NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F051838

Metagenome Family F051838

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051838
Family Type Metagenome
Number of Sequences 143
Average Sequence Length 42 residues
Representative Sequence MLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKD
Number of Associated Samples 107
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 64.34 %
% of genes near scaffold ends (potentially truncated) 99.30 %
% of genes from short scaffolds (< 2000 bps) 90.21 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.301 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(27.273 % of family members)
Environment Ontology (ENVO) Unclassified
(60.140 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(66.434 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.56%    β-sheet: 23.26%    Coil/Unstructured: 44.19%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF01734Patatin 43.36
PF00571CBS 9.79
PF09925DUF2157 5.59
PF030614HBT 4.90
PF13414TPR_11 2.80
PF02540NAD_synthase 2.10
PF00730HhH-GPD 2.10
PF08308PEGA 2.10
PF13360PQQ_2 1.40
PF09969DUF2203 0.70
PF0563523S_rRNA_IVP 0.70
PF13349DUF4097 0.70
PF10576EndIII_4Fe-2S 0.70
PF02537CRCB 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 143 Family Scaffolds
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 43.36
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 43.36
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 43.36
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 2.10
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 2.10
COG0177Endonuclease IIIReplication, recombination and repair [L] 2.10
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 2.10
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 2.10
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 2.10
COG0239Fluoride ion exporter CrcB/FEX, affects chromosome condensationCell cycle control, cell division, chromosome partitioning [D] 0.70

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.30 %
UnclassifiedrootN/A0.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001686|C688J18823_10851445All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11579Open in IMG/M
3300002560|JGI25383J37093_10068481All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300002560|JGI25383J37093_10071653All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1074Open in IMG/M
3300002908|JGI25382J43887_10051955All Organisms → cellular organisms → Bacteria2227Open in IMG/M
3300004281|Ga0066397_10016001All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1048Open in IMG/M
3300005171|Ga0066677_10594004All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium629Open in IMG/M
3300005171|Ga0066677_10606225All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005172|Ga0066683_10622048All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium651Open in IMG/M
3300005178|Ga0066688_10815231All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium582Open in IMG/M
3300005180|Ga0066685_10152315All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1573Open in IMG/M
3300005180|Ga0066685_10507541All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes834Open in IMG/M
3300005180|Ga0066685_10759246All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium660Open in IMG/M
3300005180|Ga0066685_11104114All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005341|Ga0070691_10659680All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes624Open in IMG/M
3300005406|Ga0070703_10073358All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1148Open in IMG/M
3300005445|Ga0070708_100559327All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1079Open in IMG/M
3300005446|Ga0066686_10203490All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300005447|Ga0066689_10974657All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium522Open in IMG/M
3300005451|Ga0066681_10747035All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11593Open in IMG/M
3300005467|Ga0070706_100355492All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300005471|Ga0070698_102083606All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium521Open in IMG/M
3300005518|Ga0070699_100056757All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3391Open in IMG/M
3300005536|Ga0070697_100830662All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300005547|Ga0070693_100393679All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300005553|Ga0066695_10499295All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium747Open in IMG/M
3300005558|Ga0066698_10496433All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300005558|Ga0066698_10611035All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium733Open in IMG/M
3300005561|Ga0066699_10170942All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1497Open in IMG/M
3300005574|Ga0066694_10139555All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1146Open in IMG/M
3300005576|Ga0066708_10123532All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1564Open in IMG/M
3300005576|Ga0066708_10638920All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium679Open in IMG/M
3300005598|Ga0066706_10798277All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes744Open in IMG/M
3300006031|Ga0066651_10114206All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1377Open in IMG/M
3300006034|Ga0066656_10090276All Organisms → cellular organisms → Bacteria1844Open in IMG/M
3300006046|Ga0066652_101106444All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium750Open in IMG/M
3300006049|Ga0075417_10185768All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes979Open in IMG/M
3300006791|Ga0066653_10438611All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11666Open in IMG/M
3300006796|Ga0066665_11571505All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium516Open in IMG/M
3300006797|Ga0066659_11336669All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium598Open in IMG/M
3300006797|Ga0066659_11490004All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium566Open in IMG/M
3300006852|Ga0075433_10158149All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300006852|Ga0075433_10338714All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1329Open in IMG/M
3300006854|Ga0075425_100837617All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1053Open in IMG/M
3300006880|Ga0075429_100829053All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300006880|Ga0075429_101437698All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11600Open in IMG/M
3300006903|Ga0075426_10446362All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes958Open in IMG/M
3300006903|Ga0075426_10844407All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300006918|Ga0079216_10204547All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1086Open in IMG/M
3300007258|Ga0099793_10013810All Organisms → cellular organisms → Bacteria3197Open in IMG/M
3300007265|Ga0099794_10629700All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes569Open in IMG/M
3300009012|Ga0066710_100554860All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1738Open in IMG/M
3300009012|Ga0066710_100662413All Organisms → cellular organisms → Bacteria1589Open in IMG/M
3300009012|Ga0066710_101044303All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300009012|Ga0066710_101660278All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes975Open in IMG/M
3300009089|Ga0099828_11209507All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300009090|Ga0099827_10284198All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1397Open in IMG/M
3300009090|Ga0099827_11901318All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium519Open in IMG/M
3300009137|Ga0066709_100753298All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1406Open in IMG/M
3300009137|Ga0066709_102052785All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium791Open in IMG/M
3300010303|Ga0134082_10095868All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300010303|Ga0134082_10530423All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium516Open in IMG/M
3300010329|Ga0134111_10135641All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes966Open in IMG/M
3300010333|Ga0134080_10083906All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1293Open in IMG/M
3300010333|Ga0134080_10644009All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes520Open in IMG/M
3300010333|Ga0134080_10652399All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11517Open in IMG/M
3300010335|Ga0134063_10438008All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium646Open in IMG/M
3300010337|Ga0134062_10124921All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1125Open in IMG/M
3300011438|Ga0137451_1035017All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1460Open in IMG/M
3300012179|Ga0137334_1136233All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes556Open in IMG/M
3300012200|Ga0137382_11309574All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium511Open in IMG/M
3300012203|Ga0137399_10177731All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300012207|Ga0137381_10123659All Organisms → cellular organisms → Bacteria2212Open in IMG/M
3300012207|Ga0137381_10137977All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2092Open in IMG/M
3300012207|Ga0137381_10665467All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes906Open in IMG/M
3300012209|Ga0137379_11838172All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012210|Ga0137378_10454599All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300012285|Ga0137370_10227270All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1101Open in IMG/M
3300012918|Ga0137396_10467024All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11935Open in IMG/M
3300012925|Ga0137419_10421047All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1047Open in IMG/M
3300012944|Ga0137410_11880296All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11530Open in IMG/M
3300012948|Ga0126375_10806235All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes744Open in IMG/M
3300012971|Ga0126369_10770372All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300012972|Ga0134077_10365014All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11618Open in IMG/M
3300012972|Ga0134077_10406054All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11589Open in IMG/M
3300012975|Ga0134110_10429916All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium590Open in IMG/M
3300012976|Ga0134076_10034443All Organisms → cellular organisms → Bacteria1859Open in IMG/M
3300014150|Ga0134081_10016989All Organisms → cellular organisms → Bacteria2020Open in IMG/M
3300014157|Ga0134078_10056586All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1372Open in IMG/M
3300014157|Ga0134078_10259611All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300014157|Ga0134078_10270378All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes720Open in IMG/M
3300014166|Ga0134079_10043594All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1554Open in IMG/M
3300015052|Ga0137411_1265225All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11728Open in IMG/M
3300015356|Ga0134073_10037795All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1244Open in IMG/M
3300015359|Ga0134085_10333828All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium671Open in IMG/M
3300017659|Ga0134083_10100033All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300018054|Ga0184621_10129164All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11906Open in IMG/M
3300018431|Ga0066655_10105749All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1587Open in IMG/M
3300018431|Ga0066655_10423983All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes878Open in IMG/M
3300018431|Ga0066655_10826257All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium631Open in IMG/M
3300018433|Ga0066667_10253445All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1336Open in IMG/M
3300018433|Ga0066667_10385222All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1128Open in IMG/M
3300018468|Ga0066662_10862658All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11885Open in IMG/M
3300018482|Ga0066669_11042463All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11738Open in IMG/M
3300018482|Ga0066669_11248427All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11671Open in IMG/M
3300019360|Ga0187894_10217768Not Available922Open in IMG/M
3300019877|Ga0193722_1001704All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae5202Open in IMG/M
3300020004|Ga0193755_1028155All Organisms → cellular organisms → Bacteria1860Open in IMG/M
3300020004|Ga0193755_1126426All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11793Open in IMG/M
3300021344|Ga0193719_10006190All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae4930Open in IMG/M
3300026295|Ga0209234_1056778All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1489Open in IMG/M
3300026296|Ga0209235_1205658All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes667Open in IMG/M
3300026297|Ga0209237_1043562All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2324Open in IMG/M
3300026298|Ga0209236_1060227All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300026298|Ga0209236_1066230All Organisms → cellular organisms → Bacteria1731Open in IMG/M
3300026300|Ga0209027_1141685All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11825Open in IMG/M
3300026301|Ga0209238_1215864All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium564Open in IMG/M
3300026313|Ga0209761_1140039All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300026313|Ga0209761_1192543All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium908Open in IMG/M
3300026315|Ga0209686_1096254All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300026315|Ga0209686_1122453All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes865Open in IMG/M
3300026317|Ga0209154_1103844All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1210Open in IMG/M
3300026318|Ga0209471_1019690All Organisms → cellular organisms → Bacteria3418Open in IMG/M
3300026324|Ga0209470_1239893All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11733Open in IMG/M
3300026324|Ga0209470_1386894All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11500Open in IMG/M
3300026329|Ga0209375_1274010All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium555Open in IMG/M
3300026331|Ga0209267_1337061All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11500Open in IMG/M
3300026343|Ga0209159_1002017All Organisms → cellular organisms → Bacteria14630Open in IMG/M
3300026527|Ga0209059_1015212All Organisms → cellular organisms → Bacteria3491Open in IMG/M
3300026527|Ga0209059_1110238All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1083Open in IMG/M
3300026532|Ga0209160_1000581All Organisms → cellular organisms → Bacteria30465Open in IMG/M
3300026532|Ga0209160_1163043All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes988Open in IMG/M
3300026537|Ga0209157_1107791All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300026538|Ga0209056_10237129All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1305Open in IMG/M
3300026540|Ga0209376_1069454All Organisms → cellular organisms → Bacteria1923Open in IMG/M
3300026547|Ga0209156_10299016All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11727Open in IMG/M
3300026557|Ga0179587_10996042All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium552Open in IMG/M
3300027778|Ga0209464_10074243All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1143Open in IMG/M
3300027787|Ga0209074_10267754All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes671Open in IMG/M
3300027875|Ga0209283_10348082All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300027875|Ga0209283_10417548All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300031152|Ga0307501_10206846All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_66_11564Open in IMG/M
3300031740|Ga0307468_100334654All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1120Open in IMG/M
3300032180|Ga0307471_100427623All Organisms → cellular organisms → Bacteria1458Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil27.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil18.18%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil13.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.50%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.50%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.40%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.40%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.40%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.70%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.70%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J18823_1085144523300001686SoilMRASEVMIADPVVAAAGATSSEVAALMRIKNISVVPVVDN
JGI25383J37093_1006848123300002560Grasslands SoilLRASEVMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNP
JGI25383J37093_1007165313300002560Grasslands SoilMRASEIMIADPVVAAAGATSAEVAALMRVKNISVVPVVDN
JGI25382J43887_1005195513300002908Grasslands SoilLRASDVMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNP
Ga0066397_1001600123300004281Tropical Forest SoilMRASEVMIAEPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDRKYLGT
Ga0066677_1059400423300005171SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPK
Ga0066677_1060622523300005171SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDR
Ga0066683_1062204813300005172SoilLRASEVMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLG
Ga0066688_1081523113300005178SoilMLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPLVDNPKDRRY
Ga0066685_1015231513300005180SoilMLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGTI
Ga0066685_1050754113300005180SoilMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGTI
Ga0066685_1075924623300005180SoilLLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPK
Ga0066685_1110411413300005180SoilMLAREIMIPEPFVAAAGATTAEVALLMRAKDISVVPVVDNPKDR
Ga0070691_1065968013300005341Corn, Switchgrass And Miscanthus RhizosphereLLARDVMIASPVVVAAGATSAEVASLMKLRNISVAPVVDNPKDLGYLG
Ga0070703_1007335813300005406Corn, Switchgrass And Miscanthus RhizosphereMLAHEIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNP
Ga0070708_10055932713300005445Corn, Switchgrass And Miscanthus RhizosphereMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKD
Ga0066686_1020349023300005446SoilMLAREIMIPEPFVAAAGATSAEVALLMVAKDISVVPVVDNPK
Ga0066689_1097465713300005447SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDN
Ga0066681_1074703513300005451SoilMRASEVMIADPVVAAAGATSAEVAALMRVKNISVVPVVDNPKDRR
Ga0070706_10035549213300005467Corn, Switchgrass And Miscanthus RhizosphereVLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRY
Ga0070698_10208360613300005471Corn, Switchgrass And Miscanthus RhizosphereVLAREIMIPEPFVAAAGATSAEVAVLMRMKDISVVPVVDNPKDRR
Ga0070699_10005675753300005518Corn, Switchgrass And Miscanthus RhizosphereVLAREIMIPEPFVAAAGATSAEVAVLMRMKDISVVPVVDNPKDRRY
Ga0070697_10083066213300005536Corn, Switchgrass And Miscanthus RhizosphereVLASAVMIADPLAAAAGATSAEVAALMRSRNISVVPVIDNPKD
Ga0070693_10039367913300005547Corn, Switchgrass And Miscanthus RhizosphereMRASEVMITDVIVAAAGATSSEVAALMRVKNISVVPVVDNP
Ga0066695_1049929523300005553SoilVLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPK
Ga0066698_1049643313300005558SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVV
Ga0066698_1061103523300005558SoilMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRY
Ga0066699_1017094233300005561SoilVLAREIMIPEPFVAAAGATSAEVALLMQAKDISVVP
Ga0066694_1013955533300005574SoilMLAREIMIPEPFVAAAGATSSEVALLMRAKDISVVP
Ga0066708_1012353233300005576SoilMHASEVMIPDPVVAAAGATSSEVAALMRVKDISVVPVVD
Ga0066708_1063892023300005576SoilVLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVP
Ga0066706_1079827723300005598SoilMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLG
Ga0066651_1011420613300006031SoilMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNP
Ga0066656_1009027613300006034SoilMRASEVMVADPIVAAAGATSSEVAALMRVKNISVVPVVDN
Ga0066652_10110644413300006046SoilMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGTIS
Ga0075417_1018576823300006049Populus RhizosphereMRASEVMIADPVVAAAGATSSEVAALMRLKNISVVPVVDNPKDRHYMG
Ga0066653_1043861113300006791SoilMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDLRYLGTISD
Ga0066665_1157150523300006796SoilLRASEVMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLGTI
Ga0066659_1133666913300006797SoilLRASDVMIPDPYVAAAGATSAEVAALMRMKDISVVP
Ga0066659_1149000423300006797SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLG
Ga0075433_1015814933300006852Populus RhizosphereMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPV
Ga0075433_1033871413300006852Populus RhizosphereMRASEVMIADPIVVAAGATSSEVAALMRTKNISVVPVV
Ga0075425_10083761713300006854Populus RhizosphereMRASEVMIADPVVAAAGATSSEVAALMRLKNISVVPVV
Ga0075429_10082905323300006880Populus RhizosphereMRASEVMIADPIVVAAGATSSEVAALMRIKNISVVPVVDN
Ga0075429_10143769823300006880Populus RhizosphereMKASEVMIPDPLVAAAGATSSEVAALMRLKNISVVPVV
Ga0075426_1044636223300006903Populus RhizosphereMRASEIMIKDPVVAAAGATSAEVATLMRMKDISVVPVVDNPKDRRYL
Ga0075426_1084440713300006903Populus RhizosphereMRAQDIMIADPVVAAAGATSAEVATLMRMKDISVVPVVDNPKDRRY
Ga0079216_1020454733300006918Agricultural SoilMKASEAMIPEPIVAAAGATTSEVAALMRIKNIAVVPVVDNPKDRRYLGT
Ga0099793_1001381043300007258Vadose Zone SoilMRASEVMIADPVVAAAGATSSEVAALMRLKNISVVPVVDNPKDRHY
Ga0099794_1062970013300007265Vadose Zone SoilMRASEVMIGDPVVAAAGATSAEVAHLMRAKNISVVPVVDNPK
Ga0066710_10055486013300009012Grasslands SoilMIFVPYVVAAGATRDAVALLMRATDISVVPVVDNHKARRYLGMLSDRDFVTGGV
Ga0066710_10066241313300009012Grasslands SoilVLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKD
Ga0066710_10104430333300009012Grasslands SoilMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLGTIS
Ga0066710_10166027813300009012Grasslands SoilMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLGTISD
Ga0099828_1120950723300009089Vadose Zone SoilMLAREIMIPEPFVAAAGATSSEVALLMRAKDISVVPVVDNPKDRRY
Ga0099827_1028419813300009090Vadose Zone SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKGISVVPVVDN
Ga0099827_1190131823300009090Vadose Zone SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISTVPVVDNPKD
Ga0066709_10075329833300009137Grasslands SoilMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGTISD
Ga0066709_10205278523300009137Grasslands SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRR
Ga0134082_1009586813300010303Grasslands SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRY
Ga0134082_1053042323300010303Grasslands SoilMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPK
Ga0134111_1013564113300010329Grasslands SoilMRAAEVMIADPVVAAAGATSSEVAALMRIKNISVVPV
Ga0134080_1008390613300010333Grasslands SoilMLAREIMIPEPFVAAAGATSSEVALLMRAKDISVVPVVDNPKDRRYLGT
Ga0134080_1064400913300010333Grasslands SoilMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYL
Ga0134080_1065239923300010333Grasslands SoilMRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDR
Ga0134063_1043800813300010335Grasslands SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPL
Ga0134062_1012492123300010337Grasslands SoilLIQEVPVLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPVVDNPKD
Ga0137451_103501713300011438SoilMIADPIVVAAGATSSEVAALMRTKNISVVPVVDNPK
Ga0137334_113623313300012179SoilMRASEVMIADPVVAAAGATSAEVAALMRVKNISVVP
Ga0137382_1130957413300012200Vadose Zone SoilMLAREIMIPEPLVAAAGATSAEVALLMRAKDISVVPVVDNPKDR
Ga0137399_1017773143300012203Vadose Zone SoilMIPEPFVAAAGATSAEVALVMRAKDISVVPVVDNPKDRRY
Ga0137381_1012365913300012207Vadose Zone SoilMRASEVMIRDPVVAAAGATSAEVATLMRMKDISVVPVVDNPKD
Ga0137381_1013797743300012207Vadose Zone SoilMIPEPVVAAAGATSAEVALLMRAKDISVVPVVDNP
Ga0137381_1066546723300012207Vadose Zone SoilMIPDPDVAAAGASSAEVAALMRMKDISVVPVVDNT
Ga0137379_1183817213300012209Vadose Zone SoilMIPEPVVVAAGATSAEVALLMRAKDISVVPVVDNPKDRRYL
Ga0137378_1045459913300012210Vadose Zone SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPLVDNPKDRRYLGTISD
Ga0137370_1022727043300012285Vadose Zone SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDIPVVPLLDNPKDRS*
Ga0137396_1046702413300012918Vadose Zone SoilMRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDLHYLGT
Ga0137419_1042104723300012925Vadose Zone SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVD
Ga0137410_1188029613300012944Vadose Zone SoilMRASEVMIADPVVAAAGATSSEVAALMRLKNISVVPVVDNPKDRH
Ga0126375_1080623523300012948Tropical Forest SoilMRASEVMIADPVVAAAGATSSEVAALMRMKNISVV
Ga0126369_1077037213300012971Tropical Forest SoilMIPDPLVAAAGATSAEVAALMRSRNISVVPVIDNPKDRRYLGTV
Ga0134077_1036501413300012972Grasslands SoilMHASEVMIPDPVVAAAGATSSEVAALMRVKDISVVPVVDNPKDRRYM
Ga0134077_1040605423300012972Grasslands SoilMRASEVMITDVIVAAAGATSSEVAALMRVKNISVVPVVD
Ga0134110_1042991623300012975Grasslands SoilMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNP
Ga0134076_1003444343300012976Grasslands SoilMVADPIVAAAGATSSEVAALMRVKNISVVPVVDNPKDRHY
Ga0134081_1001698913300014150Grasslands SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYL
Ga0134078_1005658613300014157Grasslands SoilMVTDVIVAAAGATSAEVAALMRVKNISVVPVVDNPKD
Ga0134078_1025961113300014157Grasslands SoilMLAREIMIPEPFVAAAGATSAEVALLMVAKDISVVPLVDNPKDRRYL
Ga0134078_1027037813300014157Grasslands SoilLLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPVVDNPKDR
Ga0134079_1004359413300014166Grasslands SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPVV
Ga0137411_126522513300015052Vadose Zone SoilMIADPVVAAAGATSSEVAALMRMKNISVVPVVDNPKDRHYPTAERFPIVI
Ga0134073_1003779513300015356Grasslands SoilMLAREIMIPEPFVAAAGATSAEVALLMVAKDISVVPVVDNPKD
Ga0134085_1033382823300015359Grasslands SoilMLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNP
Ga0134083_1010003313300017659Grasslands SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPLVDNPKDRRYLGT
Ga0184621_1012916413300018054Groundwater SedimentMRASEVMIADPVVAAAGATSSEVAALMRMKNISVVPVVDNPKDRHYLGT
Ga0066655_1010574923300018431Grasslands SoilMLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPK
Ga0066655_1042398313300018431Grasslands SoilAHLITGVPLLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPVVDNPKDRR
Ga0066655_1082625713300018431Grasslands SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPLVDNPKDRRY
Ga0066667_1025344533300018433Grasslands SoilMRAAEVMIADPVVAAAGATSAEVDALMRVKNIYVVPVVDNHKDRRYQGTISDRNIVAH
Ga0066667_1038522233300018433Grasslands SoilMRASEVMIADPVIAAAGATSSEVAALMRLKNISVV
Ga0066662_1086265823300018468Grasslands SoilMRAAEVMILDPVVAAAGATSSEIAALMRVKNISVVPVVDNP
Ga0066669_1104246323300018482Grasslands SoilMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLG
Ga0066669_1124842713300018482Grasslands SoilMRASEMMVTDVIVAAAGATSAEVAALMRVKNISVVPVVDNPKDRHYLGT
Ga0187894_1021776813300019360Microbial Mat On RocksLLASSVMIPDPLCAAAGATSAEVAALMRTKNISVVPVIDN
Ga0193722_100170473300019877SoilMRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNP
Ga0193755_102815523300020004SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVP
Ga0193755_112642623300020004SoilMRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDRHY
Ga0193719_1000619013300021344SoilMRASEVMVADPVVAAAGATSSEVAALMRLKNISVVP
Ga0209234_105677813300026295Grasslands SoilMLAREIMIPEPFVAAAGATSAELALLMRAKDISVVP
Ga0209235_120565813300026296Grasslands SoilVLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVP
Ga0209237_104356243300026297Grasslands SoilMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYL
Ga0209236_106022713300026298Grasslands SoilMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNP
Ga0209236_106623043300026298Grasslands SoilMRASEVMIADPVVAAAGATSAEVAALMRVKNISVVPVVD
Ga0209027_114168523300026300Grasslands SoilMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYL
Ga0209238_121586423300026301Grasslands SoilMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRY
Ga0209761_114003933300026313Grasslands SoilMRASEVMIADPVVAAAGATSAEVAALMRVKNISVVPVVDN
Ga0209761_119254313300026313Grasslands SoilMLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPLVDNPKDRRYLG
Ga0209686_109625413300026315SoilMLAREIMIPEPFVAAAGATSAEVALLMQAKDISVVPAV
Ga0209686_112245323300026315SoilMRAAEVMIADPVVAAAGATSAEVAALMRVKNISVVP
Ga0209154_110384433300026317SoilVGGVRADTLRAMLAREIMIPEPLVAAAGATSAEVALLMRAKDISVVPVVDNPKDR
Ga0209471_101969013300026318SoilMIPEPFVAAAGATSAEVALLMRGKDISVVPVVDNPKDRRYLGTI
Ga0209470_123989313300026324SoilMLAREIMIPEPFVAAAGATSAEVALLMRGKDISVV
Ga0209470_138689423300026324SoilMRASEVMVADPIVAAAGATSSEVAALMRVKNISVVPVVD
Ga0209375_127401023300026329SoilLLAREIMIPEPFVAAAGATSAELALLMRAKDISVVPVVDNPKDRR
Ga0209267_133706123300026331SoilMRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDRHYLG
Ga0209159_1002017123300026343SoilMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDR
Ga0209059_101521213300026527SoilVLAREIMIPEPFVAAAGATSAEVALLMQAKDISVVPVV
Ga0209059_111023813300026527SoilMLAREIMIPEPFVAAAGATSAEVALLMQAKDISVVPVV
Ga0209160_1000581313300026532SoilLLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYL
Ga0209160_116304313300026532SoilMLAREIMIPEPFVAAAGATSAEVALLMRGKDISVVP
Ga0209157_110779123300026537SoilMLAREIMIPEPFVAAAGATSAEVALLMVAKDISVVPVVDNP
Ga0209056_1023712913300026538SoilMIPDPYVAAAGATSAEVAALMRMKDISVVPVVDNPKDRRYLGTI
Ga0209376_106945413300026540SoilMLAREIMIPEPFVAAAGATSAEVALLMRAKDISVVPLVD
Ga0209156_1029901623300026547SoilMIPEPFVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGTI
Ga0179587_1099604223300026557Vadose Zone SoilVLAREIMIPEPYVAAAGATSAEVALLMRAKDISVVPVVDNPKDRRYLGT
Ga0209464_1007424313300027778Wetland SedimentMRASEVMIPEPIVAAAGATTSEVAALMRIKNIAVVP
Ga0209074_1026775413300027787Agricultural SoilMKAADVMIADPVVAAAGATCAEIAALMRIKNISVVPVVD
Ga0209283_1034808213300027875Vadose Zone SoilMIPDPYVAAAGATSAEVAALMRMKNISVVPVVDNPKDRRYLGT
Ga0209283_1041754813300027875Vadose Zone SoilVLASAVMIADPLVAAAGATSAEVAALMRSRNISVVPV
Ga0307501_1020684623300031152SoilMRAAEVMIADPVVAAAGATSSEIAALMRVKNLSVVPVVDNPKDRKYLG
Ga0307468_10033465433300031740Hardwood Forest SoilMRASEVMIADPVVAAAGATSSEVAALMRVKNISVVPVVDNPKDRH
Ga0307471_10042762333300032180Hardwood Forest SoilLLAREIMIPEPFVAAAGATSAEVALLMQMKDISVVPVVDNP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.