Basic Information | |
---|---|
Family ID | F051364 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 144 |
Average Sequence Length | 39 residues |
Representative Sequence | MKKVSTAVAKQSRNISQQKLTIGLDLGDRNSWYCVLD |
Number of Associated Samples | 128 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 95.10 % |
% of genes near scaffold ends (potentially truncated) | 88.19 % |
% of genes from short scaffolds (< 2000 bps) | 79.86 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.056 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.583 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.917 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.833 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.23% β-sheet: 0.00% Coil/Unstructured: 70.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF02371 | Transposase_20 | 6.25 |
PF00072 | Response_reg | 2.78 |
PF01548 | DEDD_Tnp_IS110 | 2.78 |
PF03544 | TonB_C | 1.39 |
PF07676 | PD40 | 1.39 |
PF13231 | PMT_2 | 1.39 |
PF05598 | DUF772 | 0.69 |
PF01546 | Peptidase_M20 | 0.69 |
PF00892 | EamA | 0.69 |
PF12796 | Ank_2 | 0.69 |
PF00486 | Trans_reg_C | 0.69 |
PF00535 | Glycos_transf_2 | 0.69 |
PF13620 | CarboxypepD_reg | 0.69 |
PF13565 | HTH_32 | 0.69 |
PF07238 | PilZ | 0.69 |
PF01842 | ACT | 0.69 |
PF06912 | DUF1275 | 0.69 |
PF02368 | Big_2 | 0.69 |
PF08327 | AHSA1 | 0.69 |
PF08308 | PEGA | 0.69 |
PF13431 | TPR_17 | 0.69 |
PF02743 | dCache_1 | 0.69 |
PF00589 | Phage_integrase | 0.69 |
PF06271 | RDD | 0.69 |
PF01084 | Ribosomal_S18 | 0.69 |
PF12371 | TMEM131_like_N | 0.69 |
PF00067 | p450 | 0.69 |
PF00144 | Beta-lactamase | 0.69 |
PF11941 | DUF3459 | 0.69 |
PF01261 | AP_endonuc_2 | 0.69 |
PF00893 | Multi_Drug_Res | 0.69 |
PF13683 | rve_3 | 0.69 |
PF00069 | Pkinase | 0.69 |
PF00753 | Lactamase_B | 0.69 |
PF02518 | HATPase_c | 0.69 |
PF11706 | zf-CGNR | 0.69 |
PF12697 | Abhydrolase_6 | 0.69 |
PF00132 | Hexapep | 0.69 |
PF01527 | HTH_Tnp_1 | 0.69 |
PF13924 | Lipocalin_5 | 0.69 |
PF13817 | DDE_Tnp_IS66_C | 0.69 |
PF03144 | GTP_EFTU_D2 | 0.69 |
PF00561 | Abhydrolase_1 | 0.69 |
PF08238 | Sel1 | 0.69 |
PF14520 | HHH_5 | 0.69 |
PF00891 | Methyltransf_2 | 0.69 |
PF06441 | EHN | 0.69 |
PF00873 | ACR_tran | 0.69 |
PF01126 | Heme_oxygenase | 0.69 |
PF03551 | PadR | 0.69 |
PF00078 | RVT_1 | 0.69 |
PF04075 | F420H2_quin_red | 0.69 |
PF00571 | CBS | 0.69 |
COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 9.03 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.78 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.39 |
COG0238 | Ribosomal protein S18 | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.69 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.69 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.69 |
COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.69 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.69 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.69 |
COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.69 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.69 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.69 |
COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.69 |
COG3230 | Heme oxygenase | Inorganic ion transport and metabolism [P] | 0.69 |
COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 0.69 |
COG5398 | Heme oxygenase | Coenzyme transport and metabolism [H] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.06 % |
Unclassified | root | N/A | 6.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003505|JGIcombinedJ51221_10342096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300004092|Ga0062389_100480988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1384 | Open in IMG/M |
3300005179|Ga0066684_10719435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300005353|Ga0070669_101049112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
3300005530|Ga0070679_101801610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300005541|Ga0070733_10155299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1486 | Open in IMG/M |
3300005576|Ga0066708_10234019 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300005614|Ga0068856_100299388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 1626 | Open in IMG/M |
3300005614|Ga0068856_102521348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300005617|Ga0068859_100580663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1214 | Open in IMG/M |
3300005764|Ga0066903_100660634 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
3300005921|Ga0070766_10335884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
3300005921|Ga0070766_11045282 | Not Available | 563 | Open in IMG/M |
3300006047|Ga0075024_100455793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300006052|Ga0075029_100952890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300006052|Ga0075029_101005949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 576 | Open in IMG/M |
3300006052|Ga0075029_101299019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300006059|Ga0075017_100557030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
3300006086|Ga0075019_10144768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1386 | Open in IMG/M |
3300006174|Ga0075014_100298130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
3300006176|Ga0070765_100383931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
3300006237|Ga0097621_100907832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 821 | Open in IMG/M |
3300006794|Ga0066658_10308939 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300006804|Ga0079221_10140713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
3300006914|Ga0075436_100527061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
3300009088|Ga0099830_11548962 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300009177|Ga0105248_10212138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2182 | Open in IMG/M |
3300009524|Ga0116225_1424092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300009545|Ga0105237_10639107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 1071 | Open in IMG/M |
3300009545|Ga0105237_11474211 | Not Available | 687 | Open in IMG/M |
3300009549|Ga0116137_1193694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 546 | Open in IMG/M |
3300009551|Ga0105238_10209294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1926 | Open in IMG/M |
3300009632|Ga0116102_1123174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300009645|Ga0116106_1136175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
3300010043|Ga0126380_10101268 | Not Available | 1729 | Open in IMG/M |
3300010046|Ga0126384_11023205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 753 | Open in IMG/M |
3300010046|Ga0126384_11491766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 633 | Open in IMG/M |
3300010047|Ga0126382_10770244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
3300010360|Ga0126372_10049690 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
3300010360|Ga0126372_10543626 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300010361|Ga0126378_10104098 | All Organisms → cellular organisms → Bacteria | 2808 | Open in IMG/M |
3300010371|Ga0134125_10219798 | Not Available | 2112 | Open in IMG/M |
3300010376|Ga0126381_101952195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300010397|Ga0134124_12193127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300011110|Ga0138578_1078617 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300012205|Ga0137362_11204234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300012208|Ga0137376_10575937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 975 | Open in IMG/M |
3300012210|Ga0137378_10085505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2880 | Open in IMG/M |
3300012362|Ga0137361_10947780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300012929|Ga0137404_10802786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 855 | Open in IMG/M |
3300012971|Ga0126369_10352575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1494 | Open in IMG/M |
3300012971|Ga0126369_12102446 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300012971|Ga0126369_12802163 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300012975|Ga0134110_10418192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300013307|Ga0157372_10245439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2078 | Open in IMG/M |
3300014201|Ga0181537_10044619 | All Organisms → cellular organisms → Bacteria | 3012 | Open in IMG/M |
3300014495|Ga0182015_10045999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3225 | Open in IMG/M |
3300014501|Ga0182024_10173118 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
3300014969|Ga0157376_10015047 | All Organisms → cellular organisms → Bacteria | 5832 | Open in IMG/M |
3300015264|Ga0137403_10556303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 1015 | Open in IMG/M |
3300015371|Ga0132258_11235621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1888 | Open in IMG/M |
3300015374|Ga0132255_100134777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3419 | Open in IMG/M |
3300016294|Ga0182041_11363443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 650 | Open in IMG/M |
3300016341|Ga0182035_11794998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300016371|Ga0182034_10885215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300016422|Ga0182039_11257352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300017823|Ga0187818_10169895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 950 | Open in IMG/M |
3300017927|Ga0187824_10015624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2213 | Open in IMG/M |
3300017943|Ga0187819_10003914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8057 | Open in IMG/M |
3300017943|Ga0187819_10332978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
3300017943|Ga0187819_10350894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 852 | Open in IMG/M |
3300017943|Ga0187819_10859546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 508 | Open in IMG/M |
3300017946|Ga0187879_10261966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
3300017966|Ga0187776_10099443 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
3300017975|Ga0187782_10023758 | All Organisms → cellular organisms → Bacteria | 4467 | Open in IMG/M |
3300017993|Ga0187823_10073213 | Not Available | 981 | Open in IMG/M |
3300018025|Ga0187885_10234072 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300018033|Ga0187867_10632815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 584 | Open in IMG/M |
3300018088|Ga0187771_11218148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 639 | Open in IMG/M |
3300019786|Ga0182025_1339294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1936 | Open in IMG/M |
3300020580|Ga0210403_10003185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14521 | Open in IMG/M |
3300020581|Ga0210399_10228993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1548 | Open in IMG/M |
3300021170|Ga0210400_10148201 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
3300021171|Ga0210405_10247345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1411 | Open in IMG/M |
3300021180|Ga0210396_10070870 | All Organisms → cellular organisms → Bacteria | 3171 | Open in IMG/M |
3300021401|Ga0210393_11177765 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300021401|Ga0210393_11480803 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
3300021420|Ga0210394_10000324 | All Organisms → cellular organisms → Bacteria | 109502 | Open in IMG/M |
3300021432|Ga0210384_10090756 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
3300021479|Ga0210410_10000146 | All Organisms → cellular organisms → Bacteria | 105523 | Open in IMG/M |
3300021479|Ga0210410_11063254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 699 | Open in IMG/M |
3300021559|Ga0210409_10000054 | All Organisms → cellular organisms → Bacteria | 254611 | Open in IMG/M |
3300021560|Ga0126371_10015584 | All Organisms → cellular organisms → Bacteria | 6951 | Open in IMG/M |
3300022506|Ga0242648_1031426 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300022533|Ga0242662_10315946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 525 | Open in IMG/M |
3300022709|Ga0222756_1091697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300022756|Ga0222622_10950998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 631 | Open in IMG/M |
3300025898|Ga0207692_10749186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300025905|Ga0207685_10305122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
3300025924|Ga0207694_11234870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300025934|Ga0207686_11250162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300025938|Ga0207704_10242749 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
3300025960|Ga0207651_10716893 | Not Available | 882 | Open in IMG/M |
3300026023|Ga0207677_11559819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
3300026078|Ga0207702_10169042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 2003 | Open in IMG/M |
3300026291|Ga0209890_10164605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300026552|Ga0209577_10191154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1579 | Open in IMG/M |
3300027371|Ga0209418_1021727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
3300027645|Ga0209117_1044101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1343 | Open in IMG/M |
3300027825|Ga0209039_10126107 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300027854|Ga0209517_10115644 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
3300027854|Ga0209517_10181969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1314 | Open in IMG/M |
3300027869|Ga0209579_10494517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
3300027898|Ga0209067_10133146 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300027905|Ga0209415_10380294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1154 | Open in IMG/M |
3300027910|Ga0209583_10510119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300028381|Ga0268264_10063152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 3112 | Open in IMG/M |
3300028906|Ga0308309_10752998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300029957|Ga0265324_10264533 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300030743|Ga0265461_11345801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 755 | Open in IMG/M |
3300031236|Ga0302324_100632883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1526 | Open in IMG/M |
3300031682|Ga0318560_10067103 | Not Available | 1802 | Open in IMG/M |
3300031708|Ga0310686_102075131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5725 | Open in IMG/M |
3300031715|Ga0307476_10448726 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300031718|Ga0307474_10273851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1296 | Open in IMG/M |
3300031740|Ga0307468_101428106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
3300031781|Ga0318547_10639745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300031788|Ga0302319_10027724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9911 | Open in IMG/M |
3300031820|Ga0307473_10114435 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
3300031910|Ga0306923_11556171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300031946|Ga0310910_10168256 | Not Available | 1686 | Open in IMG/M |
3300031962|Ga0307479_10634906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
3300032035|Ga0310911_10599586 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300032051|Ga0318532_10330978 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300032180|Ga0307471_103317528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300032770|Ga0335085_10356941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1711 | Open in IMG/M |
3300032782|Ga0335082_10032454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5531 | Open in IMG/M |
3300032893|Ga0335069_10002509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 28208 | Open in IMG/M |
3300032898|Ga0335072_10273297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1919 | Open in IMG/M |
3300033158|Ga0335077_11032215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300033158|Ga0335077_11786556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 578 | Open in IMG/M |
3300033412|Ga0310810_10066041 | All Organisms → cellular organisms → Bacteria | 4378 | Open in IMG/M |
3300033743|Ga0334844_014089 | Not Available | 1597 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.33% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.25% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.86% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.17% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.78% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.08% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.08% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.08% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.08% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.08% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.39% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.39% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.39% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.39% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.39% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.69% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.69% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.69% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033743 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ51221_103420962 | 3300003505 | Forest Soil | MKKVSTRAAAQSRNISQQKLTIGLDLGGRNSWYCAVDEAGQI |
Ga0062389_1004809881 | 3300004092 | Bog Forest Soil | AMKKISTVAAKQSRNFSQPKLTIGLDLDDRSNWYCVLEERS* |
Ga0066684_107194352 | 3300005179 | Soil | MKKISIRAAAQSRNISQQKLTLGLDLGDRNSWYCVVDEAGQIQ |
Ga0070669_1010491121 | 3300005353 | Switchgrass Rhizosphere | MKKVSTTTAKQSRNISQQKRTIELDLGDRNSWCCVLDEVGQSSV* |
Ga0070679_1018016101 | 3300005530 | Corn Rhizosphere | MKKVSTAVVRQSRNICPPKLTIGLDLGDRNSWYCVLNGAG |
Ga0070733_101552993 | 3300005541 | Surface Soil | MKKVSTAATKQSRNISQQQLTIGLDLGDRNAWSCVLDEAGRI |
Ga0066708_102340194 | 3300005576 | Soil | MKKVSTAATKQSRNISQQKLTIGLDLGDRNSWYCV |
Ga0068856_1002993881 | 3300005614 | Corn Rhizosphere | MKKVSTAAAKQSRNVLQSNLTIGLDLGDRSSCYCVLDEEKLCGV* |
Ga0068856_1025213481 | 3300005614 | Corn Rhizosphere | MKKTSTAVAKQSRNICRQTLTIGLDLGDRNSRYCVLDEVGADTTGTACAN |
Ga0068859_1005806633 | 3300005617 | Switchgrass Rhizosphere | MKKVSIAATRQSRNISQQKLTIGLDLGDRNSWYCV |
Ga0066903_1006606341 | 3300005764 | Tropical Forest Soil | VKNSSTAVTMASRNISQQKLPIGSDPGDRNRWYCVVDTAGQIQVEQ |
Ga0070766_103358841 | 3300005921 | Soil | MKKVSTVAAKPGKKISQQKLTVGLDLGDRNSWYCVLDE |
Ga0070766_110452821 | 3300005921 | Soil | RPAMKKVSTVAAKPSKKISQQKLAVGLDLGDRNSWYCVVDDTGQIQLE* |
Ga0075024_1004557932 | 3300006047 | Watersheds | MKKISTAEARQTRNVRDQHLTIGLDLGDRSSWYCGLE |
Ga0075029_1009528902 | 3300006052 | Watersheds | MKKVSIRAAAQSRNISQQKLTIGLDLGDRNSWYCVVDEAGQIQ |
Ga0075029_1010059491 | 3300006052 | Watersheds | MKKVSTRAGAQSGNISQQRLTIGLDLGDRNSWYCVLDES |
Ga0075029_1012990192 | 3300006052 | Watersheds | MKKGSTRAAAQSGNISQQKLTIGLDLGDRNCWYCVVDEAGQIR |
Ga0075017_1005570302 | 3300006059 | Watersheds | MKKVSIRAAAQSRNISQQKLTIGLDLGDRNSWYCVVDE |
Ga0075019_101447683 | 3300006086 | Watersheds | MKKVSTRAAAQSGNISQQKLTIGLDLGDRNSWYCVVDEGGQIQL |
Ga0075014_1002981302 | 3300006174 | Watersheds | MKKVSTVGTQQTMNISRQKLTIGLDLGDRNSWYCV |
Ga0070765_1003839313 | 3300006176 | Soil | MKKVSTVAAQRSTKISRQKLTVGLDLGDRSSWYCVLDET |
Ga0097621_1009078321 | 3300006237 | Miscanthus Rhizosphere | MKKVSTVAGKQSRNISRQTLTIGLDLGDRNSWYCVLDE |
Ga0066658_103089392 | 3300006794 | Soil | MKKVSTPAVKATKHFSQPKLTIGLDLGDRSSWYCLLGNL* |
Ga0079221_101407133 | 3300006804 | Agricultural Soil | MKKVSTILAKQSRKSSQRELIVGLDLGDRNSWYCVLDEAATYN* |
Ga0075436_1005270611 | 3300006914 | Populus Rhizosphere | MKKVSTVAARQRKTFSQPTLTIGLDLGDRNSWYCV |
Ga0099830_115489621 | 3300009088 | Vadose Zone Soil | MKKISTVMAKKVEKNASQKLTIGLDLGDRFSWYCV |
Ga0105248_102121381 | 3300009177 | Switchgrass Rhizosphere | TTAKQSRNISQQKRTIELDLGDRNSWCCVLDEVGQSSV* |
Ga0116225_14240921 | 3300009524 | Peatlands Soil | MKQVSRVAAKPSRNNSQPKLTIGLDLGDRNSWYCVVDEAGQIRLE |
Ga0105237_106391071 | 3300009545 | Corn Rhizosphere | TAAAKQSRNVLQSNLTIGLDLGDRSSCYCVLDEEKLCGV* |
Ga0105237_114742111 | 3300009545 | Corn Rhizosphere | MKKISTVAVKQNRSFSEQKLTIGLDLGDRSSWYVEAGEIRLEQTLG |
Ga0116137_11936942 | 3300009549 | Peatland | MKKISTVARKQSRNFSEQKLTIGLDLGDRSSWYCVLNE |
Ga0105238_102092942 | 3300009551 | Corn Rhizosphere | MKKVSTTLAKQSRKNSQQKLTVGLDLGDRNSWYCV |
Ga0116102_11231741 | 3300009632 | Peatland | MKKISSAVTMESRNFSRQQKLTIGLDLGDRHSWYCVVDE |
Ga0116106_11361751 | 3300009645 | Peatland | MKKISSAVTMESRNFSRQQKLTIGLDLGDRHSWYCV |
Ga0126380_101012682 | 3300010043 | Tropical Forest Soil | MKKGSSAAAQQSRNISQQKLTIGLDLGERNSRYCVLDESG |
Ga0126384_110232051 | 3300010046 | Tropical Forest Soil | MKKVSTVAAKASKKISAQKLTIGLDLGDRNSWYCVLD |
Ga0126384_114917662 | 3300010046 | Tropical Forest Soil | MKKVSTATANEIRNFSEQKLTIGLDLGDRSSCYCLLDE |
Ga0126382_107702442 | 3300010047 | Tropical Forest Soil | MKKSSPAAVRQSRNISRQTLIIGLDLGDRNSWYYVLDEAGQIQLE* |
Ga0126372_100496906 | 3300010360 | Tropical Forest Soil | MKKVSTAAAQQSRNISQQKLTIGLDLGDRNSLAALHE* |
Ga0126372_105436262 | 3300010360 | Tropical Forest Soil | MKKVSTAAMKQGKNISRQRLTIGLDLGDRNSWYCVLDE |
Ga0126378_101040983 | 3300010361 | Tropical Forest Soil | MKKGSTVPESSRNISRQTLTIGLDSGGRNSWYCLVYEVGPI |
Ga0134125_102197983 | 3300010371 | Terrestrial Soil | MKKVSTVVTMQSRNISQQKLSIGLDLGDRNSWYCVLDE |
Ga0126381_1019521952 | 3300010376 | Tropical Forest Soil | MKKGNTAAAKQRRNISQQQLTIGLDLEDRSSWCCVMDEAGSVVQ |
Ga0134124_121931271 | 3300010397 | Terrestrial Soil | MKKTSTAVARQGRNISRQQLTIGLDLGDRNSWYCV |
Ga0138578_10786172 | 3300011110 | Peatlands Soil | MKKVSTVAAKPSRNNSQPKLTIGLDLGDRNSWYCVVDEAG |
Ga0137362_112042341 | 3300012205 | Vadose Zone Soil | MKKVSTGAGRQAKNFSEQKLTIGLDLGDRSSWYCVLD |
Ga0137376_105759371 | 3300012208 | Vadose Zone Soil | MKKISTAVAKQSRNFSQQKLTIGLDLGDRSSCYCVL |
Ga0137378_100855052 | 3300012210 | Vadose Zone Soil | MKKVSTRAAAQSRDISQQKLTIGLDLGDRNSWYCVVDEAG |
Ga0137361_109477801 | 3300012362 | Vadose Zone Soil | MKKVSTAATKPSKNVSQSNLTIGLDLGDRSSCYCVL |
Ga0137404_108027861 | 3300012929 | Vadose Zone Soil | MKKVSTAATKQTNNFGEQKLTIGLDLGDRSSWYCMLDGS |
Ga0126369_103525751 | 3300012971 | Tropical Forest Soil | MKKVSTAAKKQGRNISRQTLTIGLDLGDRNSWYCVL |
Ga0126369_121024461 | 3300012971 | Tropical Forest Soil | MKKNSSAAAMQGRNISRQTLTIGLDLGDRNSWYCV |
Ga0126369_128021631 | 3300012971 | Tropical Forest Soil | MKKVSTAVAKQSRNISRQKLTIGLDLGDRNSWYCVL |
Ga0134110_104181922 | 3300012975 | Grasslands Soil | MKKVSTAVSKGTKNFPEQKLTIGLDLGDRSSWYCVLD |
Ga0157372_102454391 | 3300013307 | Corn Rhizosphere | MKKVSTTLAKQSRKNSQQKLTVGLDLGDRNSWYCVL |
Ga0181537_100446194 | 3300014201 | Bog | MKKVSTVAAQQSRNISQAKLTIGLDLGDRNSWSRWHRRG* |
Ga0182015_100459993 | 3300014495 | Palsa | VKKVSSAVEKVTKNFCQQKLTIGLDLSDRSSWYCSARRSG* |
Ga0182024_101731182 | 3300014501 | Permafrost | MKKISTVTLKQSKNISGEKLMIGLDLGDRSSWYCVPSAH* |
Ga0157376_100150471 | 3300014969 | Miscanthus Rhizosphere | MKKVSTVAAKQSRNISQQKLTIGLDLGDRNSWYCV |
Ga0137403_105563032 | 3300015264 | Vadose Zone Soil | MKKVSTAATKQTNNFGEQKLTIGLDLGDRSSWYCMLDG |
Ga0132258_112356211 | 3300015371 | Arabidopsis Rhizosphere | MKKVSTAATKQSRNISGQKLTIGLDLGDRNSWYCVLD |
Ga0132255_1001347776 | 3300015374 | Arabidopsis Rhizosphere | MKKVSTAATKQSRNISRQKLTIGLDLGDRNSWYCVLDE |
Ga0182041_113634432 | 3300016294 | Soil | MKKVSTAVAKLNRNVSQQKLTIGLDLGDRNSWYCVLDEA |
Ga0182035_117949981 | 3300016341 | Soil | MKKVSTPSTKQGRNISRQSLTIGLDLGDRNSWYCVLD |
Ga0182034_108852152 | 3300016371 | Soil | MKQVSTAVNNQGRIFPQPTLTIGLDLGDRKSWYCVLDEAGQIQLA |
Ga0182039_112573522 | 3300016422 | Soil | MKKVSTEAAKVRRKISRQKVTVGWDLGDRNSWYCVLDESGQIQ |
Ga0182038_121757641 | 3300016445 | Soil | MKKVSTVAVKRIRNVSQQKPTLEKLTIGLDLGDRWSWYCVLDEAG |
Ga0187818_101698951 | 3300017823 | Freshwater Sediment | MRKVSTVAATQSKNFSGQKLTIGLDLGARSSWYCVL |
Ga0187824_100156244 | 3300017927 | Freshwater Sediment | MKKVSTAAAKQSRNFSQQKLTIGLDLGDRNSWYCVVDE |
Ga0187819_100039148 | 3300017943 | Freshwater Sediment | MKKVSTRTAKQSRNISQQKLTIGLDLGDRNSWYCVLD |
Ga0187819_103329782 | 3300017943 | Freshwater Sediment | MKKGSTRAAAQSRNISQQKLTIGLDLGDRNSWYCVVDESGQ |
Ga0187819_103508941 | 3300017943 | Freshwater Sediment | MKKISTAAAKRSRNSSEQKLTIGLDLGDRSSWYCV |
Ga0187819_108595462 | 3300017943 | Freshwater Sediment | MKKGSTAAAKQSTIFSQQKLTIGLDLGDRSSWYCVLDERGELRL |
Ga0187879_102619661 | 3300017946 | Peatland | MKKVSTAAAKQSKNFSQQKLTIGLDLGDRNSWYCVVD |
Ga0187776_100994432 | 3300017966 | Tropical Peatland | MKKVSTVVTRQRKNISQLKLTIGLDLGDRNSWYCVLEEVG |
Ga0187782_100237587 | 3300017975 | Tropical Peatland | MKKVSTAVAKQNRNFSQQKLTIGLDLGDRNSWYCVMDE |
Ga0187823_100732131 | 3300017993 | Freshwater Sediment | MKKVSRAVTKQSKNISQPTLTIGLDLGDRNSWYCV |
Ga0187885_102340721 | 3300018025 | Peatland | MKKISTVGAKQSKKFREQKLTIGLDLGDRSSWYCVLD |
Ga0187867_106328151 | 3300018033 | Peatland | MKKISTLAAQKVEKIEGQKLTIGLDLGDRTSWYCV |
Ga0187771_112181481 | 3300018088 | Tropical Peatland | MKKGSTAATKQGRNISRQTLTIGLDLGDRNSWYCVL |
Ga0182025_13392941 | 3300019786 | Permafrost | MKKVSTAAAKQSKNVSQQKLTSGLDLGDRKQLVLRGG |
Ga0210403_1000318511 | 3300020580 | Soil | MKKVSIRAAAQSRNISQQKLTIGLDLGDRNSWYCVVD |
Ga0210399_102289932 | 3300020581 | Soil | MKKGSTAATKPSRNISQQKLTLGLDLGDRNSWYCVVDQAGQIQLE |
Ga0210400_101482011 | 3300021170 | Soil | MKNVSTAAAKQIRNFSEQKLTIGLDLGDRSSWYCV |
Ga0210405_102473451 | 3300021171 | Soil | MEKVSTAAAKSSSNISQQRLTIGLDLGDRNTWYCVVDETGQMQQ |
Ga0210396_100708701 | 3300021180 | Soil | MRKVSIVTAAQSRNISQQKLTIGLDLGDRNSWYCVVDE |
Ga0210393_111777652 | 3300021401 | Soil | MKKVSTAATKQSRNISQQRLTIGLDLGDRNSCYCVL |
Ga0210393_114808032 | 3300021401 | Soil | MKKISTVAVKQSKNFSEQKLTIGFDLGDRSSWYCVL |
Ga0210394_100003241 | 3300021420 | Soil | MKKVSTVAAKPSKKISQQKLTVGLDLGDRNSWYCVLDE |
Ga0210384_100907561 | 3300021432 | Soil | MKKVSTVTAAQSRNVSQQKLTIGLDLGDRNCWYCVVDEAG |
Ga0210410_100001464 | 3300021479 | Soil | MKKVSTAGAKQTKNFADQKLTIGLDLGDRSSWYCALNEEVVG |
Ga0210410_110632541 | 3300021479 | Soil | MKKVSTAVAKQSRNISQQKLTIGLDLGDRNSWYCVLD |
Ga0210409_10000054209 | 3300021559 | Soil | MRKVSIVTAAQSRNISQQKLTIGLDLGDRNSWYCVVDEGGQIRL |
Ga0126371_1001558413 | 3300021560 | Tropical Forest Soil | MKKVSTAIAQPCRNISQPKRTIGLDLGDRNSWYCVL |
Ga0242648_10314261 | 3300022506 | Soil | MKKVSTMAAKPSKKILQQRLTIGLDLGDRNSWYCFEAVASHS |
Ga0242662_103159461 | 3300022533 | Soil | MKKVSTVAVKQSRNISQQKLTIGLDLGDRNSWYCVVDE |
Ga0222756_10916971 | 3300022709 | Soil | MKKVNTAATKQSRNISQQPLTIGLDLGDRNSWYCVLDE |
Ga0222622_109509983 | 3300022756 | Groundwater Sediment | MKKVSTAARKQINNFGEQKLTIGLDLSDRSSWYCMLD |
Ga0207692_107491862 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKVSTVAAKPGKKISQQKLTVGLDLGDRNSWYCVLD |
Ga0207685_103051221 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTSTAASKQSGNISQQKLTIGLDLGDRNSWYCV |
Ga0207694_112348701 | 3300025924 | Corn Rhizosphere | MKKVSTTLAKQSRKNSQQKLTVGLDLGDRNSWYCVLD |
Ga0207686_112501621 | 3300025934 | Miscanthus Rhizosphere | MKKVSTTTAKQSRNISQQKRTIELDLGDRNSWCCV |
Ga0207704_102427491 | 3300025938 | Miscanthus Rhizosphere | MKKVSIAATRQSRNISQQKLTIGLDLGDRNSWYCVL |
Ga0207651_107168932 | 3300025960 | Switchgrass Rhizosphere | MKKVSATRAKRSRNISQQKRTIGLDLVDPNRWYCGL |
Ga0207677_115598192 | 3300026023 | Miscanthus Rhizosphere | MKKVSTVGAKPSKKISQQKLTVGLDLGDRNSWYCVLDES |
Ga0207702_101690421 | 3300026078 | Corn Rhizosphere | MKKVSTAAAKQSRNVLQSNLTIGLDLGDRSSCYCVLDEEKLCGV |
Ga0209890_101646052 | 3300026291 | Soil | MKKVSIAKTKQRRNIFQQKLTIGLDLGDRNSWYCMVDE |
Ga0209577_101911541 | 3300026552 | Soil | MKKVSTAARCEFGKFAGQRLTIGMDLGDRSSWYCVLDE |
Ga0209418_10217271 | 3300027371 | Forest Soil | MKKGSTAATNRSRSLSQQKLTIGLDRGDRSSWYCV |
Ga0209117_10441012 | 3300027645 | Forest Soil | MKKISTAAAKATKNFFQQKLTIGLDLGDRSSWYCLLDEVC |
Ga0209039_101261072 | 3300027825 | Bog Forest Soil | MKKSSTVAAASNKNFERKLTIGLDLGDRSSWYCVLDEA |
Ga0209517_101156441 | 3300027854 | Peatlands Soil | MKKISTVAAKQSRNCSEQKLTIGLDLGDRSSWYCVLD |
Ga0209517_101819691 | 3300027854 | Peatlands Soil | MKKVSTVGAKPSRNISQQRLTMGLDLGDRNSWYCVVDEAGQIQL |
Ga0209579_104945171 | 3300027869 | Surface Soil | MKKVSTAVAKQSRNISRQRLTIGLDLGDRNSWYCV |
Ga0209067_101331461 | 3300027898 | Watersheds | MKKSSSAATRQSRNISRQTLTIGLDLGDRNSWYCVLDE |
Ga0209415_103802941 | 3300027905 | Peatlands Soil | MKKISTVARKQIRNFSEQKLTIGLDLGDRSSWYCVL |
Ga0209583_105101191 | 3300027910 | Watersheds | MKKISTVTTKKVEKNASQKLTIGLDLGDRSSWYCVLD |
Ga0268264_100631521 | 3300028381 | Switchgrass Rhizosphere | MKKVSIAARKQSRNISQQKLTIGLDLGDRNSWYCVLDEA |
Ga0308309_107529982 | 3300028906 | Soil | MKKVSAIAAKPSKKISQERLTIGLDPGDRNSWYCVLDESGGIQRE |
Ga0265324_102645332 | 3300029957 | Rhizosphere | MKKVSTRALAQSKNISQQKLTIGLDLGDRNSWYCVVDEA |
Ga0265461_113458011 | 3300030743 | Soil | MKKVSAVAATQSKNFREQKLTIGLDLGDRSSWYCVL |
Ga0302324_1006328833 | 3300031236 | Palsa | MKKISTVAAKQNRNFSQPKLTIGLDLGDRSSWYCLLD |
Ga0318560_100671031 | 3300031682 | Soil | MKKVSTAALKQSRNFSQPQLTIGLDLGDRSSCYCVL |
Ga0310686_1020751315 | 3300031708 | Soil | MKKVSTRAAAQSRNISQQKLTIGLDLGDRNSWYCVVD |
Ga0307476_104487262 | 3300031715 | Hardwood Forest Soil | MKKVSTAVSKQSRIFSQPTQTIGFDLGDRNSWYCVPDEAGQIQLEQRVRTNA |
Ga0307474_102738512 | 3300031718 | Hardwood Forest Soil | MKKVSTVTAAQSSNISQQKLTIGLDLGDRNCWYCV |
Ga0307468_1014281063 | 3300031740 | Hardwood Forest Soil | MKNVSTGATKQSRNISQQKLTIGLDLGDRNSWYCVMDEA |
Ga0318547_106397451 | 3300031781 | Soil | MKKGSTVAAKQGRNFKHQKLTIGLDLGDRASWYCVLEQTGAVL |
Ga0302319_1002772413 | 3300031788 | Bog | RRPAMKKVSTVAAKASKKISQQKLTVGLDLGDRNSW |
Ga0307473_101144351 | 3300031820 | Hardwood Forest Soil | MKGSTTAAKESRDFSHQKLTIGLDLGDRSSWYCVLDEAGR |
Ga0306923_115561711 | 3300031910 | Soil | MKKVSTAATMQSRDFCVQQKLTIGLDLGDRHSWYCVLDEAGKVQ |
Ga0310910_101682561 | 3300031946 | Soil | MKKVSTVAAKQAKNLPARSFTEQKLTVGLDLGDRSSWYCVIDESGAVQM |
Ga0307479_106349063 | 3300031962 | Hardwood Forest Soil | MKKGSTIAARASRKISERKLTIGLDLGDRSSCYCVLD |
Ga0310911_105995861 | 3300032035 | Soil | MKKVSTKAGKQTKNFTCQRLTIGLDLSDRSSWYCVLDESG |
Ga0318532_103309781 | 3300032051 | Soil | MKKVSTAALKQSRNFSQPQLSIGLDLGDRSSCYCVL |
Ga0307471_1033175282 | 3300032180 | Hardwood Forest Soil | MKKVSIAAARPSRKISAQKLTVGLDLGDRSSWYCVL |
Ga0335085_103569413 | 3300032770 | Soil | MKKVSTAAMKQSRNISRQKLTIGLDLGDRNSWYCVL |
Ga0335082_100324545 | 3300032782 | Soil | KQSRNISRQTLTIGLDLGDRNSWYCMLDEAGRIQLENLGTDGT |
Ga0335069_1000250931 | 3300032893 | Soil | MKKVSTVATRQSRNISQQKLTIGLDLGDRNSCYCV |
Ga0335072_102732971 | 3300032898 | Soil | MKKVSTAATMESRNFSRQQKLTIGLDLGDGNSWYC |
Ga0335077_110322152 | 3300033158 | Soil | MKKVSTVAMMQSRNFSTQEKLTIGLDLGDRHSWYCVVD |
Ga0335077_117865561 | 3300033158 | Soil | MKEVSTAAGKQSRNFSQQKLTIGLDLGDRNSWYCVL |
Ga0310810_100660415 | 3300033412 | Soil | MKKVSTVATKRSRNFSQPTLTIGLDLGDRNSWYCVLGEA |
Ga0334844_014089_2_118 | 3300033743 | Soil | MKKVSTRAAAQSRNISQQKLTIGLDLGDRNSWYCVVDEA |
⦗Top⦘ |