Basic Information | |
---|---|
Family ID | F052227 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 143 |
Average Sequence Length | 43 residues |
Representative Sequence | ALEQLRQRGVEVETLPTDEAVRRYGELDPRRTAAALHLTC |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 143 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.93 % |
% of genes near scaffold ends (potentially truncated) | 86.01 % |
% of genes from short scaffolds (< 2000 bps) | 88.11 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.63 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.224 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.385 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.259 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 143 Family Scaffolds |
---|---|---|
PF04430 | DUF498 | 27.27 |
PF01161 | PBP | 9.79 |
PF07883 | Cupin_2 | 6.29 |
PF00817 | IMS | 5.59 |
PF01329 | Pterin_4a | 4.20 |
PF13417 | GST_N_3 | 3.50 |
PF00582 | Usp | 2.10 |
PF00300 | His_Phos_1 | 2.10 |
PF13472 | Lipase_GDSL_2 | 1.40 |
PF03266 | NTPase_1 | 1.40 |
PF07478 | Dala_Dala_lig_C | 1.40 |
PF02353 | CMAS | 1.40 |
PF13188 | PAS_8 | 1.40 |
PF04493 | Endonuclease_5 | 0.70 |
PF01609 | DDE_Tnp_1 | 0.70 |
PF01361 | Tautomerase | 0.70 |
PF08327 | AHSA1 | 0.70 |
PF12728 | HTH_17 | 0.70 |
PF11799 | IMS_C | 0.70 |
PF12146 | Hydrolase_4 | 0.70 |
PF01850 | PIN | 0.70 |
PF00067 | p450 | 0.70 |
PF04008 | Adenosine_kin | 0.70 |
PF03098 | An_peroxidase | 0.70 |
PF13478 | XdhC_C | 0.70 |
PF09922 | DUF2154 | 0.70 |
PF00296 | Bac_luciferase | 0.70 |
PF00462 | Glutaredoxin | 0.70 |
PF13407 | Peripla_BP_4 | 0.70 |
PF00069 | Pkinase | 0.70 |
PF01548 | DEDD_Tnp_IS110 | 0.70 |
PF12697 | Abhydrolase_6 | 0.70 |
PF07690 | MFS_1 | 0.70 |
PF13684 | Dak1_2 | 0.70 |
PF09587 | PGA_cap | 0.70 |
PF03807 | F420_oxidored | 0.70 |
PF08843 | AbiEii | 0.70 |
PF12229 | PG_binding_4 | 0.70 |
PF04055 | Radical_SAM | 0.70 |
PF13483 | Lactamase_B_3 | 0.70 |
COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
---|---|---|---|
COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 27.27 |
COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 27.27 |
COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 9.79 |
COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 5.59 |
COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 4.20 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.80 |
COG1618 | Nucleoside-triphosphatase THEP1 | Nucleotide transport and metabolism [F] | 1.40 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.40 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 1.40 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 1.40 |
COG1515 | Deoxyinosine 3'-endonuclease (endonuclease V) | Replication, recombination and repair [L] | 0.70 |
COG1839 | Adenosine/AMP kinase | Nucleotide transport and metabolism [F] | 0.70 |
COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.70 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.70 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.70 |
COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.70 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.70 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.70 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.70 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.70 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.70 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.70 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.92 % |
Unclassified | root | N/A | 23.08 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000878|AL9A1W_1014138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1178 | Open in IMG/M |
3300000956|JGI10216J12902_101443833 | Not Available | 1204 | Open in IMG/M |
3300002568|C688J35102_120880444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1986 | Open in IMG/M |
3300003373|JGI25407J50210_10002386 | All Organisms → cellular organisms → Bacteria | 4420 | Open in IMG/M |
3300003373|JGI25407J50210_10147740 | Not Available | 579 | Open in IMG/M |
3300003465|P52013CM_1028342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1624 | Open in IMG/M |
3300004157|Ga0062590_102537657 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300004480|Ga0062592_101221684 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 704 | Open in IMG/M |
3300005093|Ga0062594_101426271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300005162|Ga0066814_10031120 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300005167|Ga0066672_10611747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
3300005171|Ga0066677_10762353 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300005172|Ga0066683_10183366 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300005186|Ga0066676_10268783 | Not Available | 1119 | Open in IMG/M |
3300005187|Ga0066675_11100639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
3300005329|Ga0070683_101923236 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300005332|Ga0066388_100192832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2654 | Open in IMG/M |
3300005345|Ga0070692_10952496 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 597 | Open in IMG/M |
3300005445|Ga0070708_101157576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
3300005456|Ga0070678_101867778 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005555|Ga0066692_10895180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
3300005556|Ga0066707_10964430 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300005574|Ga0066694_10320740 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300005981|Ga0081538_10334562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300006032|Ga0066696_10859697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300006163|Ga0070715_10313257 | Not Available | 844 | Open in IMG/M |
3300006796|Ga0066665_10669845 | Not Available | 824 | Open in IMG/M |
3300006804|Ga0079221_10388347 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300006871|Ga0075434_100393236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1407 | Open in IMG/M |
3300006918|Ga0079216_11868696 | Not Available | 518 | Open in IMG/M |
3300009012|Ga0066710_102937171 | Not Available | 667 | Open in IMG/M |
3300009012|Ga0066710_103522451 | Not Available | 592 | Open in IMG/M |
3300009100|Ga0075418_12138060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
3300009101|Ga0105247_10517572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 872 | Open in IMG/M |
3300009817|Ga0105062_1060004 | Not Available | 708 | Open in IMG/M |
3300009840|Ga0126313_10071662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2491 | Open in IMG/M |
3300009840|Ga0126313_10703490 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300009840|Ga0126313_10775431 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300009840|Ga0126313_11387335 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300010041|Ga0126312_10039310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3159 | Open in IMG/M |
3300010041|Ga0126312_10143544 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
3300010044|Ga0126310_10021585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3234 | Open in IMG/M |
3300010166|Ga0126306_10228347 | Not Available | 1414 | Open in IMG/M |
3300010166|Ga0126306_10400596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1073 | Open in IMG/M |
3300010326|Ga0134065_10126210 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300010329|Ga0134111_10441922 | Not Available | 563 | Open in IMG/M |
3300010333|Ga0134080_10389400 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300010335|Ga0134063_10403653 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300010335|Ga0134063_10415270 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300010400|Ga0134122_11110237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
3300012201|Ga0137365_10444643 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300012204|Ga0137374_10030077 | All Organisms → cellular organisms → Bacteria | 5957 | Open in IMG/M |
3300012204|Ga0137374_10755530 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300012204|Ga0137374_11066736 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300012204|Ga0137374_11248011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300012206|Ga0137380_10917357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300012208|Ga0137376_11179100 | Not Available | 655 | Open in IMG/M |
3300012210|Ga0137378_11201312 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300012210|Ga0137378_11852159 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300012350|Ga0137372_11125296 | Not Available | 537 | Open in IMG/M |
3300012353|Ga0137367_10014218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6321 | Open in IMG/M |
3300012353|Ga0137367_10692718 | Not Available | 710 | Open in IMG/M |
3300012353|Ga0137367_10874324 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300012355|Ga0137369_10014137 | All Organisms → cellular organisms → Bacteria | 7737 | Open in IMG/M |
3300012355|Ga0137369_10324823 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300012355|Ga0137369_10452278 | Not Available | 916 | Open in IMG/M |
3300012355|Ga0137369_10563626 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300012357|Ga0137384_11202356 | Not Available | 603 | Open in IMG/M |
3300012359|Ga0137385_11265061 | Not Available | 600 | Open in IMG/M |
3300012360|Ga0137375_10578995 | Not Available | 939 | Open in IMG/M |
3300012388|Ga0134031_1014828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
3300012532|Ga0137373_10100432 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
3300012532|Ga0137373_10168801 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
3300012958|Ga0164299_10858568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
3300012972|Ga0134077_10167714 | Not Available | 882 | Open in IMG/M |
3300013297|Ga0157378_11697740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
3300014149|Ga0181613_1116288 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300014326|Ga0157380_12491334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300015374|Ga0132255_103038266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
3300016341|Ga0182035_10985716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300017654|Ga0134069_1172165 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300017657|Ga0134074_1177555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
3300017965|Ga0190266_10402848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 760 | Open in IMG/M |
3300018027|Ga0184605_10035923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2065 | Open in IMG/M |
3300018063|Ga0184637_10344899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
3300018081|Ga0184625_10130202 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300018433|Ga0066667_11238144 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300018433|Ga0066667_11331041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300018433|Ga0066667_11581341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300018469|Ga0190270_10472166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1186 | Open in IMG/M |
3300018469|Ga0190270_13205902 | All Organisms → cellular organisms → Archaea | 518 | Open in IMG/M |
3300018482|Ga0066669_10866347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 805 | Open in IMG/M |
3300018482|Ga0066669_12251459 | Not Available | 518 | Open in IMG/M |
3300019767|Ga0190267_11083297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
3300022756|Ga0222622_10737924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
3300025094|Ga0209478_1007348 | All Organisms → cellular organisms → Bacteria | 3412 | Open in IMG/M |
3300025167|Ga0209642_10608579 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300025174|Ga0209324_10614280 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300025922|Ga0207646_10734721 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300025933|Ga0207706_10321652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1346 | Open in IMG/M |
3300025949|Ga0207667_10943968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
3300026020|Ga0208531_1021926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
3300026041|Ga0207639_10535420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
3300026044|Ga0208287_1023366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
3300027163|Ga0209878_1041924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 585 | Open in IMG/M |
3300027577|Ga0209874_1089014 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300028578|Ga0272482_10045736 | Not Available | 1150 | Open in IMG/M |
3300028587|Ga0247828_11211711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300028707|Ga0307291_1070946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
3300028875|Ga0307289_10342335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
3300028878|Ga0307278_10001246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12697 | Open in IMG/M |
3300028880|Ga0307300_10243686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
3300028884|Ga0307308_10444150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
3300030006|Ga0299907_11307495 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300031091|Ga0308201_10353751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
3300031682|Ga0318560_10024602 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
3300031731|Ga0307405_11730318 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300031824|Ga0307413_10010477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4500 | Open in IMG/M |
3300031852|Ga0307410_12063255 | Not Available | 509 | Open in IMG/M |
3300031901|Ga0307406_10837538 | Not Available | 779 | Open in IMG/M |
3300031911|Ga0307412_10125812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1854 | Open in IMG/M |
3300031911|Ga0307412_12180768 | Not Available | 515 | Open in IMG/M |
3300031947|Ga0310909_10797669 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300031995|Ga0307409_100832460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus endophyticus | 932 | Open in IMG/M |
3300031995|Ga0307409_102102977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
3300032002|Ga0307416_102981054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus endophyticus | 566 | Open in IMG/M |
3300032004|Ga0307414_11745261 | Not Available | 581 | Open in IMG/M |
3300032005|Ga0307411_10477146 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300032126|Ga0307415_100000620 | All Organisms → cellular organisms → Bacteria | 15552 | Open in IMG/M |
3300032126|Ga0307415_100580123 | Not Available | 994 | Open in IMG/M |
3300032126|Ga0307415_102476685 | Not Available | 511 | Open in IMG/M |
3300032159|Ga0268251_10214366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
3300032159|Ga0268251_10461355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300032261|Ga0306920_104299579 | Not Available | 512 | Open in IMG/M |
3300032770|Ga0335085_10030240 | All Organisms → cellular organisms → Bacteria | 7560 | Open in IMG/M |
3300032783|Ga0335079_10307445 | Not Available | 1729 | Open in IMG/M |
3300032892|Ga0335081_12710156 | Not Available | 505 | Open in IMG/M |
3300033158|Ga0335077_10843031 | Not Available | 929 | Open in IMG/M |
3300033290|Ga0318519_10559903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
3300033805|Ga0314864_0026809 | Not Available | 1232 | Open in IMG/M |
3300033812|Ga0364926_084063 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300034174|Ga0334932_025566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 996 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.38% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 9.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.09% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.99% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.90% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.10% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.10% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.40% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.40% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.40% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.40% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.40% |
Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | 0.70% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.70% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.70% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.70% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.70% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.70% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.70% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.70% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.70% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.70% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.70% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.70% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.70% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014149 | In situ water column microbial community from the vent pool of Chocolate Pots hot spring, Yellowstone National Park, Wyoming, USA - CP Vent Pool | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025094 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC8 2012 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026020 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes) | Environmental | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026044 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AL9A1W_10141382 | 3300000878 | Permafrost | GQLQPDPKTISRLRERGVEVEALPTEEAVRRYGELDPRRTAAALHLAC* |
JGI10216J12902_1014438333 | 3300000956 | Soil | QMRPDPATLERLSERGVEVECLPTDRAVSRFGELDPARTAAALHLTC* |
C688J35102_1208804445 | 3300002568 | Soil | GRMRPEPGALEALQARGVEVEVLPTAEAVTRYAELDPKTTAAALHLTC* |
JGI25407J50210_100023862 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MRPDPDTIRQLQERGVTVETLPTDQAVRRFAELDPAHVAAALHLTC* |
JGI25407J50210_101477401 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VLEELERRGIDVEVLHTDDAVRRYGELDERRTAAALHLTC* |
P52013CM_10283424 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | AMLDALAAGGIRVEVLPTAEAVRRYGETDPERTAAALHLTC* |
Ga0062590_1025376571 | 3300004157 | Soil | LETLRARGVEVEVLPTDEAVTRYAELDPGTTAAALHLTC* |
Ga0062592_1012216841 | 3300004480 | Soil | QGQLRPDPAVIEALERQGIEVVAVPTDEAVRRYGESDERQTAAALHLTC* |
Ga0062594_1014262711 | 3300005093 | Soil | MRPDPDVLDLLKERGVEVECLPTDRAVARFAELDPATTAAALHLTC* |
Ga0066814_100311202 | 3300005162 | Soil | PGTIETLRARGVDVEVLPTAAAVERYAELDPRRTAAALHLTC* |
Ga0066672_106117472 | 3300005167 | Soil | DARALESLRTRGIEVEVMPTADGVRRYGELDEREAAAALHLTC* |
Ga0066677_107623532 | 3300005171 | Soil | EALEQLRQRGVEVEALPTDEAVRRYGELDPRRMAAALHLTC* |
Ga0066683_101833661 | 3300005172 | Soil | EGLEQLRQRGVEVEALPTGEAVRRYGELDPRRTAAALHLTC* |
Ga0066676_102687831 | 3300005186 | Soil | PDPDVLDRLGERGVQVECLPTDRAVARFAELNPAETAAALHLTC* |
Ga0066675_111006392 | 3300005187 | Soil | PDPDALRALAKRGIQVEVLRTGDAVRRYGELDEARTAAAIHLTC* |
Ga0070683_1019232361 | 3300005329 | Corn Rhizosphere | AYGRLRPDPGTIESLRGRGIDVEVLPTAEAVDRYAELDPRTTAAALHLTC* |
Ga0066388_1001928321 | 3300005332 | Tropical Forest Soil | MRPDPGALEALRGRGVEVEVLPTAEAVRRYAQLDPRKTAAALHPTC* |
Ga0070692_109524962 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VIEALERQGIEVVAVPTDEAVRRYGESDERNTAAALHLTC* |
Ga0070708_1011575761 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LDRLRDRGIDVECLPTDRAVKRFSELDPATTAAALHLTC* |
Ga0070678_1018677781 | 3300005456 | Miscanthus Rhizosphere | DPGTIEALRGRGIDVEVLRTAAAVDRYAELDPQTTAAALHLTC* |
Ga0066692_108951802 | 3300005555 | Soil | PDPAVIEALERRGVTVECLPTDAAVRRYGELDERSTAAALHLTC* |
Ga0066707_109644302 | 3300005556 | Soil | EQLRQRGVEVESLPTNEAVRRYCELDPRRTAAALHLTC* |
Ga0066694_103207403 | 3300005574 | Soil | ALEQLRQRGVEVETLPTDEAVRRYGELDPRRTAAALHLTC* |
Ga0081538_103345622 | 3300005981 | Tabebuia Heterophylla Rhizosphere | GRLEPPRAVLEQLRARGVEVEAMPTAEAVRRYGELDPQRTAAALHLTC* |
Ga0066696_108596972 | 3300006032 | Soil | PDPAVIAELERRRVQVECLPTDAAVRRYCELDGRTTAAALHLTC* |
Ga0070715_103132572 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LQERGVEVECLPTDRAVVRFAELDPAETAAALHLTC* |
Ga0066665_106698452 | 3300006796 | Soil | ERGVDVEVMRTDDAVRRYSELDPARTAAALHLTC* |
Ga0079221_103883471 | 3300006804 | Agricultural Soil | GTIETLRGRGIDVEMLPTAAAVDRYAELDPQTTAAALHLTC* |
Ga0075434_1003932362 | 3300006871 | Populus Rhizosphere | MQERGIDLEMLPTETVRHYGELDEHRTAAALHLTC* |
Ga0079216_118686962 | 3300006918 | Agricultural Soil | PAPVLQELERRGIDVEVLHTGDAVRRYGELDERRTAAALHLTC* |
Ga0066710_1029371712 | 3300009012 | Grasslands Soil | DPGTLRRLRERGVEVECLPTTRAVARFRELDPTTTAAALHLTC |
Ga0066710_1035224513 | 3300009012 | Grasslands Soil | AYGRLRPEPGALDELRARGVEVESLPAADAVERYGLLDETRTAAALHLTC |
Ga0075418_121380601 | 3300009100 | Populus Rhizosphere | RRGIDVAVLQTAEAVRRYGDLDERRTAAALHLTC* |
Ga0105247_105175723 | 3300009101 | Switchgrass Rhizosphere | ALRGRGIDVEVLRTAAAVDRYAELDPQTTAAALHLTC* |
Ga0105062_10600041 | 3300009817 | Groundwater Sand | RMRPDPGALETLRARGVDVEVLPTADAVQRYAQLDPKRTAAALHLTC* |
Ga0126313_100716622 | 3300009840 | Serpentine Soil | MRPDPDTVLQLQRGVTVEALPTGQAVRRFGELDPARAAAALHLTC* |
Ga0126313_107034901 | 3300009840 | Serpentine Soil | RMRPDPKMVQQLQERRVTVEALPNGQAARRFAELDPAGTAAALHLTC* |
Ga0126313_107754313 | 3300009840 | Serpentine Soil | DPAVLAALERRGVQVECLPTDAAVRRYGELDERRTAAALHLTC* |
Ga0126313_113873351 | 3300009840 | Serpentine Soil | RPDSEALNELRQRGVEVEALPTDEAVRRYGELDPRRTAAALHLTC* |
Ga0126312_100393106 | 3300010041 | Serpentine Soil | RGGIEVEALATADAVRRYTELDPHRTAAALHLTC* |
Ga0126312_101435445 | 3300010041 | Serpentine Soil | DPEALEQLRQRGVEVEALPTGEAIQRYGELDPRRTAAALHLTC* |
Ga0126310_100215855 | 3300010044 | Serpentine Soil | ERRHVQVECLSTRAAVRRYGELDERTTAAALHLTC* |
Ga0126306_102283471 | 3300010166 | Serpentine Soil | RAVIEELERRGIDVEVLQTDDAVRRYGDLDERRTAAALHLTC* |
Ga0126306_104005962 | 3300010166 | Serpentine Soil | AVIAELERRRVQVECLPTDAAVRRYGELDERTTAAALHLTC* |
Ga0134065_101262101 | 3300010326 | Grasslands Soil | YGQMRPDPEALEELRLRGVEVEALPMDESVRRYGELAPRRTAGALHLTC* |
Ga0134111_104419221 | 3300010329 | Grasslands Soil | DPRALDALHAKGIEVEVLPTDDAVRRYVELDPNRTAAALHLTC* |
Ga0134080_103894002 | 3300010333 | Grasslands Soil | EALEQLRQRGVEVEALPTGEAVRRYRELDPRRTAAALHLTC* |
Ga0134063_104036533 | 3300010335 | Grasslands Soil | LHPDPAALESLRERGVEVEVLPTAEAVSRYGELDPRRTAAALHLTC* |
Ga0134063_104152701 | 3300010335 | Grasslands Soil | LEQLRQRGVEIETLPTGDAVRRYGELDPRRTAAALHLTC* |
Ga0134122_111102371 | 3300010400 | Terrestrial Soil | TIETLRGRGIDVEVLRTAAAVDRYAELDPQTTAAALHLTC* |
Ga0137365_104446433 | 3300012201 | Vadose Zone Soil | QMRPDPEAVEQLRQRGVEVEALPTGEAVHRYGELDPRRTAAALHLTC* |
Ga0137374_100300773 | 3300012204 | Vadose Zone Soil | MGGCDPDPQLSECLRERGVEVEALPTAAAIRRYGELDPRCAAAALHLTC* |
Ga0137374_107555303 | 3300012204 | Vadose Zone Soil | ERLRQRGVEVDALPTGEAVRRYGELDSHRTAAALHLTC* |
Ga0137374_110667362 | 3300012204 | Vadose Zone Soil | GQLQPDPKTIDQLRERGVEVESLPTEQAVQRYAELDPSRTAAALHLTC* |
Ga0137374_112480111 | 3300012204 | Vadose Zone Soil | PDPRTLAELRARGIDVEVLPTAEAVARYGVLDSTRTAAALHLTC* |
Ga0137380_109173572 | 3300012206 | Vadose Zone Soil | LRPDGETLDGLRQPGVEVEALPTAEAVRRYGELDPRRTAAALHLTC* |
Ga0137376_111791002 | 3300012208 | Vadose Zone Soil | RPDPGTVETLRARGVEVEVLPTAEAVQRYAQLDPRKTAAALHLTC* |
Ga0137378_112013121 | 3300012210 | Vadose Zone Soil | PEALEQLQQRGVEVEALPTDEAVRRYGELDPRRTAAALHLTC* |
Ga0137378_118521592 | 3300012210 | Vadose Zone Soil | MRPEPETLERRRERGIELETLPTGDAVRRYGELDPRGTAAAIHLTC* |
Ga0137372_111252963 | 3300012350 | Vadose Zone Soil | GALDELRARGVDVQVLPTDHAVDRYGELDPGRTAAALHLTC* |
Ga0137367_100142189 | 3300012353 | Vadose Zone Soil | EQLRERGVDVEALPTDEAVRRYGELDPRRTAAALHLTC* |
Ga0137367_106927183 | 3300012353 | Vadose Zone Soil | MQPDPEAVERLRQRGVEVEALPTGEAVRRYGELDPRRTAAALHLTC* |
Ga0137367_108743241 | 3300012353 | Vadose Zone Soil | EHEALEQLRERGIEVEALPTAEAVRRYAGLDPRRTAAALHLTC* |
Ga0137369_100141371 | 3300012355 | Vadose Zone Soil | DPELFEQLRERGVEVEALPTDEAVRRYRDLDPRRTAAALHLTC* |
Ga0137369_103248233 | 3300012355 | Vadose Zone Soil | ETIEQLRERGVEVEALPTGEAVRRYGELDPRRSAAALHLTC* |
Ga0137369_104522781 | 3300012355 | Vadose Zone Soil | MQPDPDTIQQLQDRGVTVETLPTSQAVRRFGELDPANTAAALHLTC* |
Ga0137369_105636262 | 3300012355 | Vadose Zone Soil | DRGIEVEVLPTGEAVHRYGELDPRRTAAALHLTC* |
Ga0137384_112023561 | 3300012357 | Vadose Zone Soil | MRPDQATLDELDRRGVKVEVLRTDEAARRYGELDSSTTAAALHLIC* |
Ga0137385_112650612 | 3300012359 | Vadose Zone Soil | LEALRARGVDVEVLPTAEAVRRYAQRDPRKSAAALHLTC* |
Ga0137375_105789951 | 3300012360 | Vadose Zone Soil | IEELERRGIDVELLHTDEAVRRYGELDERRTAAALHLTC* |
Ga0134031_10148281 | 3300012388 | Grasslands Soil | YGRMRPDAGALEALRSRGVEVEVLPTTEAVNRYPELDPQKTAAALHLTC* |
Ga0137373_101004322 | 3300012532 | Vadose Zone Soil | MRPDPQLSECLRERGVEVEALPTAAAIRRYGELDPRCAAAALHLTC* |
Ga0137373_101688014 | 3300012532 | Vadose Zone Soil | YGQMRPDPETIEQLRERGVKVEALPTGEAVRRYGELDPHRTAAALHLTC* |
Ga0164299_108585681 | 3300012958 | Soil | EVFDRLKERGVEVECLQTDQAVARFAELEPATTAAALHLTC* |
Ga0134077_101677142 | 3300012972 | Grasslands Soil | LETLRARGVEVEVLPTAEAVQRYAQLDPRKTAAALHLTC* |
Ga0157378_116977401 | 3300013297 | Miscanthus Rhizosphere | LETLRTRGIDVEVAPTPEAVARYAELDPQTTAAALHLTC* |
Ga0181613_11162881 | 3300014149 | Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | PTVLRLLRERGVEVEVLPTEEAVRRYGELDPARTAAALHLTC* |
Ga0157380_124913342 | 3300014326 | Switchgrass Rhizosphere | RGRGIDVEMLPTAAAVDRYAELDPQTTAAALHLTC* |
Ga0132255_1030382661 | 3300015374 | Arabidopsis Rhizosphere | IESLRGRGIDVEVLRTAAAVDRYAELDPQTTAAALHLTC* |
Ga0182035_109857161 | 3300016341 | Soil | NPDVIAELERRGIAVECLPTDEAVRRYGELDERRTAAALHLTC |
Ga0134069_11721651 | 3300017654 | Grasslands Soil | QLRQRGVEVEALPTDEAVRRYCELDPRRTAAALHLTC |
Ga0134074_11775552 | 3300017657 | Grasslands Soil | LARRGVRVECLRTDAAVRRYGELDERRTAAALHLTC |
Ga0190266_104028482 | 3300017965 | Soil | MSSLVRCEGIEVEALPAAKAVRRYGELDPGRTAAALHLTC |
Ga0184605_100359233 | 3300018027 | Groundwater Sediment | GADERMRPDPEVFDRLKERGVEVECLQTDQAVTRFAELDPANTAAALHLTC |
Ga0184637_103448992 | 3300018063 | Groundwater Sediment | MLETLRDRGVDVEVLPTADAVERYAQLDPRKTAAALHLTC |
Ga0184625_101302024 | 3300018081 | Groundwater Sediment | ALETLRARGVDVEVFPTADAVQRYAQLDPKRTAAALHLTC |
Ga0066667_112381442 | 3300018433 | Grasslands Soil | EALDQLRRRGVEVEALPTDEAVRRYGELDPRRTAAALHLTC |
Ga0066667_113310412 | 3300018433 | Grasslands Soil | ADQRMQPDPDVLDRLQERGVDVECLPTDRAVARFGELDPADTAAALHLTC |
Ga0066667_115813411 | 3300018433 | Grasslands Soil | PDALRALAKRGIQVEVLRTGDAVRRYGELDEARTAAAIHLTC |
Ga0190270_104721661 | 3300018469 | Soil | PAVLEQLRARGVEVEAMPTAEAVRRYGELDPKRTAAALHLTC |
Ga0190270_132059022 | 3300018469 | Soil | VIEELERRGIDVELLHTDEAVRRYGELDERRTAAALHLTC |
Ga0066669_108663471 | 3300018482 | Grasslands Soil | RLQERGVDVECLPTDSAVARFGELDPADTAAALHLTC |
Ga0066669_122514591 | 3300018482 | Grasslands Soil | LVVGMGADGRMRPDPGTLDRLRGRGVEVECHRTDRAIARLAELDPATTAAALHLTC |
Ga0190267_110832971 | 3300019767 | Soil | EAFGQLRRDGIEVEALPTADAVRRYGELDPWRTAALHLNC |
Ga0222622_107379241 | 3300022756 | Groundwater Sediment | ALERRGVAVEALPTADAVERYRGLDPARTAAALHLTC |
Ga0209478_10073485 | 3300025094 | Hot Spring Sediment | PDPAVLRLLRERGVEVEVLPTEQAVRRYGELDPARTAAALHLTC |
Ga0209642_106085791 | 3300025167 | Soil | RPDPGLPAQLRELGVLVEVLPTEEAVRRYGELDPARTAAALHLTC |
Ga0209324_106142801 | 3300025174 | Soil | LRPEPKTLEQLRERGIEVEALPTGEAVHRYGELDPRRTAAALHLTC |
Ga0207646_107347211 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AYGRLRPDPSALERLRERGVAVEALPTGQAVRRYGELDPARSAVALHLTC |
Ga0207706_103216524 | 3300025933 | Corn Rhizosphere | RLRPDPGTIETLRGRGIDVEVLRTAAAVDRYAELDPQTTAAALHLTC |
Ga0207667_109439681 | 3300025949 | Corn Rhizosphere | PDPGTIETLRGRGIDVEVLRTAAAVDRYAELDPRTTAAALHLTC |
Ga0208531_10219261 | 3300026020 | Rice Paddy Soil | LRGRGIDVEVLPTAEAVDRYAELDPQTTAAALHLTC |
Ga0207639_105354204 | 3300026041 | Corn Rhizosphere | ESLRGRGIDVEVLRTAAAVDRYAELDPQTTAAALHLTC |
Ga0208287_10233662 | 3300026044 | Natural And Restored Wetlands | TGATGRMEPDPAVLEDLRARGVDVECLPTDRAVERFGELDPATSAAALHLTC |
Ga0209878_10419242 | 3300027163 | Groundwater Sand | ALETLRARGVDVEVLPTADAVQRYAQLDPKRTAAALHLTC |
Ga0209874_10890141 | 3300027577 | Groundwater Sand | RPDPVTLELLRQRGIEVEALPTDEAVRRFQELDPAATAAALHLTC |
Ga0272482_100457362 | 3300028578 | Soil | MPSHLVVGTEAAGRMRPDPDTIQQLQDRGLTVEALPTSQAVRRFGELDPANTAAALHLTC |
Ga0247828_112117112 | 3300028587 | Soil | PGTIESLRGRGIDVEVLPTAEAVDRYAELDPRTTAAALHLTC |
Ga0307291_10523461 | 3300028707 | Soil | VLGCGAHGRLVPDPAVVEALERRGVAVEALPTADAVERYRGLDPARTAAALHLTC |
Ga0307291_10709461 | 3300028707 | Soil | GTGADERMRPDPEVFDRLKERGVEVECLQTDQAVTRFAELDPANTAAALHLTC |
Ga0307289_103423351 | 3300028875 | Soil | EVLDRLKERGVEVECLQTDQAVTRFAELDPANTAAALHLTC |
Ga0307278_100012461 | 3300028878 | Soil | LEQLRAREIEVESLPTPDAVRRYGELDEARTAAALHLTC |
Ga0307300_102436862 | 3300028880 | Soil | GTLEMLRARGVDVEVLPTAEAVTRYAELDPQTTAAALHLTC |
Ga0307308_104441501 | 3300028884 | Soil | RPDPDVFDRLKERGVEVECLQTDRAVTRFAELDPAKTAAALHLTC |
Ga0299907_113074951 | 3300030006 | Soil | RQRGIEVEALPTAEAVHRYGELDPRRTAAALHLTC |
Ga0308201_103537511 | 3300031091 | Soil | LEMLRARGVDVEVLPTAEAVTRYAELDPQTTAAALHLTC |
Ga0318560_100246021 | 3300031682 | Soil | RLRPDTEALERLRARGIHVESLPTADAVERYLRLDPDHAAAALHLTC |
Ga0307405_117303182 | 3300031731 | Rhizosphere | MRPDPDTVLQLQRGVTVEALPTGQAVRRFGELDPARAAAALHLTC |
Ga0307413_100104771 | 3300031824 | Rhizosphere | ETVNELRRGGIEVEALATADAVRRYTELDPHRTAAALHLTC |
Ga0307410_120632552 | 3300031852 | Rhizosphere | GRMRPDPDTILQLQQRGVTVEALPTAQAVRRFGELDPTGAAAALHLTC |
Ga0307406_108375381 | 3300031901 | Rhizosphere | PDQDTVQRLQARGVTVESLPTGQAVRRYGALEARRTAAALHLTC |
Ga0307412_101258121 | 3300031911 | Rhizosphere | RPDPHALERLRAHGVTVETLPTGQAVRRYGELDPSRTAAALHLTC |
Ga0307412_121807681 | 3300031911 | Rhizosphere | IRIGAYGQRHPNPETVKELRSGGIEVEALPTADAVRRYTDLDPHRTAAALHLTC |
Ga0310909_107976691 | 3300031947 | Soil | LIVGTGAYGRLRPDTEALERLRARGIHVESLPTADAVERYLRLDPDHAAAALHLTC |
Ga0307409_1008324602 | 3300031995 | Rhizosphere | MRPDPDTILRLQQRGVTVEALPTAQAVRRFGELDPAGAAAALHLTC |
Ga0307409_1021029771 | 3300031995 | Rhizosphere | PAVLAALERRGVHAECLPTDAAVRRYGELDERRTAAALHLTC |
Ga0307416_1029810542 | 3300032002 | Rhizosphere | PDTIRQLQERGVTVEALPTGQAVRRFGELDPARTAAALHLTC |
Ga0307414_117452612 | 3300032004 | Rhizosphere | MRPDPDTVQQLQERGVTVEALPTGRAVRRFGELDPAGAAAALHLTC |
Ga0307411_104771461 | 3300032005 | Rhizosphere | GRMRPDPDMILQLQQRGVTVETLPTAQAVRRFGELDPTGAAAALHLTC |
Ga0307415_10000062015 | 3300032126 | Rhizosphere | VGTGADGRMRPDPDTVLQLQRGVTVEALPTGQAVRRFGELDPARAAAALHLTC |
Ga0307415_1005801231 | 3300032126 | Rhizosphere | RTQARGVTVESLLTDRAVRHYGELDPSRTAVALHLTC |
Ga0307415_1024766851 | 3300032126 | Rhizosphere | ANGRMRPDPDTIQQLQARGITVEALPTGQAVRRFGELDSASTAAAFHLTC |
Ga0268251_102143662 | 3300032159 | Agave | LQDRGVTVEALPTGQAVRRFGQLDLARAAAALHLTC |
Ga0268251_104613552 | 3300032159 | Agave | VLAALERRGVQVECLPTDAAVRRYGELDERRTAAALHLTC |
Ga0306920_1042995791 | 3300032261 | Soil | AELERRGTMVECLPTAEAVRRYGELDERHTAAALHLTC |
Ga0335085_100302401 | 3300032770 | Soil | ALRQRGIEVDALPTGEAVRLFGELDPARTAAALHLTC |
Ga0335079_103074452 | 3300032783 | Soil | YSGLHPDPTAIAELDRRGTAVECLHTHQAVRRYGKLDERPTVAALHLTC |
Ga0335081_127101561 | 3300032892 | Soil | AAIAELRRRDIAVECLHTHQAVRRYGELDERRTAAALHLTC |
Ga0335077_108430312 | 3300033158 | Soil | AYSGLHPDPTAIAELDRRGTAVECLHTHQAVRRYGKLDERPTVAALHLTC |
Ga0318519_105599032 | 3300033290 | Soil | GAYGRLRPDTEALERLRARGIHVESLPTADAVERYLRLDPDHAAAALHLTC |
Ga0314864_0026809_6_146 | 3300033805 | Peatland | MHLAPAVIEQLTARGVTVEVLRTPHAVRRYRELDPKHTAAALHLTC |
Ga0364926_084063_235_375 | 3300033812 | Sediment | MRPEPEMLEQLRERGIEVEALPTGEAVHRYGELDPRRTAAALHLTC |
Ga0334932_025566_11_151 | 3300034174 | Sub-Biocrust Soil | MRPEPDAVRQLQQRGVTVEALPTGQAVRRFGELDPARTAAALHLTC |
⦗Top⦘ |