NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050469

Metagenome / Metatranscriptome Family F050469

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050469
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 43 residues
Representative Sequence LDDDKLKDVEARVASTIDDAVEFAMNAPDPGPEDAVTDLYA
Number of Associated Samples 125
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.62 %
% of genes from short scaffolds (< 2000 bps) 91.72 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.172 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.724 % of family members)
Environment Ontology (ENVO) Unclassified
(35.172 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.03%    β-sheet: 0.00%    Coil/Unstructured: 57.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF02779Transket_pyr 66.90
PF02780Transketolase_C 24.83
PF08338DUF1731 2.76
PF04545Sigma70_r4 1.38
PF01180DHO_dh 0.69
PF08281Sigma70_r4_2 0.69
PF01799Fer2_2 0.69
PF04542Sigma70_r2 0.69
PF03781FGE-sulfatase 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 2.76
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.69
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.69
COG0167Dihydroorotate dehydrogenaseNucleotide transport and metabolism [F] 0.69
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.69
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.69
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.69
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.69
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.69
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.69
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.69

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.17 %
UnclassifiedrootN/A4.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2001200001|2001224352All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300002562|JGI25382J37095_10056335All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300005093|Ga0062594_103157348All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005293|Ga0065715_11174408All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005330|Ga0070690_101368288All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005335|Ga0070666_10748810All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005355|Ga0070671_101877598All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005459|Ga0068867_101278288All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005518|Ga0070699_102086415All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005536|Ga0070697_101191361All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005539|Ga0068853_101776760All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005542|Ga0070732_10873248All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005545|Ga0070695_100991935All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300005548|Ga0070665_100926000All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300005563|Ga0068855_100299647All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300005578|Ga0068854_101772818All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005617|Ga0068859_102350925All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300005719|Ga0068861_101851072All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300005764|Ga0066903_100077425All Organisms → cellular organisms → Bacteria4311Open in IMG/M
3300005764|Ga0066903_106304157All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005841|Ga0068863_100680068All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300006046|Ga0066652_100115087All Organisms → cellular organisms → Bacteria2196Open in IMG/M
3300006050|Ga0075028_100025204All Organisms → cellular organisms → Bacteria2673Open in IMG/M
3300006224|Ga0079037_100223701All Organisms → cellular organisms → Bacteria1705Open in IMG/M
3300006358|Ga0068871_100097321All Organisms → cellular organisms → Bacteria2460Open in IMG/M
3300006358|Ga0068871_100680842All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300006794|Ga0066658_10899957All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300006804|Ga0079221_11692903All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300006881|Ga0068865_101449361All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300006954|Ga0079219_11328809All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300009012|Ga0066710_100219710All Organisms → cellular organisms → Bacteria2724Open in IMG/M
3300009012|Ga0066710_101889697All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300009012|Ga0066710_104386679All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300009012|Ga0066710_104453884All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300009089|Ga0099828_12038633All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300009090|Ga0099827_10226418All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1564Open in IMG/M
3300009148|Ga0105243_12138898All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300009162|Ga0075423_11276761All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300009162|Ga0075423_12426291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300009174|Ga0105241_10382019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1231Open in IMG/M
3300009176|Ga0105242_11274979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300009176|Ga0105242_12353215All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300009177|Ga0105248_11748779All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300009177|Ga0105248_13227770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300009545|Ga0105237_12387421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300009553|Ga0105249_13583342All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300009662|Ga0105856_1327954All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300009812|Ga0105067_1077657Not Available571Open in IMG/M
3300010044|Ga0126310_11741058All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300010047|Ga0126382_10269018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1260Open in IMG/M
3300010336|Ga0134071_10099428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1380Open in IMG/M
3300010400|Ga0134122_10613771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1007Open in IMG/M
3300010400|Ga0134122_11727771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300010403|Ga0134123_11789591Not Available667Open in IMG/M
3300010403|Ga0134123_12773779All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300010863|Ga0124850_1023142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1994Open in IMG/M
3300011269|Ga0137392_11022455All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300012198|Ga0137364_10714769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300012350|Ga0137372_10136783All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2014Open in IMG/M
3300012357|Ga0137384_10278972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1392Open in IMG/M
3300012362|Ga0137361_11209129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300012363|Ga0137390_11997105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300012905|Ga0157296_10192784All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300012929|Ga0137404_10225084All Organisms → cellular organisms → Bacteria → Acidobacteria1600Open in IMG/M
3300012948|Ga0126375_11723170All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300012957|Ga0164303_11164722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300012960|Ga0164301_10149957All Organisms → cellular organisms → Bacteria1425Open in IMG/M
3300012960|Ga0164301_11773892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300012961|Ga0164302_10886517All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300012961|Ga0164302_10891189All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300012984|Ga0164309_10354074All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1079Open in IMG/M
3300012989|Ga0164305_10245169All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300014325|Ga0163163_10089313All Organisms → cellular organisms → Bacteria3093Open in IMG/M
3300014326|Ga0157380_12607292All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300014968|Ga0157379_10978464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300014969|Ga0157376_13066097All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300015200|Ga0173480_11011912All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300015241|Ga0137418_11120881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300015371|Ga0132258_13068845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1156Open in IMG/M
3300015372|Ga0132256_103395897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300016319|Ga0182033_10015638All Organisms → cellular organisms → Bacteria4454Open in IMG/M
3300016445|Ga0182038_11392304All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300018027|Ga0184605_10173143All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium976Open in IMG/M
3300018027|Ga0184605_10222784All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium857Open in IMG/M
3300018079|Ga0184627_10390435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300018422|Ga0190265_12284022All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300018433|Ga0066667_11056723All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300018468|Ga0066662_11661974All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300018468|Ga0066662_11685029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300018468|Ga0066662_12982797All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300018481|Ga0190271_13716322All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300018482|Ga0066669_10288123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1324Open in IMG/M
3300018482|Ga0066669_12039014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300018482|Ga0066669_12337291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300019487|Ga0187893_10716731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300021339|Ga0193706_1094958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium813Open in IMG/M
3300021479|Ga0210410_11301700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300021861|Ga0213853_10632233All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium984Open in IMG/M
3300022756|Ga0222622_10822350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300024317|Ga0247660_1010428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1420Open in IMG/M
3300025703|Ga0208357_1199160Not Available537Open in IMG/M
3300025903|Ga0207680_10757634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300025907|Ga0207645_10930352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300025911|Ga0207654_10232430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1228Open in IMG/M
3300025918|Ga0207662_11262226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300025941|Ga0207711_10281372All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300025942|Ga0207689_11019659All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300025960|Ga0207651_10843934All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300025972|Ga0207668_11740195All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300026088|Ga0207641_10655779All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1031Open in IMG/M
3300026088|Ga0207641_11568624All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium660Open in IMG/M
3300026296|Ga0209235_1076519All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1507Open in IMG/M
3300026327|Ga0209266_1216813All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300026469|Ga0257169_1061624All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300026547|Ga0209156_10153954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1113Open in IMG/M
3300027819|Ga0209514_10168325All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300027882|Ga0209590_10821913All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300027910|Ga0209583_10274015All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300027948|Ga0209858_1011621Not Available713Open in IMG/M
3300028379|Ga0268266_12099157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300028784|Ga0307282_10220135All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300028885|Ga0307304_10462213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300029999|Ga0311339_11480076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi606Open in IMG/M
3300031184|Ga0307499_10285360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300031229|Ga0299913_11845043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300031538|Ga0310888_10612936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300031549|Ga0318571_10265540All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300031716|Ga0310813_11481747All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300031716|Ga0310813_11505868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300031778|Ga0318498_10029737All Organisms → cellular organisms → Bacteria2366Open in IMG/M
3300031798|Ga0318523_10024646All Organisms → cellular organisms → Bacteria2664Open in IMG/M
3300031820|Ga0307473_11309124All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300031879|Ga0306919_11387017Not Available531Open in IMG/M
3300031890|Ga0306925_11591336All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300031942|Ga0310916_10003753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes9523Open in IMG/M
3300031943|Ga0310885_10901173Not Available507Open in IMG/M
3300031962|Ga0307479_10616013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1067Open in IMG/M
3300032012|Ga0310902_10117706All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300032041|Ga0318549_10205874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium883Open in IMG/M
3300032179|Ga0310889_10257094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium830Open in IMG/M
3300032180|Ga0307471_100957905All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1023Open in IMG/M
3300032205|Ga0307472_101404693All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300033406|Ga0316604_10852500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300034257|Ga0370495_0231619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil8.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.45%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.07%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.07%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.07%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.07%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.07%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.07%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.38%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.38%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.38%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.38%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.38%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.38%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.69%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.69%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.69%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.69%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.69%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.69%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.69%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.69%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.69%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.69%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2001200001Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150EnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010863Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024317Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01EnvironmentalOpen in IMG/M
3300025703Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027948Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300034257Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
20012466232001200001SoilGLPGRSTSPYLQARNVLNPDKLKQIDDRVAATIDDAVEFATNADDPTPADAVTDLYA
JGI25382J37095_1005633513300002562Grasslands SoilILDDEKLKDIETRAASVIDDAVEFAMNAPDPSPEDAVTDLYA*
Ga0062594_10315734823300005093SoilRKVLTDDNLKEIEARVTTTIDDAVDFATSAPDPRPEDAITDLYSS*
Ga0065715_1117440823300005293Miscanthus RhizosphereDDAKLKEIEDQAAHTIDDAVEFASNAPDPVAADAVTDLYA*
Ga0070690_10136828813300005330Switchgrass RhizosphereTFTTYLKGLHVLTDEHEAEIDTRVKATIDDALEFAMNAPDPAPEAAVTDLYA*
Ga0070666_1074881023300005335Switchgrass RhizosphereTFTTYLQARKVLTGDNLKEIEARVTTTIDDAVDFATSAPDPRPEDAITDLYSS*
Ga0070671_10187759813300005355Switchgrass RhizosphereRHVLDDQKQKDVEARVTAVIDEAVEFAMNAPDPAPEEAVTDLYA*
Ga0068867_10127828813300005459Miscanthus RhizosphereTDEKMKEIEGRIAETLDEAAEYAMNAPDPIPEDAVTDLYA*
Ga0070699_10208641523300005518Corn, Switchgrass And Miscanthus RhizosphereDDEKQKDVEARVASTIDDAVEFATNAPDPKPEDAVADLYA*
Ga0070697_10119136113300005536Corn, Switchgrass And Miscanthus RhizosphereFATYLRTRHILDDAKSKDIEARIATTIDDAVEFASNAPDPSPEDAVTDLLA*
Ga0068853_10177676023300005539Corn RhizosphereTFTTYLQSRHLLDDHKMKDVEARVAAVIDEAVEYAQNAPDPAPEEAVTDLYA*
Ga0070732_1087324813300005542Surface SoilFTSYLRARHVLDDGKLHDVEARVASTIDEAVEFAMNAKDPAPEDAVTDLYA*
Ga0070695_10099193513300005545Corn, Switchgrass And Miscanthus RhizosphereQARSVLSADKLKEIEERVTSTIDDAVEFAMNAPDPAPQDAVTDLYA*
Ga0070665_10092600023300005548Switchgrass RhizosphereLRTRQVLDDEKLKDIEARVASTIDDAVEFAMNAPDPSPGDAVTDLYA*
Ga0068855_10029964733300005563Corn RhizosphereTDEIVKNTEERVASTIDDAVEFAMNAPDPDPSEAAADLYA*
Ga0068854_10177281823300005578Corn RhizosphereVLDDQKQKDIEAKVAATIDEALEFAMNSADPQPGEAVTDLYA*
Ga0068859_10235092513300005617Switchgrass RhizosphereLQSRHVLDDQKQKDVEARVAAVIDEAVEFAQNAPDPAPEEAVTDLYA*
Ga0068861_10185107223300005719Switchgrass RhizosphereLDDDKLKDVEARVASTIDDAVEFAMNAPDPGPEDAVTDLYA*
Ga0066903_10007742553300005764Tropical Forest SoilDIEAKVKSTIDDAVEFASNSPDPAPEEAVTDLYA*
Ga0066903_10630415723300005764Tropical Forest SoilLHVLTDEQEKDIEAKVKSTIDEAVEFASDSPDPAPEEAVTDLYA*
Ga0068863_10068006823300005841Switchgrass RhizosphereGLHVLTDDHEKEIEGRVKSVIDDAVEFATNSPDPGPEEAITDLYA*
Ga0066652_10011508713300006046SoilDDSKLKEIESRVASVIDGAVEFAANGADPKPEDAVTDIYAP*
Ga0075028_10002520443300006050WatershedsKGLHALTDGQIKEIEARVTVTIDDAVEFAMNAPDPGPEEAVTDLYA*
Ga0079037_10022370133300006224Freshwater WetlandsLADIERNVKAVIDAAVTFAESSPDPDPIEAVTDLYA*
Ga0068871_10009732153300006358Miscanthus RhizosphereYLRARHVLDDEKLKDVEGRVKATIDEATEFAMNAPDPAPEEAITDLYA*
Ga0068871_10068084213300006358Miscanthus RhizosphereTYLKGLHTLTDEKEKEIEGRVASAIDEAVEFAMNAPDPQPGDAVTDLYA*
Ga0066658_1089995713300006794SoilKLKEIEARVASTIDDAVQFAMDAPDPPAEEAVRDLYA*
Ga0079221_1169290313300006804Agricultural SoilSVGDIELRVKKTIDDAVEFAMSSADPAPAEAVADLYA*
Ga0068865_10144936123300006881Miscanthus RhizosphereGLKVLTDDQEREIEERVKTTIDDAVEFASSSPDPKAEDAVTDLYA*
Ga0079219_1132880913300006954Agricultural SoilEAEIDARVKTTIDDAVEFAMNAPDPAPEAAVTDIYA*
Ga0066710_10021971013300009012Grasslands SoilYLLARHVLDDQKQKDIDARVAAAIDDAVEFAMNAPEPDPQDAVTDLYA
Ga0066710_10188969723300009012Grasslands SoilQAEVEARVKQTIDDAVEFAMNAPDPTPEEAVTDLYA
Ga0066710_10438667923300009012Grasslands SoilHVLDDGTLKEIESRVAAVIDGAVEFAVNAADPRPEDAVTDIYA
Ga0066710_10445388413300009012Grasslands SoilVLDDPHQKEIEERVTKTIDEALEYAMNAPEPDAHDAVTDLYA
Ga0099828_1203863323300009089Vadose Zone SoilETEERVTRAIDDAIEYATSAPDPHPGDAVTDLYA*
Ga0099827_1022641813300009090Vadose Zone SoilKEVAERVAKTIDEAVEFAMNAEDPKPADAITDLYA*
Ga0105243_1213889813300009148Miscanthus RhizosphereIEARVTTTIDDAVDFATSAPDPRPEDAITDLYSS*
Ga0075423_1127676113300009162Populus RhizosphereTFTTYLKGLHVLSDAQEKEIEERVKATIDDAVEFATNSPDPSPEQAVIDLYA*
Ga0075423_1242629113300009162Populus RhizospherePTFTTYLRTRTILDDQKIRDVETRVTGAIDEAVEYAMNAPDPSAEDATTDLYA*
Ga0105241_1038201923300009174Corn RhizosphereYLKGLHILTDEIVKNTEERVASTIDDAVEFAMNAPDPDPSEAAADLYA*
Ga0105242_1127497913300009176Miscanthus RhizosphereYLRARHVLDDEKLKDVEARVTSTIYEAVEFAMNAPDPAPEEAVTDLYA*
Ga0105242_1235321513300009176Miscanthus RhizospherePRARHVLDDDKLKDVEPRVASTIDDAVEFAMNAPDPGPEDAVTDLYA*
Ga0105248_1174877923300009177Switchgrass RhizosphereLTDEKLQEVEARIASTIDEAVEYAMNAPDPQPEDAVTDLYA*
Ga0105248_1322777023300009177Switchgrass RhizosphereQEIEARVAQTIDDAVEFASSSPEPDPGDAVTDLYA*
Ga0105237_1238742113300009545Corn RhizosphereEKLKDVEARVKATIDEATEFAMNAPDPAPEEAITDLYA*
Ga0105249_1358334213300009553Switchgrass RhizosphereEKLQEVEARIASTIDEAVEYAMNAPDPQPEDAVTDLYA*
Ga0105856_132795413300009662Permafrost SoilGEIEARVTQTIDDAVEFAMNAPDPDPADAVTDLYA*
Ga0105067_107765713300009812Groundwater SandPTFTTYLQARQVLNDDRMKEIETRVAATIDDAVEHAMGAPDPEPGEAATDLYAEQAAEKRSLN*
Ga0126310_1174105823300010044Serpentine SoilDAKLKDVEGRVASTIDDAVEYAMNAAEPDPTDAVTDLYA*
Ga0126382_1026901813300010047Tropical Forest SoilTFTTYLKGLHALTDDKLKEIDARVNATIDDALEFAMNAPDPSAEDATTDLYA*
Ga0134071_1009942813300010336Grasslands SoilDDARLKEVERRVASTIDEAVEFAMSAPDPKPEDAVTDLYA*
Ga0134122_1061377113300010400Terrestrial SoilDDQKQKDIEAKVAATIDEALEFAMNSPDPKPEDAVTDLYA*
Ga0134122_1172777113300010400Terrestrial SoilLHDENLKEVEERVASTIDDAVKFAIDAPDPDPAEAVTDLYA*
Ga0134123_1178959123300010403Terrestrial SoilVLTDEKMKEIEAGIAKTLDEAVEYAMNAPDPAPEDAVTDLYA*
Ga0134123_1277377923300010403Terrestrial SoilDDAKLKEIEDQAAQAIDDAVEFASNAPDPAVADAVADLYA*
Ga0124850_102314243300010863Tropical Forest SoilFTTYLRTRTVLDDAKLKEIEARMAAVIDDAVEYAMNAPDPRVEDAVTDLYA*
Ga0137392_1102245513300011269Vadose Zone SoilKEIENRVKSTIDDAMEFATNSPDPDPADAVTDLYA*
Ga0137364_1071476923300012198Vadose Zone SoilLSEGKLKEVEDSVTSTIDDAVRFAMNAPDPNPTDAVTDLYA*
Ga0137372_1013678313300012350Vadose Zone SoilKEIEAKVAATIDEALEFAMNSPDPKPEDAVTDLYA*
Ga0137384_1027897233300012357Vadose Zone SoilFTTYLRARHVLDDDKLKEIESRITAAIDAAVEFATNAADPEAADAVTDLYA*
Ga0137361_1120912913300012362Vadose Zone SoilSADKLKEIEDRVASTIDDAVEFAMNAPDPSPEDAVTDLHA*
Ga0137390_1199710513300012363Vadose Zone SoilPTFTTYLRGLHALTDDQLHEIDARVTKTIDDAVEFAVSSPDPAPDEAVKDLYA*
Ga0157296_1019278423300012905SoilLKEIEERVTSTIDDAVEFAMNAPDPAPQDAVTDLYA*
Ga0137404_1022508413300012929Vadose Zone SoilLDEQKQKVVVARVAAVIDEAVEYAMNAPDPAPEEAVTDLYA*
Ga0126375_1172317013300012948Tropical Forest SoilLKGLHVLTNEHEAEIETRIKATIDDALEFAMNAPDPAPEEAVTDLYA*
Ga0164303_1116472213300012957SoilDDQKMKDVEARVAAVIDEAVEYAQNAPDPAPEEAVTDLYA*
Ga0164301_1014995713300012960SoilEQKQKDIEAKVAATIDEALEFAMNSADPKPEDAITDLFA*
Ga0164301_1177389213300012960SoilLLDDEKLKDVETRVASTINDAVEFAMNAADPKPEDAVSDLYA*
Ga0164302_1088651713300012961SoilKLHEVEARITTTIDEAVEYAMNAPDPQPEDALTDLYA*
Ga0164302_1089118923300012961SoilLHILTDEHEKEIDARVKSTIDDAVEFAANSPDPTPEDAITDLYA*
Ga0164309_1035407413300012984SoilKGLHVLSDEQEKDIEAKVKSTIDDAVEFASNSPDPAPEEAVTDLYA*
Ga0164305_1024516913300012989SoilVLDDQKMKDVEARVAAVIDEAVEYAQNAPDPAPEEAVTDLYA*
Ga0163163_1008931353300014325Switchgrass RhizosphereDQKLKEVEARVTTTIDEAVEFAQNAPDPAPEEAVTDLYA*
Ga0157380_1260729213300014326Switchgrass RhizospherePTFTTYLQARHVLTDEKMKEIEGRIAETLDEAVEYAMNAPDPVPEDAVTDLYA*
Ga0157379_1097846423300014968Switchgrass RhizosphereTDEQEKDIEAKVKSTIDDAVEFASNSPDPAPEEAVTDLYA*
Ga0157376_1306609713300014969Miscanthus RhizosphereEIQNRVTKTIDDAVEFATNGTDPHPDEAVSDLYA*
Ga0173480_1101191223300015200SoilTLSDEKEKEIEARVASTIDDAVEFAANAPDPKPEDAVTDLYA*
Ga0137418_1112088123300015241Vadose Zone SoilQALNDEKLAKIEARVTKTIDDAVEDAMNAPDPDPEDAITDLYA*
Ga0132258_1306884513300015371Arabidopsis RhizosphereLRTRNVLDDAKLKDVEARVASTIDEAVEYAMNEPEPAPADAVTDLYA*
Ga0132256_10339589713300015372Arabidopsis RhizosphereTFTTYLRGTNVLTDDKQREVEARVAATIDEAVEFATSAPDPVASDAVTDLYA*
Ga0182033_1001563853300016319SoilTFTTYLRTRTVLDDAKLKEIEARVAAVIDDAVDYAMNAPDPRVEDAVTDLYA
Ga0182038_1139230423300016445SoilLRARHVLDDDKLKDVEARVKSTIDEATEFAMNAPDPAPEEAVTDLYA
Ga0184605_1017314313300018027Groundwater SedimentTDDNLKELEARVIKTIDDAVEFAMSAPDPKPEDAVTDLYT
Ga0184605_1022278413300018027Groundwater SedimentGKILSADKLKEIEDRVASTIDDAVECAMNAPDPNPEDAVTDLYA
Ga0184627_1039043523300018079Groundwater SedimentDEKMREIEGRVLQTIDEAVEYAMNAPDPLPEDAITDLYA
Ga0190265_1228402213300018422SoilDKLQAIETRVTSTIDEAVDFAINSPDPKPEDAVTDLYA
Ga0066667_1105672323300018433Grasslands SoilPIPTFTTYLRARHVLDDGTLNEIESRVAAVIDGAVEFAVNAADPRPEDAVTDIYA
Ga0066662_1166197423300018468Grasslands SoilQKDVESRVKDTIDDAVDFAMNAPDPSPEDATTDLYA
Ga0066662_1168502913300018468Grasslands SoilILTDEIVKNTEERVASTIDDAVEFAMNAPDPDPSEAATDLYA
Ga0066662_1298279723300018468Grasslands SoilMLDDSQEKAMNERVEATIDDAVEFAMSAPDPKPEDAVTDLYA
Ga0190271_1371632213300018481SoilTPEHITDIENRVKSSIDDAVEFALNAPDPAPEDAVTDLYA
Ga0066669_1028812313300018482Grasslands SoilLKEIESRVAAVIDGAVEFAVNAADPRPEDAVTDIYA
Ga0066669_1203901413300018482Grasslands SoilKEIDERVKSTTDDALEFAGNSPDPVPEDAVTDLYA
Ga0066669_1233729113300018482Grasslands SoilSGEKLKEIEDRVTSTIDDAVEFAMSAPDPSPDAAVTDLYA
Ga0187893_1071673123300019487Microbial Mat On RocksVLSDEKMRDIEERVTEAIDDAVEYATNAPEPNPEDAVTDLYA
Ga0193706_109495823300021339SoilHISEIETRVTSAIDDAVEFAQNAPDPAPEDAVTDLYA
Ga0210410_1130170023300021479SoilRHVLDEEKEKDVDARVAAVIDEAVEFATNAPDPAPEEAVTDLYA
Ga0213853_1063223313300021861WatershedsKEIEARVTATIDDAVEFAMNAPDPTPEDATTDLYA
Ga0222622_1082235023300022756Groundwater SedimentYLQARNVLSADKLKEIEDRVTSTIDDAVEFAMNAPDPAPQDAVTDLYA
Ga0247660_101042813300024317SoilQKDVEARVASVIDEAVEFAMNAPDPAPEEAVTDLYA
Ga0208357_119916013300025703Arctic Peat SoilQASHVLDETKLKEIEARVKETIDEAVEYAANAPEPTVDEAVTDLYA
Ga0207680_1075763423300025903Switchgrass RhizosphereTFTTYLQARKVLTGDNLKEIEARVTTTIDDAVDFATSAPDPRPEDAITDLYSS
Ga0207645_1093035213300025907Miscanthus RhizosphereKLKDVEARVASTIDEALEFALNSPDPDPSEAVTDLYA
Ga0207654_1023243013300025911Corn RhizosphereYLKGLHILTDEIVKNTEERVASTIDDAVEFAMNAPDPDPSEAAADLYA
Ga0207662_1126222623300025918Switchgrass RhizosphereQKDVEQRVTAAIDDAVEFAMNAADPDPSEAATDLYA
Ga0207711_1028137233300025941Switchgrass RhizosphereDDNLKEIEARVTTTIDDAVDFATSAPDPRPEDAITDLYSS
Ga0207689_1101965913300025942Miscanthus RhizosphereDNLKEIEARVTTTIDDAVDFATSAPDPRPEDAITDLYSS
Ga0207651_1084393423300025960Switchgrass RhizosphereLHILTDEHEKEIDARVKSTIDDAVEFAANSPDPTPEDAITDLYA
Ga0207668_1174019523300025972Switchgrass RhizosphereMKEIEGRIAQTLDEAVEYAMNAPDPVPEDAVTDLYA
Ga0207641_1065577913300026088Switchgrass RhizosphereYLKGLHVLTDDHEKEIEGRVKSVIDDAVEFATNSPDPGPEEAITDLYA
Ga0207641_1156862423300026088Switchgrass RhizosphereQKQKDIEQRVAATIDDAVEFAVNAADPDPSEAAADLYA
Ga0209235_107651913300026296Grasslands SoilRHILDDEKLKDIETRAASVIDDAVEFAMNAPDPSPEDAVTDLYA
Ga0209266_121681313300026327SoilDEQKLNDIEGRVRSTIDGAVEFAMNAADPVPEDAVTDLYA
Ga0257169_106162423300026469SoilYLRARHILDDEKLKDIETRVASVIDDAVEFAMNAADPSPEDAVTDLYA
Ga0209156_1015395423300026547SoilLKEIESKVDGTIEDAVEFASNAPDPAPEDALSDLYA
Ga0209514_1016832513300027819GroundwaterTYLKARNVLDEATLKDTEARAAKAIDEAVEYAMNAEDPPPDEAVTDLYA
Ga0209590_1082191313300027882Vadose Zone SoilYLKGLNVLSDDKEKEVVARVAKTIDEAVEFAMNAPDPNPVDAVTDLYS
Ga0209583_1027401523300027910WatershedsKEIEARVTVTIDDAVEFAMNAPDPGPEEAVTDLYA
Ga0209858_101162123300027948Groundwater SandKLNEIEGRVTATIDDAVEFAMNARDPRPEDAVADLYV
Ga0268266_1209915723300028379Switchgrass RhizosphereTFTSYLRARHVLDDQKQKDIEKKVAATIDEALEFAMNSADPQPGEAVTDLYA
Ga0307282_1022013523300028784SoilLRARHVLDDDKLKDVEARVATTIDEAVEFAINAPDPKPEDAVTDLYA
Ga0307304_1046221323300028885SoilKDVEARITSTIDDAVEFAMNAPDPSPEDAVTDLYA
Ga0311339_1148007623300029999PalsaTFTTYLRARHELDDEKLKDVEARVASTIDEALEYALNAPDPAPEDAITDLYA
Ga0307499_1028536013300031184SoilQEVEARIASTIDEAVEYAMNAPDPQPEDAVTDLYA
Ga0299913_1184504323300031229SoilDKLKEIEDRVTSTIDDAVDFATNTPDPKPEDAVTDLYA
Ga0310888_1061293613300031538SoilTTYLKGIRTLTDEKIKDIEGRITAVIDDAVEFAMNAPDPTPEDAVTDLYA
Ga0310888_1072779313300031538SoilLDDQLADIEARVKATIDDAVEFAAGAPEADPSDAATDLYA
Ga0318571_1026554013300031549SoilTYLRTRTVLDDAKLKEIEARVAAVIDDAVDYAMNAPDPRVEDAVTDLYA
Ga0310813_1148174723300031716SoilTTYLRARHVLDDEKLKDVEARVKQTIDEAVDFAANAPDPSPGDAITDLYA
Ga0310813_1150586823300031716SoilKGLHVLTDDHEKEIEGRVKSVIDDAVEFATNSPDPGPEEAITDLYA
Ga0318498_1002973713300031778SoilFTTYLRTRTVLDDAKLKEIEARVAAVIDDAVDYAMNAPDPRVEDAVTDLYA
Ga0318523_1002464643300031798SoilTTYLRTRTVLDDAKLKEIEARVAAVIDDAVDYAMNAPDPRVEDAVTDLYA
Ga0307473_1130912423300031820Hardwood Forest SoilDAKQKDVEARVASTIDDAVEFAMNAAEPDPKDAVTDLYA
Ga0306919_1138701713300031879SoilTRNVLDDRKVEEIEGRVAATVDDAVEFAANAPDPRPEDATTDLYA
Ga0306925_1159133613300031890SoilQEIELKVKTTIDEAVEFAMTAPEPVPEDALTDLYA
Ga0310916_1000375393300031942SoilIPTFTTYLRTRTVLDDAKLKEIEARVAAVIDDAVDYAMNAPDPRVEDAVTDLYA
Ga0310885_1090117323300031943SoilSDDKLKEIEDRVKTAIDDAVEFAMGAPDPAPEDAVTDLYA
Ga0307479_1061601323300031962Hardwood Forest SoilRARHVLDDRQEQEINARVEATIDEAVEFAMNAPDPDAADAVTDVYA
Ga0310902_1011770613300032012SoilLKGLQTLSDEKEKEIEARVASTIDDAVEFAANAPDPKPEDAVTDLYA
Ga0318549_1020587413300032041SoilYLRTRTVLDDAKLKEIEARVAAVIDDAVDYAMNAPDPRVEDAVTDLYA
Ga0310889_1025709423300032179SoilQKDIEAKVAATIDEALEFAMNSPDPKPEDAVTDLYA
Ga0307471_10095790513300032180Hardwood Forest SoilQKLKEIEAKITTTIDDAVEFAMNAPDPQPEDATTDLYA
Ga0307472_10140469323300032205Hardwood Forest SoilLTDDKQADVENRVKQTIDDAVEFAMNSPDPDPAEAVTDLYA
Ga0316604_1085250013300033406SoilLADIERNVKAVIDAAVTFAESSPDPDPIEAVTDLYA
Ga0370495_0231619_452_6013300034257Untreated Peat SoilTYLKGINVLTDDKVTETEARIAATIDDAVEFAMNAADPTPEEAVTDLYV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.