGQLQFGAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGADGSYTGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193037_1031739713300019033MarineMGQLQFGAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGADGSYTGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0192857_1031769713300019040MarineQFGAMLTLAALSMCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193189_1016858213300019044MarineAMLTLAALSTCLVAVSGFPRPQGPGPAGPLPIPRPGADGSYTGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193455_1043704313300019052MarineQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193455_1045066813300019052MarineQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193208_1073243313300019055MarineLPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0193541_107712213300019111MarineWKWYQRRVHGELQFGAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193541_108202613300019111MarineMGQLQFGAMLILAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYGSARR
Ga0193256_106832513300019120MarineTTMNKLVSVACLVASVSAFPRPWPQAPGPGGPGGIAFPKPGADGAYAGDNYFQYINVPAPHTFEWGYRRGNPDHNREQYLSQKDHTFKAKLKWHDGYEGHGEHYFDYNHVGPKEPVHHAAPAYNAPPKPSYGGPALTN
Ga0193089_114071613300019133MarineMGSQRREIMLTIGAVLASLVAVCSGYPRPQGPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPGHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHGGGYKEEAHAPAYAPPAPAYEAGRR
Ga0193515_107817013300019134MarineKDATFSDVFYFNVTVFRKLLSLNWLQAALSACLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0193246_1026763213300019144MarineFGAMLTLAALSACLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPEPAYAPPKPAYGPARR
Ga0193239_1029756113300019148MarineLHTTAMNRLGTALLVVGTVSAFPRPFPDGPGGHGGAPGPLPIPRPGTDGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGAAYKEPVHAAPAYAPPAPAYDAGRR
Ga0193239_1033617313300019148MarineLATMLTLAALTTCLVAVSGFPRPQAPAGPLPIPRPGSDGSYAGDNYFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPGYGPARR
Ga0063136_101300513300021896MarineFTGRTSIKMKAVALVSVACLVASVSTLPRPQAPGPGGPGGIAFPTPGADGAYAGDNYFQYINVPAPHTFEWGYRRGNPDHNREQYLSQKDHTFKAKLKWHDGYEGHGEHYFDYNHVGPKEPVHHAPAYASPN
Ga0063135_100269613300021908MarineAMLTLAALSTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0063135_100539913300021908MarineHHPTQSHANTMLPLVTLTACLAAASAYPRPQGPGPAGPLPIPRPGADGSYTGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGAAYKEPVHAAPAYAPPAPAYDAGRR
Ga0063135_102770713300021908MarineMNKLVSVACLVASVTAFPRPQAPGPGGPGGIAFPKPGADGAYAGDNYFQYINVPAPHTFEWGYRRGNPDHNREQYLSQKDHTFKAKLKWHDGYEGHGEHYFDYNHVGLKEPVHQAPAYAPLKPTYGGPALTN
Ga0063133_100231513300021912MarineAMLTLAALGTCLVAVSGYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPHHNREEYLSQKDHTFKAKLKWSDEYGGHGEHYYDINHVSAYKEPVHHEPAYAPPKPAYDAGRR
Ga0307388_1027828013300031522MarinePRAFPDGPGGHGGSPGPLPIPRPGSDGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGDSYQEPAHAAPAYAPPAPAYDAGRR
Ga0307384_1006386313300031738MarineMTIVLQVTLSACLAAASAYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGDSYQEPAHAAPAYAPPAPAYDAGRR
Ga0307395_1052114513300031742MarineTMLPLVTLSACLAAASAYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGDSYQEPAHAAPAYAPPAPAYDAGRR
Ga0307389_1107589913300031750MarineHGCDMTIVLQVTLSACLAAASAYPRPQGPGPAGPLPIPRPGADGSYAGDNHFQYINVPAHKTFEWGYRRGNPDHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGDSYQEPAHAAPAYAPPAPAYDAGRR
Ga0314668_1064554213300032481SeawaterDTMLRLGCACTCLLAAVSGYPRPQGGGPGPAGPLPIPRPGADGSYAGDNYFQYINVPAHKTFEWGYRRGNPEHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGDSYKEPAPAYHEPAPAYSPPTYEAGRR
Ga0314698_1051382613300032726SeawaterNTLGAVLLFAGAASAYPLAFPDGPGGPGPLPIPRPGSDGSYAGDNYFQYINVPAHKTFEWGYRRGNPEHNREEYLSQKDHTFKAKLKWSDAYGGHGEHYYDINHGDSYKAPEPAYHEPAPAYSPPTYEAGRR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.