NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051403

Metagenome / Metatranscriptome Family F051403

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051403
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 39 residues
Representative Sequence MLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS
Number of Associated Samples 111
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.08 %
% of genes near scaffold ends (potentially truncated) 17.36 %
% of genes from short scaffolds (< 2000 bps) 85.42 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.167 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.111 % of family members)
Environment Ontology (ENVO) Unclassified
(28.472 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.861 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF01230HIT 25.00
PF03640Lipoprotein_15 5.56
PF01544CorA 4.17
PF00274Glycolytic 4.17
PF14329DUF4386 1.39
PF09851SHOCT 1.39
PF03793PASTA 1.39
PF00188CAP 0.69
PF05746DALR_1 0.69
PF13396PLDc_N 0.69
PF13360PQQ_2 0.69
PF03448MgtE_N 0.69
PF01566Nramp 0.69
PF00528BPD_transp_1 0.69
PF11987IF-2 0.69
PF00082Peptidase_S8 0.69
PF08044DUF1707 0.69
PF07883Cupin_2 0.69
PF07690MFS_1 0.69
PF10031DUF2273 0.69
PF02894GFO_IDH_MocA_C 0.69
PF13378MR_MLE_C 0.69
PF00849PseudoU_synth_2 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 5.56
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 4.17
COG3588Fructose-bisphosphate aldolase class 1Carbohydrate transport and metabolism [G] 4.17
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.69
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 0.69
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.69
COG0751Glycyl-tRNA synthetase, beta subunitTranslation, ribosomal structure and biogenesis [J] 0.69
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 0.69
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.69
COG2239Mg/Co/Ni transporter MgtE (contains CBS domain)Inorganic ion transport and metabolism [P] 0.69
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.17 %
UnclassifiedrootN/A20.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig16901All Organisms → cellular organisms → Bacteria → Terrabacteria group777Open in IMG/M
2170459019|G14TP7Y01C178XAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
2170459021|G14TP7Y02JS374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
2170459022|GZEQPF101ANBDHNot Available525Open in IMG/M
2199352024|deeps_contig36658.23277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1924Open in IMG/M
3300001686|C688J18823_10056795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2712Open in IMG/M
3300001686|C688J18823_10107885All Organisms → cellular organisms → Bacteria1934Open in IMG/M
3300005181|Ga0066678_11089390Not Available514Open in IMG/M
3300005332|Ga0066388_101639884Not Available1134Open in IMG/M
3300005435|Ga0070714_100078283All Organisms → cellular organisms → Bacteria2873Open in IMG/M
3300005456|Ga0070678_100045206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3149Open in IMG/M
3300005538|Ga0070731_10306812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1054Open in IMG/M
3300005540|Ga0066697_10187292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1229Open in IMG/M
3300005553|Ga0066695_10620981All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300005563|Ga0068855_102028207All Organisms → cellular organisms → Bacteria → Terrabacteria group581Open in IMG/M
3300005564|Ga0070664_100260980All Organisms → cellular organisms → Bacteria1559Open in IMG/M
3300005574|Ga0066694_10206478All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300005578|Ga0068854_100141103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1849Open in IMG/M
3300005598|Ga0066706_11509127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300005614|Ga0068856_100184907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2097Open in IMG/M
3300005764|Ga0066903_100009339All Organisms → cellular organisms → Bacteria9205Open in IMG/M
3300005764|Ga0066903_100116143All Organisms → cellular organisms → Bacteria3696Open in IMG/M
3300005764|Ga0066903_101092547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1469Open in IMG/M
3300005764|Ga0066903_101924465Not Available1133Open in IMG/M
3300005764|Ga0066903_103753106Not Available817Open in IMG/M
3300005764|Ga0066903_104571874Not Available737Open in IMG/M
3300005764|Ga0066903_108006960Not Available542Open in IMG/M
3300005764|Ga0066903_108968861All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300005893|Ga0075278_1038545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300005899|Ga0075271_10100908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300006028|Ga0070717_10020668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5181Open in IMG/M
3300006028|Ga0070717_10232243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1624Open in IMG/M
3300006028|Ga0070717_10492944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1107Open in IMG/M
3300006028|Ga0070717_11046085Not Available743Open in IMG/M
3300006028|Ga0070717_11420244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300006032|Ga0066696_10098531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1752Open in IMG/M
3300006058|Ga0075432_10519972Not Available533Open in IMG/M
3300006059|Ga0075017_100053535All Organisms → cellular organisms → Bacteria → Terrabacteria group2719Open in IMG/M
3300006173|Ga0070716_100617377All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300006173|Ga0070716_100622625All Organisms → cellular organisms → Bacteria → Terrabacteria group815Open in IMG/M
3300006173|Ga0070716_100651675All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium798Open in IMG/M
3300006576|Ga0074047_10101302Not Available509Open in IMG/M
3300006578|Ga0074059_11413552Not Available683Open in IMG/M
3300006578|Ga0074059_11776702All Organisms → cellular organisms → Bacteria → Terrabacteria group1196Open in IMG/M
3300006580|Ga0074049_12992896All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300006804|Ga0079221_10217378All Organisms → cellular organisms → Bacteria → Terrabacteria group1060Open in IMG/M
3300006806|Ga0079220_10085173All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300006806|Ga0079220_10579045All Organisms → cellular organisms → Bacteria → Proteobacteria791Open in IMG/M
3300006806|Ga0079220_11902009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300009098|Ga0105245_10355737Not Available1452Open in IMG/M
3300009137|Ga0066709_102468026All Organisms → cellular organisms → Bacteria → Terrabacteria group703Open in IMG/M
3300009174|Ga0105241_10805273All Organisms → cellular organisms → Bacteria → Terrabacteria group866Open in IMG/M
3300009792|Ga0126374_11373004All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300010048|Ga0126373_11153490Not Available841Open in IMG/M
3300010154|Ga0127503_10005032Not Available577Open in IMG/M
3300010154|Ga0127503_10883418All Organisms → cellular organisms → Bacteria2603Open in IMG/M
3300010154|Ga0127503_11115328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1723Open in IMG/M
3300010320|Ga0134109_10392951Not Available553Open in IMG/M
3300010333|Ga0134080_10082752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1302Open in IMG/M
3300010335|Ga0134063_10157270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1057Open in IMG/M
3300010335|Ga0134063_10541082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300010358|Ga0126370_11133117All Organisms → cellular organisms → Bacteria → Terrabacteria group723Open in IMG/M
3300010358|Ga0126370_11750308Not Available600Open in IMG/M
3300010360|Ga0126372_10154501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1840Open in IMG/M
3300010362|Ga0126377_12091514Not Available642Open in IMG/M
3300010373|Ga0134128_12776168All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300010376|Ga0126381_100656585All Organisms → cellular organisms → Bacteria → Terrabacteria group1497Open in IMG/M
3300010376|Ga0126381_100987163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales1215Open in IMG/M
3300010398|Ga0126383_13419601All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300011106|Ga0151489_1620555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300012199|Ga0137383_11188503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300012211|Ga0137377_10112442All Organisms → cellular organisms → Bacteria2588Open in IMG/M
3300012349|Ga0137387_10311255All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300012914|Ga0157297_10238116All Organisms → cellular organisms → Bacteria → Terrabacteria group652Open in IMG/M
3300012915|Ga0157302_10332958All Organisms → cellular organisms → Bacteria → Terrabacteria group602Open in IMG/M
3300012951|Ga0164300_10169389Not Available1042Open in IMG/M
3300012955|Ga0164298_10728024All Organisms → cellular organisms → Bacteria → Terrabacteria group700Open in IMG/M
3300012957|Ga0164303_10336171All Organisms → cellular organisms → Bacteria → Terrabacteria group906Open in IMG/M
3300012958|Ga0164299_11570355Not Available517Open in IMG/M
3300012960|Ga0164301_10626128All Organisms → cellular organisms → Bacteria → Terrabacteria group798Open in IMG/M
3300012977|Ga0134087_10109164All Organisms → cellular organisms → Bacteria → Terrabacteria group1167Open in IMG/M
3300012977|Ga0134087_10340526Not Available714Open in IMG/M
3300012984|Ga0164309_10723942All Organisms → cellular organisms → Bacteria → Terrabacteria group792Open in IMG/M
3300012986|Ga0164304_10842621All Organisms → cellular organisms → Bacteria → Terrabacteria group712Open in IMG/M
3300012989|Ga0164305_10565778All Organisms → cellular organisms → Bacteria → Terrabacteria group907Open in IMG/M
3300013105|Ga0157369_10400997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1423Open in IMG/M
3300015358|Ga0134089_10164834All Organisms → cellular organisms → Bacteria → Terrabacteria group880Open in IMG/M
3300015371|Ga0132258_12580876All Organisms → cellular organisms → Bacteria → Terrabacteria group1270Open in IMG/M
3300015373|Ga0132257_100857813All Organisms → cellular organisms → Bacteria → Terrabacteria group1136Open in IMG/M
3300017947|Ga0187785_10070892All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300017959|Ga0187779_10039459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2738Open in IMG/M
3300018032|Ga0187788_10549908Not Available505Open in IMG/M
3300018433|Ga0066667_10299107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1250Open in IMG/M
3300018468|Ga0066662_10494093All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300018482|Ga0066669_11634252All Organisms → cellular organisms → Bacteria → Terrabacteria group589Open in IMG/M
3300019362|Ga0173479_10867672Not Available507Open in IMG/M
3300020069|Ga0197907_11405396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium909Open in IMG/M
3300020070|Ga0206356_11297712Not Available503Open in IMG/M
3300020080|Ga0206350_10010368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1183Open in IMG/M
3300021478|Ga0210402_11831544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300021560|Ga0126371_11641844Not Available768Open in IMG/M
3300022467|Ga0224712_10193940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300022467|Ga0224712_10387914All Organisms → cellular organisms → Bacteria → Terrabacteria group664Open in IMG/M
3300024055|Ga0247794_10065704All Organisms → cellular organisms → Bacteria → Terrabacteria group1024Open in IMG/M
3300024347|Ga0179591_1193728Not Available2878Open in IMG/M
3300025910|Ga0207684_10854814All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium767Open in IMG/M
3300025922|Ga0207646_10000502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria52324Open in IMG/M
3300025927|Ga0207687_11212318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300025929|Ga0207664_10007435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium7595Open in IMG/M
3300025929|Ga0207664_10607413All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300025929|Ga0207664_12011576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300026034|Ga0208773_1033203All Organisms → cellular organisms → Bacteria → Terrabacteria group666Open in IMG/M
3300026078|Ga0207702_11133269All Organisms → cellular organisms → Bacteria → Terrabacteria group776Open in IMG/M
3300026109|Ga0208774_1070129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300027765|Ga0209073_10128276All Organisms → cellular organisms → Bacteria → Terrabacteria group920Open in IMG/M
3300027869|Ga0209579_10133396All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300027907|Ga0207428_10349343All Organisms → cellular organisms → Bacteria → Terrabacteria group1088Open in IMG/M
3300031057|Ga0170834_101618642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300031199|Ga0307495_10059499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300031226|Ga0307497_10394056All Organisms → cellular organisms → Bacteria → Terrabacteria group660Open in IMG/M
3300031226|Ga0307497_10409513Not Available650Open in IMG/M
3300031543|Ga0318516_10418524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300031544|Ga0318534_10011090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4530Open in IMG/M
3300031572|Ga0318515_10427687All Organisms → cellular organisms → Bacteria → Terrabacteria group708Open in IMG/M
3300031858|Ga0310892_11130056Not Available556Open in IMG/M
3300031938|Ga0308175_100069914All Organisms → cellular organisms → Bacteria3122Open in IMG/M
3300031938|Ga0308175_100200561All Organisms → cellular organisms → Bacteria1964Open in IMG/M
3300031939|Ga0308174_10084330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2242Open in IMG/M
3300031939|Ga0308174_10787253All Organisms → cellular organisms → Bacteria → Terrabacteria group798Open in IMG/M
3300032001|Ga0306922_12080138All Organisms → cellular organisms → Bacteria → Terrabacteria group551Open in IMG/M
3300032076|Ga0306924_12222713All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300032180|Ga0307471_101553951Not Available819Open in IMG/M
3300032261|Ga0306920_100513930All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300032261|Ga0306920_103766795All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300032770|Ga0335085_10024188All Organisms → cellular organisms → Bacteria8576Open in IMG/M
3300032770|Ga0335085_10501120All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1386Open in IMG/M
3300032770|Ga0335085_12227696Not Available550Open in IMG/M
3300032783|Ga0335079_10116042All Organisms → cellular organisms → Bacteria3025Open in IMG/M
3300032893|Ga0335069_10042250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6065Open in IMG/M
3300032893|Ga0335069_10850750Not Available1023Open in IMG/M
3300032955|Ga0335076_10113725All Organisms → cellular organisms → Bacteria2632Open in IMG/M
3300033004|Ga0335084_10222499All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1959Open in IMG/M
3300033412|Ga0310810_11313094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300033475|Ga0310811_11259000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.11%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.25%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.47%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.78%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.78%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.08%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.08%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.39%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.39%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.39%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.39%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter1.39%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.69%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.69%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.69%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.69%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
2170459021Litter degradation NP4EngineeredOpen in IMG/M
2170459022Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition)EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300005899Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026034Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026109Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_000605702166559006Grass SoilMLVDVVAVLVLVLMAADVFRMLFVDTEPERDPVRRADRPERGG
4MG_041762802170459019Switchgrass, Maize And Mischanthus LitterMLVEVVAVLVLVLMGADVFRMLFLDTEPRRDPVRRNAPSG
4NP_002921402170459021Switchgrass, Maize And Mischanthus LitterMLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS
FA2_052266802170459022Grass SoilMSVEVVAVLVLVLMAADVFRMVFIDTEPQREPVRRNDS
deeps_039486502199352024SoilMLVDVVAVLVMVLMAGDVVRMLFVDSEPHGDPVRRNDS
C688J18823_1005679523300001686SoilMLVDVVAALVLVLMAADVFRMLFVDTETQRDPVRRNNS*
C688J18823_1010788533300001686SoilMAVDVVAVLVLVLMAADAFRMLFVDTEPQRDPVRRNDP*
Ga0066678_1108939023300005181SoilMDMLVEVVAVLVLVLMTADVLRMLFADSEPQRDPVRRRDS*
Ga0066388_10163988413300005332Tropical Forest SoilYDESMLVQVVAVIVLVLMAADILRMLFADTEPQRDPVRRRNS*
Ga0070714_10007828333300005435Agricultural SoilMHMLVDVVAVLVLVLMAADVFRMLLIDTEPHRDPARRDDS*
Ga0070678_10004520613300005456Miscanthus RhizosphereVAVDVVAALVLVLMAADVFRMLFVDTELQRDPVRRNDPSG*
Ga0070731_1030681223300005538Surface SoilVIVDVVAVLVLVLMGADVVRMLFVDPEPRHDPARRQDS*
Ga0066697_1018729233300005540SoilMAVEVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDP*
Ga0066695_1062098123300005553SoilMAVDLVAVLVLVLMAMDVFRMLFVDTEPQRDPVRRNDP*
Ga0068855_10202820723300005563Corn RhizosphereVAVDVVAALVLVLMAADVFRMLFVDTELQRDPVRRNDS*
Ga0070664_10026098043300005564Corn RhizosphereMLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS*
Ga0066694_1020647823300005574SoilMAVDLVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDP*
Ga0068854_10014110333300005578Corn RhizosphereMLVDVVAVLVLALMAADVFRMLFVDTEPRRDPDRPNGS*
Ga0066706_1150912713300005598SoilVVAVLVLVLMAMDVFRMLFVDTEPQRDPVRRNDP*
Ga0068856_10018490753300005614Corn RhizosphereMLVEVVAVLVLVLMGADVFRMVFLDTEPRRDPVRRNDP*
Ga0066903_10000933933300005764Tropical Forest SoilMLVQVVAVLVLVLMTADILRMLFADTEPQRDPVRRRDT*
Ga0066903_10011614363300005764Tropical Forest SoilMLVQVVAVLVLVLMAADILRMLFADTEPQRDPVRRRDS*
Ga0066903_10109254723300005764Tropical Forest SoilMAVDVVAVLVLVLMAADTFRMLFVDTEPQRDPARRRDA*
Ga0066903_10192446533300005764Tropical Forest SoilMAVAVVAVLVLVLMAADTFRMLFIDTEPQRDPVRRRDS*
Ga0066903_10375310623300005764Tropical Forest SoilVLVDVVAVLVLVLMAADVFRMLYLDDEPQRDPVRRDDS*
Ga0066903_10457187423300005764Tropical Forest SoilMAVDVVAVLVLVLMAADTFRMLFIDTEPQRDPVRRRDS*
Ga0066903_10800696023300005764Tropical Forest SoilMAVDVVAVLVLVLMAADVFRMLFIDTEPQHDPVRRRDS*
Ga0066903_10896886123300005764Tropical Forest SoilMLVQVVAVIVLVLMAADILRMLFAEAEPERNPVRRRDS*
Ga0075278_103854523300005893Rice Paddy SoilMAVDVVAVLVLLLMLGDVIRMLFDDAEPHRDPARRNGS*
Ga0075271_1010090813300005899Rice Paddy SoilVLVDVVAALVMLLMLGDVIRMLFVDPEPQRDPVRGNDS*
Ga0070717_1002066843300006028Corn, Switchgrass And Miscanthus RhizosphereMLVDVVAVLVLVLMAADVFRMLFVDTEPPGDPARRRDS*
Ga0070717_1023224313300006028Corn, Switchgrass And Miscanthus RhizosphereMLVEVVAVLVLVLMAADVFRMVFLDTDPQRDPVRRNDR*
Ga0070717_1049294413300006028Corn, Switchgrass And Miscanthus RhizosphereMLVEVVAVLVLVLMGADVFRMLFLDTEPQRDPVRRNDP*
Ga0070717_1104608523300006028Corn, Switchgrass And Miscanthus RhizosphereMHMLVDVVAVLVLVLMAADVFRMLFIDTEPQRDPARRDDS*
Ga0070717_1142024413300006028Corn, Switchgrass And Miscanthus RhizosphereMLVDVVAALVLVLMAADVFRMLFIDTEPQRVETRRDPVRRGDS*
Ga0066696_1009853143300006032SoilMAVEVVAVLVLVLMAMDVFRMLFVDTEPQRDPVRRNDP*
Ga0075432_1051997213300006058Populus RhizosphereVAVYVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS*
Ga0075017_10005353553300006059WatershedsVLVDVVAVLVLVLMVADVFRMLFVDSGPQHDPVCRDDS*
Ga0070716_10061737723300006173Corn, Switchgrass And Miscanthus RhizosphereMLVDVVAALVLVLMAADVFRMLFVDTEPQRAPARRDDA*
Ga0070716_10062262523300006173Corn, Switchgrass And Miscanthus RhizosphereVAVDVVAVLVLVLMAADVFRMLFVDTELQRDPVRRNDS*
Ga0070716_10065167513300006173Corn, Switchgrass And Miscanthus RhizosphereDGAQGYDTAMLVDVVAVLVLVLMAADVFRMLFIDTEPQRDPARRDDS*
Ga0074047_1010130213300006576SoilDVVAVLVLVLMAADVFRMLFIDTEPQRDPARRDDS*
Ga0074059_1141355223300006578SoilMVEVVAVLVLVLMAADVLRMLFADAEPQRDPVRRRDS*
Ga0074059_1177670223300006578SoilMLVDVVAVVVMLLMLGDVIRMLFVDTEPEPQRDPVRRNDFQ*
Ga0074049_1299289613300006580SoilMYMLVDVVAVLVLVLMAADVFRMLFIDTEPQRDPARRDDS*
Ga0079221_1021737823300006804Agricultural SoilMLVDAVAVLVLVLMAADVFRMLFVDTEPERNPARRGDS*
Ga0079220_1008517333300006806Agricultural SoilMLVNAVAVLVLVLMAADVFRMLFVDTEPERNPARRNDS*
Ga0079220_1057904533300006806Agricultural SoilMAVDVVAVLVLVLMAADTFRMLFIDTEPQRDPARR
Ga0079220_1190200913300006806Agricultural SoilMAVDVVAVLVLVLMAADTFRMLFIDTEPQRDPARRRDS*
Ga0105245_1035573743300009098Miscanthus RhizosphereRARGYDENVAVYVVAVLVLVLMAADVFRMLFVDTEPQHGPVRRNDS*
Ga0066709_10246802613300009137Grasslands SoilMAVDVVAALVLLLMAADVFRMLFVDTEPQREPVRRRDS*
Ga0105241_1080527323300009174Corn RhizosphereMLVDVVAVLVLVLMAADVFRMLFVDTEPQHGPVRRNDS*
Ga0126374_1137300413300009792Tropical Forest SoilMLVQVVAVIVLVLMAADILRMLFADAEPQRNPVRRRDS*
Ga0126373_1115349013300010048Tropical Forest SoilMLVDVVAVLVLVLMAADVFRMLFIDTEPQRDRAHRDNT*
Ga0127503_1000503223300010154SoilEHMLVDVVAVLVLLLMAADVFRMLFVDTEPQRDPVRRDDF*
Ga0127503_1088341823300010154SoilMLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRADRPERGG*
Ga0127503_1111532843300010154SoilMLVDVVAVLVLLLMGADVFRMLFIDTEPQRDPVRRDDF*
Ga0134109_1039295123300010320Grasslands SoilMAVDLVAVLVLVLMAADVFRMLFVDTEPQRDPVRRND
Ga0134080_1008275233300010333Grasslands SoilMAVEVVAVLVLVLMAADVLRMLFVDTEPQRDPVRRNDP*
Ga0134063_1015727023300010335Grasslands SoilMLVDVVAVLVLVLMAADAFRMLFVDTEPQRDRVRRNNS*
Ga0134063_1054108223300010335Grasslands SoilYDENMAVEVVAVLVLVLMAMDVFRMLFVDTEPQRDPVRRNDP*
Ga0126370_1113311723300010358Tropical Forest SoilMLVQVVAVLVLVLMAADILRMLFADTEPQRDPVRRRNS*
Ga0126370_1175030813300010358Tropical Forest SoilVTVELVAVLVLVLMAADILRMLFADDEPQRNPVRRRDS*
Ga0126372_1015450133300010360Tropical Forest SoilMLVQVVAVIVLVLMAADILRMLFADTEPQRDPVRRRNS*
Ga0126377_1209151413300010362Tropical Forest SoilMLVDVVAVLVLVLMTADILRMLFADEEPQRHSVRRRDS*
Ga0134128_1277616823300010373Terrestrial SoilMVVDVVAALVLLLMAGDVLRMVFVDPEPRRDPVRRNDS*
Ga0126381_10065658513300010376Tropical Forest SoilMLVDIVAVLVLVLMAADVFRMLYLDDEPQRDPVRRDDS*
Ga0126381_10098716333300010376Tropical Forest SoilLRGYDKHMLVDVVAVLVLVLMAADVFRMLFIDTEPPRDPARRDHS*
Ga0126383_1341960123300010398Tropical Forest SoilMAVDVVAVLVLVLMAADTFRMLFIDTEAQRDPVRRRDS*
Ga0151489_162055523300011106SoilMLVDVVAVLVLLLMLGDVIRMLFVDTEPEPQREPVRRNDSQ*
Ga0137383_1118850323300012199Vadose Zone SoilMLVDVVAVLVMLLMLGDVIRMLFVDTEPQRNPVRRSDSQ*
Ga0137377_1011244243300012211Vadose Zone SoilMLVDVVAVLVMLLMLGDVIRMLFVDTEPQRAPVRRSDSQ*
Ga0137387_1031125533300012349Vadose Zone SoilMLVDVVAVLVMLLMLGDVIRMLFVDTEPQRDPVRRNDS*
Ga0157297_1023811623300012914SoilVAVDVVAALVLVLMAADVFRMLFIDTEPQRDPVRRNDP*
Ga0157302_1033295823300012915SoilVAVDVVAALVLVLMAADVFRMLFVDTEQQRDPVRRNDS*
Ga0164300_1016938923300012951SoilVAVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS*
Ga0164298_1072802423300012955SoilMLVEVVAVLVMLLMLGDVIRMLFVDTEPQRDPVRRTDR*
Ga0164303_1033617133300012957SoilVAVDVVAVLVLVLMAADVFRMVVLDTEPRRDLARRDDS*
Ga0164299_1157035523300012958SoilVVVDVVAALVLVLMAADVFRMLFVDTEPQRGAVRRNDY*
Ga0164301_1062612823300012960SoilMLVEVVAVLVMLLMLGDVIRMLCVDTEPQRDPVRRTDR*
Ga0134087_1010916413300012977Grasslands SoilMAVDLVAVLVLVLMAMDVFRMLFVDTEPQRDPVRR
Ga0134087_1034052613300012977Grasslands SoilMAVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRRDS*
Ga0164309_1072394213300012984SoilMAVDVVASLVLLLMAADMFRMLFIDTELQRDPVRRHDSRL*
Ga0164304_1084262113300012986SoilVAVDVVAVLVLVLMAADVFRMLFVDTEPQRGAVRRNDY*
Ga0164305_1056577823300012989SoilMLVDVVAALVLGLMAADVFRMLFVDTEPQRAPARRDDA*
Ga0157369_1040099733300013105Corn RhizosphereMLVEVVAVLVLVLMGADVFRMLFLDTEPRRDPVRRNDP*
Ga0134089_1016483423300015358Grasslands SoilMAVEVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNNS*
Ga0132258_1258087633300015371Arabidopsis RhizosphereVAVDVVAVLVLVLMAADVFRMLFIDTEPQRDPVRRNDS*
Ga0132257_10085781323300015373Arabidopsis RhizosphereVAVDVVAVLVLVLMAADVFRMLFVDTEPERDPVRRNDS*
Ga0187785_1007089213300017947Tropical PeatlandMLVQVVAVLVLVLMGADVLRMLFADPEPRRDPVRRRDS
Ga0187779_1003945923300017959Tropical PeatlandMLVDVVAVVVLLLMAGDVFRMLFIDTEPQRDRVRRNDDS
Ga0187788_1054990823300018032Tropical PeatlandMLVQVVAVVVLVLMGADVLRMLFADPEPQRDPVRRRDS
Ga0066667_1029910713300018433Grasslands SoilMLVDVVAVLVLVLMAADAFRMLFVDTEPQRDPVRRNNS
Ga0066662_1049409333300018468Grasslands SoilMAVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDP
Ga0066669_1163425223300018482Grasslands SoilMAVEVVAVLVLVLMAMDVFRMLFVDTEPQRDPVRRNDP
Ga0173479_1086767213300019362SoilVAVDVVAALVLVLMAADVFRMLFIDTELQRDPVRRNDS
Ga0197907_1140539633300020069Corn, Switchgrass And Miscanthus RhizosphereVDVVAALVLLLMAGDVLRMVFVDPEPRRDPVRRNDS
Ga0206356_1129771213300020070Corn, Switchgrass And Miscanthus RhizosphereVSVDVGAALVLVLMAADVFRMLFVDTELQRDPVRRNDS
Ga0206350_1001036833300020080Corn, Switchgrass And Miscanthus RhizosphereDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS
Ga0210402_1183154423300021478SoilMLVDVVAVVVMLLMLGDVIRMLFVDTEPEPQRDPVRRNDFQ
Ga0126371_1164184423300021560Tropical Forest SoilMLVDVVAVLVLVLMAADVFRMLFIDTEPQRDPARRDHS
Ga0224712_1019394013300022467Corn, Switchgrass And Miscanthus RhizosphereMLVEVVAVLVLVLMGADVFRMLFLDTEPRRDPVRRNDP
Ga0224712_1038791423300022467Corn, Switchgrass And Miscanthus RhizosphereVAVDVVAALVLVLMAADVFRMLFVDTELQRDPVRRNDS
Ga0247794_1006570433300024055SoilMTRNVAVDVVAVLVLVLMAADAFRMLLVDTEPRRDPARR
Ga0179591_119372843300024347Vadose Zone SoilMAVDLVAALVLVLMAADVFRMLFVDTEPQRDPVRRNDS
Ga0207684_1085481413300025910Corn, Switchgrass And Miscanthus RhizosphereVAVDVVAALVLVLMAADVFRMLFVDTEPQRDPVRRN
Ga0207646_10000502123300025922Corn, Switchgrass And Miscanthus RhizosphereMLVQVVAVLVLVLMLADIFRMLFADPEPQRAPVRRRDS
Ga0207687_1121231813300025927Miscanthus RhizosphereTMLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS
Ga0207664_1000743513300025929Agricultural SoilMLVEVVAVLVLVLMAADVFRMVFLDTDPQRDPVRRHDR
Ga0207664_1060741323300025929Agricultural SoilMHMLVDVVAVLVLVLMAADVFRMLLIDTEPHRDPARRDDS
Ga0207664_1201157613300025929Agricultural SoilVEVVAVLVLVLMGADVFRMLFLDTEPQRDPVRRNDP
Ga0208773_103320323300026034Rice Paddy SoilMAVDVVAVLVLLLMLGDVIRMLFDDAEPHRDPARRNGS
Ga0207702_1113326933300026078Corn RhizosphereMLVEVVAVLVLVLMGADVFRMLFLDTEPRRDPVRR
Ga0208774_107012913300026109Rice Paddy SoilVTVAVVAVLVMLLMLGDVIRMLFDDAEPHRDPARRNGS
Ga0209073_1012827623300027765Agricultural SoilMLVNAVAVLVLVLMAADVFRMLFVDTEPERNPARRGDS
Ga0209579_1013339623300027869Surface SoilVIVDVVAVLVLVLMGADVVRMLFVDPEPRHDPARRQDS
Ga0207428_1034934323300027907Populus RhizosphereVAVYVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS
Ga0170834_10161864223300031057Forest SoilMLVDVVAVLVLLLMAADTFRMLFVDTEPHRGPARRDDS
Ga0307495_1005949923300031199SoilVVVEVVAVLVLVLMAADVFRMLFIDTEPQRNPVRRNDS
Ga0307497_1039405613300031226SoilMVVEVVAVLVLVLMAADVFRMLFIDTEPQRNPVRRNDS
Ga0307497_1040951333300031226SoilVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS
Ga0318516_1041852433300031543SoilYSTMLVDVVAVLVLVLMAADVFRMLFIDTEPQREPARRDDSRR
Ga0318534_1001109033300031544SoilMLVDVVAVLVLVLMAADVFRMLFIDTEPQREPARRDDSRR
Ga0318515_1042768713300031572SoilMLVDVVAVLVLVLMAADVFRMLFIDTEPQREPARRDDSR
Ga0310892_1113005633300031858SoilVAVDVVAVLVLVLMAADVFRMLFIDTEPQRDPVRRNDS
Ga0308175_10006991463300031938SoilMLVDVVAALVLVLMAGDVLRMLFVDPEPHGDPVRRNDS
Ga0308175_10020056123300031938SoilMAVDVVAVLVLVLMAADIFRMLFVDTELQRDPVRRRNDS
Ga0308174_1008433043300031939SoilMAVDLVAVLVLVLMAADVYRMLFVDTEPPRDAVRRDGS
Ga0308174_1078725323300031939SoilVKVLVDVVAVLVLVLMAGDVYRMLFVDTEPQHETARRGDS
Ga0306922_1208013823300032001SoilMLVDVVAVLVLVLMGADVFRMLFIDTEPQREPARRDDSRR
Ga0306924_1222271323300032076SoilMLVDVVAVLVLVLMGADVFRMLFIDTEPQRTSARRDDSRR
Ga0307471_10155395113300032180Hardwood Forest SoilMLVDVVAVLVLLLMAGDVFRMLFIDTEPQHEHARRNDS
Ga0306920_10051393043300032261SoilMLVDVVAVLVLVLMAADMFRMLFIDTEPQREPARRDDSRR
Ga0306920_10376679523300032261SoilMLVEVVAVLVLVLMGADVLRMLFADAEPQRNPVRRRDSSR
Ga0335085_1002418823300032770SoilMLVDVVAVLVLLLMGADIFRMLFVDTEPHRNPVRRDDS
Ga0335085_1050112023300032770SoilMLVDVVAVLVLLLMAGDVFRMLFVDTEPQRNPVRRND
Ga0335085_1222769613300032770SoilVLVDVVAVLVLVLMGADVFRMLFIDTEPPRYAARRRDS
Ga0335079_1011604233300032783SoilVLVDLVAVLVLVLLAADVFRMLFVDTEPRRDPVRRHDS
Ga0335069_1004225033300032893SoilMLVDLVAVLVLLLMAGDVFRMLFVDTEPQRNPVRRND
Ga0335069_1085075023300032893SoilVLVDVVAVLVLVLMAADVFRMLFVDDEPHRSSVRRDDS
Ga0335076_1011372513300032955SoilVLVDLVAVLVLVLLAADVFRMLFVDTEPRHDPVRRHDS
Ga0335084_1022249923300033004SoilMLVDVVAAFVLVLMAADVFRMLFVDTEPQRAPARRDDT
Ga0310810_1131309413300033412SoilYDKTMLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS
Ga0310811_1125900023300033475SoilGYDETMLVDVVAVLVLVLMAADVFRMLFVDTEPQRDPVRRNDS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.