Basic Information | |
---|---|
Family ID | F052231 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 143 |
Average Sequence Length | 39 residues |
Representative Sequence | LLLTIEKLIYGGDGLARLPADERGQGKAVFVPFVL |
Number of Associated Samples | 128 |
Number of Associated Scaffolds | 143 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 24.82 % |
% of genes near scaffold ends (potentially truncated) | 97.90 % |
% of genes from short scaffolds (< 2000 bps) | 88.11 % |
Associated GOLD sequencing projects | 123 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.804 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.790 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.182 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.755 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.57% Coil/Unstructured: 71.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 143 Family Scaffolds |
---|---|---|
PF03486 | HI0933_like | 13.29 |
PF03309 | Pan_kinase | 4.20 |
PF02239 | Cytochrom_D1 | 2.10 |
PF13620 | CarboxypepD_reg | 2.10 |
PF13519 | VWA_2 | 1.40 |
PF04851 | ResIII | 1.40 |
PF01979 | Amidohydro_1 | 1.40 |
PF13226 | DUF4034 | 1.40 |
PF00535 | Glycos_transf_2 | 1.40 |
PF00579 | tRNA-synt_1b | 0.70 |
PF01614 | IclR | 0.70 |
PF03795 | YCII | 0.70 |
PF04055 | Radical_SAM | 0.70 |
PF03099 | BPL_LplA_LipB | 0.70 |
PF13646 | HEAT_2 | 0.70 |
PF01636 | APH | 0.70 |
PF00027 | cNMP_binding | 0.70 |
PF13565 | HTH_32 | 0.70 |
PF12779 | WXXGXW | 0.70 |
PF12891 | Glyco_hydro_44 | 0.70 |
PF13414 | TPR_11 | 0.70 |
PF00313 | CSD | 0.70 |
PF01712 | dNK | 0.70 |
PF00871 | Acetate_kinase | 0.70 |
PF04909 | Amidohydro_2 | 0.70 |
PF10282 | Lactonase | 0.70 |
PF04545 | Sigma70_r4 | 0.70 |
PF04185 | Phosphoesterase | 0.70 |
PF01844 | HNH | 0.70 |
COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
---|---|---|---|
COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 26.57 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 26.57 |
COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 13.29 |
COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 13.29 |
COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 13.29 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 13.29 |
COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 13.29 |
COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 13.29 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 13.29 |
COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 13.29 |
COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 13.29 |
COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 13.29 |
COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 4.20 |
COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.70 |
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
COG0282 | Acetate kinase | Energy production and conversion [C] | 0.70 |
COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.70 |
COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.70 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.70 |
COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 0.70 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.70 |
COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.70 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.80 % |
Unclassified | root | N/A | 4.20 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459002|FZY7DQ102HEKBG | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
2170459005|F1BAP7Q01DRBHL | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104595881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 551 | Open in IMG/M |
3300001084|JGI12648J13191_1021176 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300001305|C688J14111_10098137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 892 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101424071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 587 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10089452 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300003987|Ga0055471_10186861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 643 | Open in IMG/M |
3300005178|Ga0066688_10655080 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300005332|Ga0066388_104924514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 679 | Open in IMG/M |
3300005534|Ga0070735_10314392 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300005534|Ga0070735_10809624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 551 | Open in IMG/M |
3300005557|Ga0066704_10329041 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300005614|Ga0068856_101435441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 704 | Open in IMG/M |
3300005905|Ga0075269_10041982 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300005921|Ga0070766_10043012 | All Organisms → cellular organisms → Bacteria | 2511 | Open in IMG/M |
3300005921|Ga0070766_10044294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2477 | Open in IMG/M |
3300005921|Ga0070766_10410309 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300006050|Ga0075028_100875940 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300006162|Ga0075030_100468232 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300006162|Ga0075030_100938112 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300006163|Ga0070715_10154136 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300006173|Ga0070716_100555022 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300006174|Ga0075014_100376460 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300006175|Ga0070712_100632109 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300006176|Ga0070765_102178709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300006800|Ga0066660_10096750 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
3300006914|Ga0075436_101085517 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300009029|Ga0066793_10108991 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
3300009088|Ga0099830_11252831 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300009174|Ga0105241_10475104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1110 | Open in IMG/M |
3300009638|Ga0116113_1009099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2075 | Open in IMG/M |
3300009683|Ga0116224_10537157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300009824|Ga0116219_10070582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 2052 | Open in IMG/M |
3300010159|Ga0099796_10392627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 607 | Open in IMG/M |
3300010343|Ga0074044_10139112 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
3300010358|Ga0126370_12647536 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300010376|Ga0126381_101951052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300012199|Ga0137383_10621370 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300012209|Ga0137379_10700616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 918 | Open in IMG/M |
3300012210|Ga0137378_11417291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300012211|Ga0137377_10537373 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300012354|Ga0137366_10627666 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300012683|Ga0137398_10965291 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300012923|Ga0137359_11385144 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300012924|Ga0137413_10854432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 703 | Open in IMG/M |
3300012929|Ga0137404_10723763 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300012944|Ga0137410_10482692 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300012971|Ga0126369_11792195 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300014164|Ga0181532_10228603 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300014489|Ga0182018_10360286 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300015199|Ga0167647_1113584 | Not Available | 652 | Open in IMG/M |
3300015245|Ga0137409_10521124 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300015359|Ga0134085_10103505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
3300016357|Ga0182032_11035466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300017821|Ga0187812_1089066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1013 | Open in IMG/M |
3300017822|Ga0187802_10103063 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300017955|Ga0187817_10018302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4130 | Open in IMG/M |
3300017972|Ga0187781_11490167 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300017973|Ga0187780_10378979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1002 | Open in IMG/M |
3300018006|Ga0187804_10198026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 858 | Open in IMG/M |
3300018037|Ga0187883_10380141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 723 | Open in IMG/M |
3300018038|Ga0187855_10194769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1198 | Open in IMG/M |
3300018038|Ga0187855_10778274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 558 | Open in IMG/M |
3300018043|Ga0187887_10619459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 639 | Open in IMG/M |
3300018085|Ga0187772_10511056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 848 | Open in IMG/M |
3300018086|Ga0187769_10352088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1104 | Open in IMG/M |
3300018086|Ga0187769_10414326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1014 | Open in IMG/M |
3300018086|Ga0187769_10460439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 959 | Open in IMG/M |
3300018088|Ga0187771_10762482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 821 | Open in IMG/M |
3300018088|Ga0187771_11358831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300018433|Ga0066667_12098110 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300019082|Ga0187852_1070563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1583 | Open in IMG/M |
3300019268|Ga0181514_1283539 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300019879|Ga0193723_1114729 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300021088|Ga0210404_10688197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300021404|Ga0210389_10430356 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300021404|Ga0210389_11256897 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300021407|Ga0210383_10791596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 812 | Open in IMG/M |
3300021474|Ga0210390_10713750 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300021479|Ga0210410_10397268 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300021559|Ga0210409_10395051 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300022557|Ga0212123_10569333 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300025929|Ga0207664_10028982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4214 | Open in IMG/M |
3300025929|Ga0207664_10053471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3197 | Open in IMG/M |
3300026335|Ga0209804_1224517 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300026342|Ga0209057_1078763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1403 | Open in IMG/M |
3300026523|Ga0209808_1124371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1051 | Open in IMG/M |
3300026529|Ga0209806_1221944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300026532|Ga0209160_1145595 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300027073|Ga0208366_1026935 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300027576|Ga0209003_1115980 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300027625|Ga0208044_1033192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1743 | Open in IMG/M |
3300027748|Ga0209689_1283166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300027773|Ga0209810_1122279 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300027884|Ga0209275_10151168 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300027889|Ga0209380_10040436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2643 | Open in IMG/M |
3300027905|Ga0209415_10350044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1230 | Open in IMG/M |
3300027908|Ga0209006_10898297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 711 | Open in IMG/M |
3300027911|Ga0209698_11020768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300027986|Ga0209168_10334996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300028800|Ga0265338_10137789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1915 | Open in IMG/M |
3300029636|Ga0222749_10018492 | All Organisms → cellular organisms → Bacteria | 2866 | Open in IMG/M |
3300029882|Ga0311368_10454619 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300029943|Ga0311340_10543757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1028 | Open in IMG/M |
3300029999|Ga0311339_10132368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2977 | Open in IMG/M |
3300030007|Ga0311338_11041936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
3300030053|Ga0302177_10002870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12062 | Open in IMG/M |
3300030056|Ga0302181_10246759 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300030617|Ga0311356_10513044 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300030685|Ga0302285_10285946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300031057|Ga0170834_105430494 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300031122|Ga0170822_13576892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300031122|Ga0170822_16181789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300031474|Ga0170818_106072876 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300031474|Ga0170818_109143303 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
3300031524|Ga0302320_11668093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300031525|Ga0302326_11166435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1063 | Open in IMG/M |
3300031543|Ga0318516_10053659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2200 | Open in IMG/M |
3300031708|Ga0310686_106381098 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300031708|Ga0310686_113694478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1486 | Open in IMG/M |
3300031711|Ga0265314_10215090 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300031753|Ga0307477_10066169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2495 | Open in IMG/M |
3300031754|Ga0307475_10890214 | Not Available | 703 | Open in IMG/M |
3300031754|Ga0307475_11225520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300031823|Ga0307478_10894573 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300031846|Ga0318512_10481914 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300031962|Ga0307479_10735588 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300031965|Ga0326597_11817490 | Not Available | 571 | Open in IMG/M |
3300032180|Ga0307471_101100311 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300032783|Ga0335079_10877056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 924 | Open in IMG/M |
3300032783|Ga0335079_11155071 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300032828|Ga0335080_10822746 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300032829|Ga0335070_11876077 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300032892|Ga0335081_10408852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1743 | Open in IMG/M |
3300032897|Ga0335071_11854834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300032898|Ga0335072_11167545 | Not Available | 687 | Open in IMG/M |
3300033158|Ga0335077_12068533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300033755|Ga0371489_0368363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300034124|Ga0370483_0003716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4154 | Open in IMG/M |
3300034125|Ga0370484_0094669 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.99% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.59% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.59% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.20% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.20% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.20% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.20% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.50% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.50% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.10% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.10% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.40% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.40% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.40% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.40% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.40% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.70% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.70% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.70% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.70% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.70% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.70% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.70% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.70% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.70% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.70% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.70% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.70% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030685 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_2 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E1_07174210 | 2170459002 | Grass Soil | LLLTIEKLIYGGDGLARLPAAPDTATPATNEARGRGKAVFVPFVLAVEKSKLRSPN |
E41_07879000 | 2170459005 | Grass Soil | MQLTIEKLVYGGEGLARLPADSLGKGKAAFIPFVPSPETEVDAT |
INPhiseqgaiiFebDRAFT_1045958812 | 3300000364 | Soil | VLLNIEKLIYGGDGLARLAPDATGRGKAAFVPFVLA |
JGI12648J13191_10211761 | 3300001084 | Forest Soil | LLLNIEKLIYGGDGLARLPAGSPTNPDKDRGRGKAVFIPFVLAGEKIDA |
C688J14111_100981372 | 3300001305 | Soil | VKLTIDKMIYGGDGLAHLPPDVSGRGKSAFVPFVLPSEE |
JGIcombinedJ26739_1014240711 | 3300002245 | Forest Soil | LQLTIEKLVYGGDGLARLPSDEHGPGKAIFVPFAL |
JGIcombinedJ51221_100894521 | 3300003505 | Forest Soil | LLLTIEKLIYGGDGLARLPAAPDTAAPTAASPATEEARGRGKA |
Ga0055471_101868611 | 3300003987 | Natural And Restored Wetlands | LRVTIEKLIYGGEGLARLEPDGEGRRKALFVPFTIAGEEAD |
Ga0066688_106550801 | 3300005178 | Soil | MDAWGDRLLLTIEKLVYRGDGLAQLPADEHGRGKAVFMPFVLEGEQVEAS |
Ga0066388_1049245142 | 3300005332 | Tropical Forest Soil | MKLTIDKMIFGGDGLSRLPGNERGPGKAVFVPFVLPGEVIEA |
Ga0070735_103143922 | 3300005534 | Surface Soil | VQLQPKFNLTIERMIYGGDGLARLPAEPGSEGRGKAVFIPFVMPGESV |
Ga0070735_108096241 | 3300005534 | Surface Soil | VQLTIEKLVYGGDGLARLPSDEQGPGKAAFVPFVL |
Ga0066704_103290412 | 3300005557 | Soil | MDAWGDRLLLTIEKLVYGGDGLARLPADEHGRGKAVFMPFVLE |
Ga0068856_1014354411 | 3300005614 | Corn Rhizosphere | LEITIEKLIYGGDGLARLPADSQGRRKAAFVPLVLP |
Ga0075269_100419822 | 3300005905 | Rice Paddy Soil | LELKIEKLIYGGDGLARMPSADPARAGKAAFVPFTIAG |
Ga0070766_100430121 | 3300005921 | Soil | LLLTIEKLIYGGDGLARLPAVADISAPATLSAAVAVNDEARGRGKAVFVPFVLAA |
Ga0070766_100442943 | 3300005921 | Soil | LLLNIEKLIYGGDGLARLPAGSPKDTSPTNKDRSR |
Ga0070766_104103091 | 3300005921 | Soil | LLLSIEKLIYGGDGLARLPAAPNTGEAPERGKAVFVPF |
Ga0075028_1008759402 | 3300006050 | Watersheds | MIYGGEGLGRLPADSSGRGKAVFVPFVLAGESVEAT |
Ga0075030_1004682324 | 3300006162 | Watersheds | MIYGGEGLARLPADENGRGKAVFIPFVLAGEQVEAALTEQK |
Ga0075030_1009381123 | 3300006162 | Watersheds | LLITIEKLIYGGDGLARTSAGADGRSMAVFVPFVL |
Ga0070715_101541361 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LELTIEKLIYGGDGLGRLPADERGRGKAAFVPFTLP |
Ga0070716_1005550222 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLTVEKLIYGGEGLARLPADASGRRKAVFVPFVLAGEKI |
Ga0075014_1003764601 | 3300006174 | Watersheds | MLLSIEKLIYGGEGLARTPGADGRSMAVLVPFVLP |
Ga0070712_1006321091 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLTIEKLIYGGDGLSRLPADAHGRGKAVFVPFVLA |
Ga0070765_1021787092 | 3300006176 | Soil | LLLNIEKLIYGGDGLARLPAGSPKDTSPTNKDRSRGKAVFVPFVLAAE |
Ga0066660_100967501 | 3300006800 | Soil | LEFIIEKLIYGGDGLTRLPADEKGRGKAVFVPFTLPG |
Ga0075436_1010855172 | 3300006914 | Populus Rhizosphere | LPLTVEKLIYGGEGLARLPADASGRGKAVFVPFVLAGEKI |
Ga0066793_101089911 | 3300009029 | Prmafrost Soil | LEFKIEKLIYGGDGLARLPSTDPGRAGKAVFVPFTIAG |
Ga0099830_112528312 | 3300009088 | Vadose Zone Soil | MQLKIEKLVYGGDGLARLPADDRGPGKTVFVPFVLEGEQ |
Ga0105241_104751042 | 3300009174 | Corn Rhizosphere | VQLKIEKLVYGGDGLARLPADDQGPGKSVFVPFVLE |
Ga0116113_10090991 | 3300009638 | Peatland | LLLNIEKLVYGGDGLARLPVGSPSDKEGGRGKAVFV |
Ga0116224_105371572 | 3300009683 | Peatlands Soil | MLLSIEKLIYGGDGLARSPGADGRSLAVFVPFVLPGE |
Ga0116219_100705823 | 3300009824 | Peatlands Soil | LNIEKLVYGGDGLARLPADERGPGKAVFVPFVLEGE |
Ga0099796_103926272 | 3300010159 | Vadose Zone Soil | VNLTIEKMIYGGDGLARLPNGKAVFMPFVVDGEEVSATMV |
Ga0074044_101391122 | 3300010343 | Bog Forest Soil | LLLTIEKMIYGGDGLARLPPGAPDDKNQGRGKAAFIPFVLAGEKV* |
Ga0126370_126475362 | 3300010358 | Tropical Forest Soil | MIYGGDGLAHLPADQQGPGKAVFFTFALTTEKVEASITEEK |
Ga0126381_1019510522 | 3300010376 | Tropical Forest Soil | LELTIEKLIYGGDGLARLPADERGPGKAVFMPFVL |
Ga0137383_106213702 | 3300012199 | Vadose Zone Soil | MQIKIEKLIFGGDGLARLPADEHGPGKTVFLPFVLESEQ |
Ga0137376_109604171 | 3300012208 | Vadose Zone Soil | VQLTIEKMVYGGDGLGRLPPDEHGRGKAAFVPFVLP |
Ga0137379_107006161 | 3300012209 | Vadose Zone Soil | VQFTIEKLIYGGDGLARIPATGDERRGKTVFIPYVLP |
Ga0137378_114172911 | 3300012210 | Vadose Zone Soil | LLLTIEKLIYGGDGLARLPAAPDTDEDHGRGKAVFVPF |
Ga0137377_105373731 | 3300012211 | Vadose Zone Soil | MQIKIEKLIFGGDGLARLPADEHGPGKTVFLPFVL |
Ga0137366_106276661 | 3300012354 | Vadose Zone Soil | LLLTIEKLIYGGDGLARLPADPDTDLAHGRGKAVFVPFV |
Ga0137398_109652911 | 3300012683 | Vadose Zone Soil | MQLTIEKLVYGGDGLARLPADDSGKGKAAFITFVLAGEEVADPLTE |
Ga0137359_113851442 | 3300012923 | Vadose Zone Soil | MKRTIEKMVYGGDGLAHLPPDASGRGKTAFAPFVLPGE |
Ga0137413_108544322 | 3300012924 | Vadose Zone Soil | LRLTIEKLIYGGEGLARLPSDDHGSGKAVFVPFVL |
Ga0137404_107237631 | 3300012929 | Vadose Zone Soil | MQLTIEKLVYGGEGLARLPADASGQGKAAFIPFVLAGEQIAA |
Ga0137410_104826921 | 3300012944 | Vadose Zone Soil | MSSRYHALLLTIEKLIYGGDGLARTPPDADSRSMAVFVPF |
Ga0126369_117921952 | 3300012971 | Tropical Forest Soil | LLLTVDKMIYGGEGLAHLPADEQGRGKAVFIPLVLPGEQVEASITEH |
Ga0181532_102286031 | 3300014164 | Bog | LSRYYEVDGLQLKIEKLVYGGDGMARLPADEHGSGKAVFVPFVIP |
Ga0182018_103602861 | 3300014489 | Palsa | LLLNIEKLIYGGDGLARLPAGSDGDKDRGRGKAVFVPFVL |
Ga0167647_11135842 | 3300015199 | Glacier Forefield Soil | LLLTIEKLVYGGDGLARSEPGPDGRSQAIFVPFVL |
Ga0137409_105211243 | 3300015245 | Vadose Zone Soil | MSSRYHALLLTIEKLIYGGDGLARTPPDADSRSMAVFVPFV |
Ga0134085_101035051 | 3300015359 | Grasslands Soil | LQLTVEKLVYGGDGLARLPADEHGPGKAVFAPFVLAAE |
Ga0182032_110354661 | 3300016357 | Soil | LELKIEKLVYGGDGLARLPPDDRGPGKAIFIPFVLE |
Ga0187812_10890663 | 3300017821 | Freshwater Sediment | LLLTIDKLIYGGNGLARLPADDKGPGKAVFLPFVLEGERV |
Ga0187802_101030632 | 3300017822 | Freshwater Sediment | LLLTIEKLIYGGDGLARLPADSPGGLPNDETRGRGKTVFVPFVLA |
Ga0187817_100183025 | 3300017955 | Freshwater Sediment | LLLTIEKLIYGGDGLARLPADASGRGKAAFVPFVLAG |
Ga0187781_114901672 | 3300017972 | Tropical Peatland | MIYGGDGLARLPADERGTGKAVFVPFVLPDEVVEASLIE |
Ga0187780_103789791 | 3300017973 | Tropical Peatland | LIFTIDKLIYGGNGLARLPADDKGPGKAVFLPFVLEG |
Ga0187804_101980262 | 3300018006 | Freshwater Sediment | VILNIDKLIYGGNGLARLPADDKGPGKAVFLPFVLEGER |
Ga0187883_103801412 | 3300018037 | Peatland | LLLSIEKLIYGGDGLARTPAGADGRSMAVFVPFVL |
Ga0187855_101947692 | 3300018038 | Peatland | LLLTIEKLIYGGDGLARLPATSPTDDRGRGKAVFVPL |
Ga0187855_107782742 | 3300018038 | Peatland | LQLQIEKLVYGGEGLARLPADEHGRGKAVFVPFVLPGEE |
Ga0187887_106194591 | 3300018043 | Peatland | MLLSIEKLVYGGNGLARAPLGPDGRSMAVFVPFVLPGEKVEAE |
Ga0187772_105110562 | 3300018085 | Tropical Peatland | LLVTIEKLVYGGDGLARLPADEHGRGKAAFLPFVL |
Ga0187769_103520882 | 3300018086 | Tropical Peatland | LLLTIEKLVYGGEGLARLPADDRGRGKAVFVPFVLAGEKIE |
Ga0187769_104143261 | 3300018086 | Tropical Peatland | LILTIDKLIYGGNGLARLPADDKGPGKAVFLPLVLEGERVE |
Ga0187769_104604392 | 3300018086 | Tropical Peatland | MLLMLLSIEKLVYGADGLARVAGADGRSMAVFVPFVLPGERVE |
Ga0187771_107624822 | 3300018088 | Tropical Peatland | LLFTVDKLIYGGNGLARLPADDKGPGKAVFLPFVLEG |
Ga0187771_113588311 | 3300018088 | Tropical Peatland | LILTIDKLIYGGNGLARLPADEKGPGKAVFLPLVLEGER |
Ga0066667_120981101 | 3300018433 | Grasslands Soil | LLLTVEKLVYGGDGLARLPADEHGRGKTVFMPFVLEG |
Ga0066669_103590694 | 3300018482 | Grasslands Soil | MEIEIEKMIYGGDGLGRYLEPGENRAKALFIPFVLED |
Ga0187852_10705633 | 3300019082 | Peatland | MLLSIEKLIYGGDGLARTPAGADRRSMAVFVPFVLPGER |
Ga0181514_12835391 | 3300019268 | Peatland | LQIKIQKLVYGGDGLGRLPADENGLGKTVFTPFVLDGETV |
Ga0193723_11147291 | 3300019879 | Soil | LILTIEKLVYGGDGLARLPADEHGRGKTVFMPFVVEGE |
Ga0210404_106881972 | 3300021088 | Soil | LLLTIEKLIYGGDGLARLPADSLASSPNDEAPGRGKAVFVP |
Ga0210389_104303562 | 3300021404 | Soil | LLLNIEKLIYGGDGLARLPADDRGRGKAAFIPFVLGGE |
Ga0210389_112568972 | 3300021404 | Soil | LRLTIEKLVYGGDGLARLPADENGRGKAVFLPFVLG |
Ga0210383_107915961 | 3300021407 | Soil | LLLSIEKLVYGGEGLARTPAGADGRSTTVLVPFVLPGERIEADVRQGKPGFSR |
Ga0210390_107137501 | 3300021474 | Soil | LLLNIEKLIYGGDGLARLPAESPSNKDHARGKAVF |
Ga0210410_103972681 | 3300021479 | Soil | MIYGGDGFARLPADEHGRGKAVFVPFVLASKKIEAVITE |
Ga0210409_103950511 | 3300021559 | Soil | LLLTIEKLIYGGDGLARLPADSLASSPNDEAPGRG |
Ga0212123_105693331 | 3300022557 | Iron-Sulfur Acid Spring | LLLNIEKLIYGGDGLARLPADDRGRGKAAFIPFVLGGEK |
Ga0207664_100289827 | 3300025929 | Agricultural Soil | LLLTIEKLIYGGDGLARLPAAPSTDDAHGRGKAVFVPFVLAGE |
Ga0207664_100534711 | 3300025929 | Agricultural Soil | LELTIEKMIYGGEGLARLPADEKGRGKAVFLPFTLP |
Ga0209804_12245171 | 3300026335 | Soil | VQLQIDKLIYGGDGLARLPADDRGSGKSVFVPFVLEGEQA |
Ga0209057_10787633 | 3300026342 | Soil | LQLTVEKLVYGGDGLARLPADEHGPGKAVFVPFVLTGE |
Ga0209808_11243711 | 3300026523 | Soil | VTPVELTIEKLVYGGEGLARLASDRESRAKTVFVP |
Ga0209806_12219442 | 3300026529 | Soil | LQLTVEKLVYGGDGLARLPADEHGPGKAVFVPFVL |
Ga0209160_11455951 | 3300026532 | Soil | LEFIIEKLIYGGDGLTRLPADEKGRGKAVFVPFTLP |
Ga0208366_10269351 | 3300027073 | Forest Soil | LEFTIEKLIYGGDGLARLPADEKGRGKAVFVPFTL |
Ga0209003_11159802 | 3300027576 | Forest Soil | LHLTIEKLIYGGDGLARLPADEKGRGKAVFVPFVLEEEE |
Ga0208044_10331921 | 3300027625 | Peatlands Soil | LLLTIEKLIYGGDGLARLPAGSGTDEARARGKAVFVPFV |
Ga0209689_12831662 | 3300027748 | Soil | LRLIIEKLVYGGDGLARLPADEHGPGKAVFVPFVLTGE |
Ga0209810_11222791 | 3300027773 | Surface Soil | MQLTIQKLIYGGDGLARLPADGAGPGKTAFVPFSIGGEQVEASI |
Ga0209275_101511683 | 3300027884 | Soil | LLLTIEKLIYGGDGLARLAANDEGRGKAVFVPFVLASEQID |
Ga0209380_100404361 | 3300027889 | Soil | MLLSIEKLIYGGDGLARTPPGADGRSRAVFVPFVL |
Ga0209415_103500443 | 3300027905 | Peatlands Soil | MQFTIEKLVYGGDGLARLPADEHGRGKAVFLPFVL |
Ga0209006_108982971 | 3300027908 | Forest Soil | LLLTIEKLIYGGDGLARFPTESSGNSNKDRGRGKAVFIPFVLAGETIE |
Ga0209698_110207681 | 3300027911 | Watersheds | LLLTIEKLIYGGDGLARAPGADGRSMAVFVPFVLPGER |
Ga0209168_103349961 | 3300027986 | Surface Soil | LLLTIEKLIYGGDGLARLPADSLASSPNDEAPGRGK |
Ga0265338_101377893 | 3300028800 | Rhizosphere | MQFTIEKLVYGGDGLARLPADEHGPGKAVFLPFVVTGDEV |
Ga0222749_100184923 | 3300029636 | Soil | MAQPQTNLEVTIEKLIYGGDGLSRLPVDSPANTAHARGKAVFVPFVLAGEKIDATL |
Ga0311368_104546191 | 3300029882 | Palsa | LLLDIEKLIYGGDGLARLPAGLSGNKACGRGKAVFLPFVLAGEKIE |
Ga0311340_105437571 | 3300029943 | Palsa | MKLRIEKAVYGGDGLARIPADETASGGKTVFVPGT |
Ga0311339_101323684 | 3300029999 | Palsa | LLLTIEKLIYGGDGFARLPPGLPASKDQDRSRGKAVFIPFVLSGE |
Ga0311338_110419362 | 3300030007 | Palsa | MVYGGDGLARLPADASDDKSQGRGKAVFIPFVLAG |
Ga0302177_1000287010 | 3300030053 | Palsa | LLLTIEKLIYGGDGFARLPPGLPASKDQDRSRGKAVFIPFVLSGEKIDASLS |
Ga0302181_102467591 | 3300030056 | Palsa | LLLTIEKLIYGGDGLARLPAVPDATASSVAAPGTAARAIDDAHGRGKAVFVPFV |
Ga0311356_105130441 | 3300030617 | Palsa | LLLTIEKLIYGGDGLARLPDTSPGDDRGRGKAVFVPLVLAGEK |
Ga0302285_102859461 | 3300030685 | Fen | MLLTIEKLIYGGDGLARTSADADGRSMAVFVPFVL |
Ga0170834_1054304941 | 3300031057 | Forest Soil | LHLTIEKLIYGGDGLARLPAASDATTPVANEARGRGKAVFVPFVLAAEKIE |
Ga0170822_135768921 | 3300031122 | Forest Soil | LLLTIEKLIYGGDGLARLPAASDADEAHARGKAVFVPF |
Ga0170822_161817892 | 3300031122 | Forest Soil | LQLTIEKLVYGGDGLARLPADEHGSGKAVFVPFVL |
Ga0170818_1060728762 | 3300031474 | Forest Soil | MPENQLLLLTIEKLIYGGDGLARLPADSPDAPNSDEARGRGKTVFVPFVLADEKIE |
Ga0170818_1091433031 | 3300031474 | Forest Soil | LFLTIEKLIYGGDGLARLPAASDTTTPVASEARGRGKAVFV |
Ga0302320_116680931 | 3300031524 | Bog | VQFTIEKLIYGGDGLARIPASGDERRGKTVFVPYVL |
Ga0302326_111664353 | 3300031525 | Palsa | LLLTIEKLIYGGDGLARLPADERGQGKAVFVPFVL |
Ga0318516_100536591 | 3300031543 | Soil | LQLTIEKLVYGGDGLARLPAEEHGGGKTVFLPYVL |
Ga0310686_1063810981 | 3300031708 | Soil | LLLTIEKLIYGGDGLARLPADPGTNEARGRGKAVFVPFVLSGEKI |
Ga0310686_1136944781 | 3300031708 | Soil | LLLSIEKLIYGGDGLARTPAGADGRSMAVFVPFVLP |
Ga0265314_102150901 | 3300031711 | Rhizosphere | LLLTIEKLIYGGDGLARLPTDSPVAPDTDEARGRGK |
Ga0307477_100661694 | 3300031753 | Hardwood Forest Soil | MLLSIEKLIYGGDGLARTPLTADGRNMAVFVPFVL |
Ga0307475_108902141 | 3300031754 | Hardwood Forest Soil | LLLNIEKLIYGGDGLARLPARSLNTGSLPTEPLTEDRGRGKAVF |
Ga0307475_112255202 | 3300031754 | Hardwood Forest Soil | MELTIEKLVYGGDGLARPGLTGGERAKTVFVPYVLPG |
Ga0307478_108945732 | 3300031823 | Hardwood Forest Soil | MIYGGDGLARLPADSNADSNNDAPNDDRSRGKAVFVPFVLANEKIEAT |
Ga0318512_104819141 | 3300031846 | Soil | LQLTIEKLVYGGDGLARLPAEEHGGGKTVFLPYVLP |
Ga0307479_107355882 | 3300031962 | Hardwood Forest Soil | LRLNIEKLIYGGEGLARLPADEHGPGKAVLVPFVLP |
Ga0326597_118174901 | 3300031965 | Soil | LRLILSMELTIEKLVYGGDGLARLAADEHGPGKAV |
Ga0307471_1011003111 | 3300032180 | Hardwood Forest Soil | MIYGGDGLAHLPADEKGRGKAVFIPFVLSGEKIEATL |
Ga0335079_108770561 | 3300032783 | Soil | MEVSIEKLIYGGEGLARLPADERGPGKAMFVPFVLE |
Ga0335079_111550712 | 3300032783 | Soil | MIYGGEGLGRLPADEKGRGKAVFVPFVLAGEKVEASLT |
Ga0335080_108227462 | 3300032828 | Soil | MIYGGDGLARLPADEHGRGKAVFLPFVLAGEKIEATLV |
Ga0335070_118760772 | 3300032829 | Soil | MQLQIEKLVYGGEGLARLPADAQGRGKTAFVPLVI |
Ga0335081_104088521 | 3300032892 | Soil | LQPPIESRKIENVRLTIEKLIYGGDGLARLPADEHGRGKAVFVPFVLA |
Ga0335071_118548341 | 3300032897 | Soil | LEVTIEKLVYGGDGLARLEGEDGRRKTVFVPLVLPGER |
Ga0335072_111675451 | 3300032898 | Soil | LLLTIEKLVYGGDGLARLPADGSSSDKQGRGKAAFVPFVLEDEKV |
Ga0335077_120685331 | 3300033158 | Soil | MQLTIEKLVYGGDGLARVEQADGKRKTVFVPLVLPG |
Ga0371489_0368363_540_668 | 3300033755 | Peat Soil | MQYPHLVRLTIEKLIYGGDGLARTPASGDDRRGKTVFVPYVLA |
Ga0370483_0003716_1_171 | 3300034124 | Untreated Peat Soil | LLINIEKLIYGGDGLARLPGLPGNESLKNASPADKNRERGKAVFVPFVLAGEKIEAA |
Ga0370484_0094669_2_142 | 3300034125 | Untreated Peat Soil | LLLTIEKLIYGGDGLSRLPADSPATPNSDEARGRGKTVFVPFVLADE |
⦗Top⦘ |