NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052443

Metagenome / Metatranscriptome Family F052443

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052443
Family Type Metagenome / Metatranscriptome
Number of Sequences 142
Average Sequence Length 153 residues
Representative Sequence MFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Number of Associated Samples 99
Number of Associated Scaffolds 142

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 60.56 %
% of genes near scaffold ends (potentially truncated) 45.07 %
% of genes from short scaffolds (< 2000 bps) 92.25 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.310 % of family members)
Environment Ontology (ENVO) Unclassified
(23.944 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.366 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 38.61%    β-sheet: 20.89%    Coil/Unstructured: 40.51%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 142 Family Scaffolds
PF09084NMT1 5.63
PF13180PDZ_2 2.11
PF07883Cupin_2 0.70
PF12439GDE_N 0.70
PF00076RRM_1 0.70
PF09334tRNA-synt_1g 0.70
PF05138PaaA_PaaC 0.70
PF07784DUF1622 0.70
PF00005ABC_tran 0.70
PF02922CBM_48 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 142 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.63
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.63
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG33961,2-phenylacetyl-CoA epoxidase, catalytic subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.70
COG4828Uncharacterized membrane proteinFunction unknown [S] 0.70


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2001200001|2001281610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium981Open in IMG/M
2088090015|GPICI_9265515All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1386Open in IMG/M
2140918013|NODE_3263_length_1164_cov_8.264605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1196Open in IMG/M
2228664021|ICCgaii200_c0874890All Organisms → cellular organisms → Bacteria → Proteobacteria2932Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14166024All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1254Open in IMG/M
3300000787|JGI11643J11755_11188099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300000787|JGI11643J11755_11670229All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2405Open in IMG/M
3300000891|JGI10214J12806_13576130All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300000956|JGI10216J12902_110433676All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium828Open in IMG/M
3300003319|soilL2_10169348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2198Open in IMG/M
3300003571|Ga0007419J51692_1050735All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300003579|Ga0007429J51699_1060085All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300003735|Ga0006780_1036027All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300003987|Ga0055471_10063579All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1025Open in IMG/M
3300004114|Ga0062593_101868149All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300004156|Ga0062589_100067634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2105Open in IMG/M
3300004157|Ga0062590_101899564All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium614Open in IMG/M
3300004463|Ga0063356_101017879All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1184Open in IMG/M
3300004463|Ga0063356_101161427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1118Open in IMG/M
3300004463|Ga0063356_104925248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300004643|Ga0062591_101946741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300004798|Ga0058859_11414704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300004798|Ga0058859_11762435All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema azotonutricium678Open in IMG/M
3300004800|Ga0058861_11838628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300004801|Ga0058860_11991502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300005093|Ga0062594_100207936All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1374Open in IMG/M
3300005093|Ga0062594_100945941All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium820Open in IMG/M
3300005577|Ga0068857_100191032All Organisms → cellular organisms → Bacteria → Proteobacteria1865Open in IMG/M
3300005843|Ga0068860_101211199All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium775Open in IMG/M
3300006845|Ga0075421_100882049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1022Open in IMG/M
3300006845|Ga0075421_101371010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium779Open in IMG/M
3300006847|Ga0075431_100704088All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium988Open in IMG/M
3300006853|Ga0075420_100687023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium882Open in IMG/M
3300006865|Ga0073934_10005557All Organisms → cellular organisms → Bacteria19360Open in IMG/M
3300006865|Ga0073934_10118218All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1965Open in IMG/M
3300006894|Ga0079215_10370617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium830Open in IMG/M
3300006918|Ga0079216_10857280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium677Open in IMG/M
3300006933|Ga0081247_1180829All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema azotonutricium527Open in IMG/M
3300007004|Ga0079218_12603342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium601Open in IMG/M
3300009147|Ga0114129_10899499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1122Open in IMG/M
3300009157|Ga0105092_10071136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1884Open in IMG/M
3300010037|Ga0126304_10494467All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium821Open in IMG/M
3300010042|Ga0126314_10562176All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium831Open in IMG/M
3300010045|Ga0126311_11674130All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300010047|Ga0126382_12382983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300010137|Ga0126323_1025839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium841Open in IMG/M
3300010145|Ga0126321_1039805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300010145|Ga0126321_1128141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium726Open in IMG/M
3300010145|Ga0126321_1148612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300010145|Ga0126321_1276331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium795Open in IMG/M
3300010145|Ga0126321_1428161All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300010145|Ga0126321_1445146All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium882Open in IMG/M
3300010145|Ga0126321_1446155All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300010146|Ga0126320_1169441All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300010146|Ga0126320_1330238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300010166|Ga0126306_10234608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1395Open in IMG/M
3300010401|Ga0134121_10658989All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium987Open in IMG/M
3300010403|Ga0134123_12826862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300010870|Ga0102750_10379543All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300010874|Ga0136264_10210409All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300011332|Ga0126317_10107108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300011332|Ga0126317_10269425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300011332|Ga0126317_10651923All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300011332|Ga0126317_10713101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1335Open in IMG/M
3300011332|Ga0126317_10941631All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300011333|Ga0127502_10019179All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300011333|Ga0127502_10649326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300011333|Ga0127502_10892738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300011333|Ga0127502_11176865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300011333|Ga0127502_11234324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300011333|Ga0127502_11317529All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300012469|Ga0150984_105424706All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300012469|Ga0150984_106242434All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300012908|Ga0157286_10275223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300018422|Ga0190265_12081657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium672Open in IMG/M
3300018432|Ga0190275_12206423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300018476|Ga0190274_11289602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium817Open in IMG/M
3300019254|Ga0184641_1472734All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300019377|Ga0190264_11027116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300020066|Ga0180108_1071833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300020080|Ga0206350_11583378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300020610|Ga0154015_1486610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300025310|Ga0209172_10001987All Organisms → cellular organisms → Bacteria39077Open in IMG/M
3300025310|Ga0209172_10199450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1055Open in IMG/M
3300025791|Ga0210115_1049828All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium894Open in IMG/M
3300025930|Ga0207701_10116346All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2385Open in IMG/M
3300026088|Ga0207641_10917785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium870Open in IMG/M
3300026095|Ga0207676_11795566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium612Open in IMG/M
3300026116|Ga0207674_10212420All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1884Open in IMG/M
3300026535|Ga0256867_10251963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium634Open in IMG/M
3300027886|Ga0209486_10115956All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1440Open in IMG/M
3300028554|Ga0302047_10446790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300028587|Ga0247828_10941339All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300030006|Ga0299907_10205597All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1624Open in IMG/M
3300030006|Ga0299907_10446333All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1031Open in IMG/M
3300030619|Ga0268386_10907233All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300030785|Ga0102757_11081600All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium700Open in IMG/M
3300030830|Ga0308205_1040165All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300030903|Ga0308206_1060228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium776Open in IMG/M
3300030903|Ga0308206_1178684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium527Open in IMG/M
3300030903|Ga0308206_1193776All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300030905|Ga0308200_1057928All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium741Open in IMG/M
3300030993|Ga0308190_1146037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300031039|Ga0102760_10641272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300031039|Ga0102760_10722688All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300031054|Ga0102746_10996664All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium707Open in IMG/M
3300031054|Ga0102746_11059314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium666Open in IMG/M
3300031058|Ga0308189_10180771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium749Open in IMG/M
3300031058|Ga0308189_10230721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M
3300031058|Ga0308189_10247822All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300031092|Ga0308204_10169969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300031092|Ga0308204_10305313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300031092|Ga0308204_10332930All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300031093|Ga0308197_10233472All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium644Open in IMG/M
3300031093|Ga0308197_10389214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300031094|Ga0308199_1202044All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300031114|Ga0308187_10234993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300031114|Ga0308187_10466901All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300031228|Ga0299914_10126120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2263Open in IMG/M
3300031228|Ga0299914_10411453All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1179Open in IMG/M
3300031229|Ga0299913_10029451All Organisms → cellular organisms → Bacteria5155Open in IMG/M
3300031229|Ga0299913_10425068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1316Open in IMG/M
3300031229|Ga0299913_10546702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1143Open in IMG/M
3300031548|Ga0307408_100379208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1208Open in IMG/M
3300031548|Ga0307408_100823429All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium844Open in IMG/M
3300031854|Ga0310904_11139338All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300031908|Ga0310900_10429686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1010Open in IMG/M
3300031943|Ga0310885_10803902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300031944|Ga0310884_10609537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300031995|Ga0307409_100148742All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2030Open in IMG/M
3300032004|Ga0307414_10034894All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3341Open in IMG/M
3300032004|Ga0307414_10662532All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium942Open in IMG/M
3300032004|Ga0307414_11366144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium658Open in IMG/M
3300032005|Ga0307411_10582571All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium959Open in IMG/M
3300032122|Ga0310895_10458565All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium634Open in IMG/M
3300032205|Ga0307472_102450495All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300033487|Ga0316630_11700300All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300033551|Ga0247830_10595782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium874Open in IMG/M
3300034668|Ga0314793_059985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300034675|Ga0314800_015328All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium884Open in IMG/M
3300034675|Ga0314800_071308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300034677|Ga0314802_033976All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.31%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil14.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil3.52%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.52%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment2.82%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.82%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.11%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.11%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.11%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.41%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.41%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.41%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.41%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.41%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.70%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.70%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.70%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2001200001Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150EnvironmentalOpen in IMG/M
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003571Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_35 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003579Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003735Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006933Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A100I (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010137Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010870Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010874Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3)EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019254Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020066Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028554Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300030785Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030830Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031039Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031054Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034668Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034675Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034677Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
20013291532001200001SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTVFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
GPICI_028522202088090015SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAXXXXX
Iowa-Corn-GraphCirc_005639202140918013SoilMFVETYRFGNDSLMVGGDARAIPYPKITDEDWRAWKLFLPFHSETIDRASASKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGILGSDRYLVARWGMEKLLPFDSIKRAVPLILAWKYIVSPAGAMAGLAALGYVAWGFLA
ICCgaii200_087489012228664021SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATG
ICChiseqgaiiFebDRAFT_1416602423300000363SoilMFVETYRFGNDSLMVGGDARAIPYPKITDEDWRAWKLFLPFHSETIDRASASKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGILGSDRYLVARWGMEKLLPFDSIKRAVPLILAWKYIVSPAGAMAGLAALGYVAWGFLA*
JGI11643J11755_1118809913300000787SoilMFVETYRFGNDSLMVGGDARAIPYPKITDEDWRAWKLFLPFHSETIDRASASKESLYFSKGIPXAXTGEIQKATEYFDKIEVWRKENVQKDPIAVGILGSDRYLVARWGMEKLLPFDSIKRAVPLILAWKYIVSPAGAMAGLAALGYVAWGFLA*
JGI11643J11755_1167022943300000787SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAG
JGI10214J12806_1357613023300000891SoilIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLA*
JGI10216J12902_11043367613300000956SoilMFVETYRFGSDSIMLGGDARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGTDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLA*
soilL2_1016934823300003319Sugarcane Root And Bulk SoilMFVENYRLNDSLMAGGDAVPAIPYPKISQEDWRAWKLFLPFRSATIDGTTARTKEALYFSYGIPYSLTGEIQKATQHFDQVEIWRKHEVQKDPIAVGVLGSDRYLIARWGMEKLLPFNTIKRAVPLILAWKVIASPAGVIGSAAMGYLAWAFLL*
Ga0007419J51692_105073513300003571Avena Fatua RhizosphereMFVENYRLENHGSIMAGGDAKLIPYPKISAEDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATQLFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF*
Ga0007429J51699_106008513300003579Avena Fatua RhizosphereAKLIPYPKISAEDWQVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGIDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF*
Ga0006780_103602713300003735Avena Fatua RhizospherePMFVENYRLETHGSIMAGGDAKLIPYPKISAEDWQVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGIDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF*
Ga0055471_1006357913300003987Natural And Restored WetlandsMFVENYRQENAESIMAGGDAIPIPYPRISAEDWRVWNLFLPVRAMDMDREAVCRETSLHHFYGIPYALTGEIQKAAQYFDKVEVWRKTEINKDPIAVGVLGDERYLIARWGMEKLIPFESIKKAMPLILAWKYATSPLGVMTALGGLSFAAWALLL*
Ga0062593_10186814913300004114SoilMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0062589_10006763413300004156SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0062590_10189956413300004157SoilGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0063356_10101787923300004463Arabidopsis Thaliana RhizosphereFVETYRFGNDSLMVGGDARAIPYPQINDEDWRAWKLFLPFHSETIDRNSATKESLYFTKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGILGSDRYLVARWGMEKLLPFDSIKRAMPLMLAWKYIVSPAGAMAGLAALGYLAWGLLA*
Ga0063356_10116142723300004463Arabidopsis Thaliana RhizosphereKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0063356_10492524813300004463Arabidopsis Thaliana RhizosphereKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0062591_10194674113300004643SoilEGGEIMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0058859_1141470413300004798Host-AssociatedMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0058859_1176243513300004798Host-AssociatedMFVETYRFGSDSIMLGGDARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLA*
Ga0058861_1183862813300004800Host-AssociatedMFVETYRQENSGSIMAGGDARPIPYPKIAQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0058860_1199150213300004801Host-AssociatedMFVETYRQESESIMAGGDARPIPYPKISAQDWRAWKLLLPFHAATIERTSAKRESLYFSHGIPYTLTTEVQKATEYFDKVEVWRKHDVQKDPIAVGVLGADRYLIARWGMEKLLPFETLKKAVPLILAWKYITSPAGVMTMLAALGYLVWGLV*
Ga0062594_10020793633300005093SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGM
Ga0062594_10094594113300005093SoilMFVETYRFGNDSLKVGGDARAIPYPKITDEDWRAWKLFLPFHSETIDRASATKKSLDFSTGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFDSIKKAMPLMLAWKYIVSPAGAMAGLAALGYLAWGFLA*
Ga0068857_10019103213300005577Corn RhizosphereMFVETYRFGNDSLMVGGDARAIPYPKITDEDWRAWKLFLPFHSETIDRASASKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGILGSDRYLVARWGMEKLLPFDSIKRAVPLILAWRYIVSPAGAMAGLAALGYVAWGFLA*
Ga0068860_10121119923300005843Switchgrass RhizosphereMFVETYRQESESIMAGGDARPIPYPKISAQDWRAWKLLLPFHAATIERTSAKRESLYFSHGIPYTLTTEVQKATEYFDKVEVWRKHDVQKDPIAVGVLGADRYLIARWGMEKLLPFETLKKAVPLILAWKYVTSPAGVMTMLAALGYLV
Ga0075421_10088204913300006845Populus RhizosphereMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0075421_10137101013300006845Populus RhizosphereQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0075431_10070408823300006847Populus RhizosphereARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0075420_10068702313300006853Populus RhizosphereQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0073934_1000555743300006865Hot Spring SedimentMFVENYRLNESLMAGGDAVPAIPYPKLSQEDWRAWKLFLPFRSATIDGTTARTKEALYFSYGVPYSLTGEIQKATQYFDQVEIWRKHEVQKDPIAVGVLGSDRYLIARWGMEKLLPFNTIKKAVPLILAWKVIASPAGVIGSAAMGYLAWAFLL*
Ga0073934_1011821823300006865Hot Spring SedimentMFVETYRQENAASIMGGGDARPIPYPKISDEDWRVWNLFLPFRSMNLDRVAAQNMKEESLHFSYGIPYAVTSEIQKATPYFDQIEVWRKREVNKDPIAVGVLGGERYLIARWGMEKLIPFSTIKKAVPLVLAWKYATSPLGALMSLFGAGLIAWSFLV*
Ga0079215_1037061723300006894Agricultural SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAW*
Ga0079216_1085728013300006918Agricultural SoilSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFIAWGMLF*
Ga0081247_118082913300006933Tropical Rainforest SoilMFVENYRQETESIMAGGDARPVPYPKLSDQDWRAWKLFLPFHAATIDRTSAKRESLYFSHGIPYALTGEIQKATEYFDKVEVWRKHDVQKDPIAVGVLGNDHYLIARWGMEKLLPFETLKKAVPLILAWRYMTSPAGVMTVLAALGYVVWGLM*
Ga0079218_1260334213300007004Agricultural SoilRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0114129_1089949913300009147Populus RhizosphereMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFYKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGMGFSRGECFSS*
Ga0105092_1007113613300009157Freshwater SedimentMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATDPAGAMAGLVGMGFLAWGILF*
Ga0126304_1049446713300010037Serpentine SoilMFVETYRQETSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0126314_1056217623300010042Serpentine SoilTEEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLA*
Ga0126311_1167413013300010045Serpentine SoilMFVETYRFGSDSIMLGGDARAIPYPKMTEEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLT*
Ga0126382_1238298313300010047Tropical Forest SoilLVFLTQTPRAKRAHTEAAAQCAKPKGGASMFVENYRNDDSLMAGGDARPTIPYPKLSDEDWRAWKLFLPFRSATIDGTTARTKESLYFSYGIPYSLTGEIQKATQYFDQVEIWRKHEVQKDPIAVGVVGPDHYLIARWGMEKLLPFNTMKRAVPLILAWKVIASPAGVIG
Ga0126323_102583923300010137SoilMFVENYRLETHGSIMAGGDAKLIPYPKISAEDWQVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGQRYLIARWGIDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF*
Ga0126321_103980523300010145SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEELQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLIGMGFLAWGMLF*
Ga0126321_112814123300010145SoilMFVENYRLETHGSIMAGGDDKLIPYPKISAEDWQVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGLFF*
Ga0126321_114861213300010145SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGILF*
Ga0126321_127633113300010145SoilMFVENYRQESAGSIMAGGDTTPIPYPKISDEDWRVWSIFLPIRTMNLDRTATTKLGPRGLNFTYGIPYALSGEVQKATEYFDKVEVWRKREVDKDPIAVGVLGDERYLIARWGMAELIPFATIKKSIPLIQAWNYATGPVGALAGVIGLGFLAWGLLF*
Ga0126321_142816113300010145SoilMFVENYRQENADSIMAGGDARPIPYPKISAEDWRVWTVFLPVRVMDMDREAVCRETSLHHFYGIPYALTGEVQKAAQHFDKVEVWRKTEINKDPIAVGVLGGDRYLIARWGMEKLIPFETIKRTVPLILAWKYATSPLGVMAALGGLSFAAWALLV*
Ga0126321_144514613300010145SoilMFVENYRLETHGSIMAGGDAKLIPYPKISAEDWRVWKMFLPVRSANFDRLATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGDRYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF*
Ga0126321_144615513300010145SoilMFVENYRLETHGSIMAGGDAKLIPYPKITADDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGLDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF*
Ga0126320_116944113300010146SoilMFVENYRQETSSIMAGGDSRPLPYPKLSNEDWRAWKLFLPFHAATIDRVSAKKESLYFSYGIPYALTGEIQKATQYFDKVEIWRKHDVQKDPIAVGLLGSDRYLIARWGMEKLLPFETLKKAVPLLLAWKYVVSPAGALAGLATLSYLAWGFLG*
Ga0126320_133023813300010146SoilMAGGDAKLIPYPKISAEDWQVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGIDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF
Ga0126306_1023460813300010166Serpentine SoilMFVETYRFGSDSIMLGGDARAIPYPKMTEEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLA*
Ga0134121_1065898913300010401Terrestrial SoilMFVETYRQESESIMAGGDARPIPYPKISAQDWRAWKLLLPFHAATIERTSAKRESLYFSHGIPYTLTTEVQKATEYFDKVEVWRKHDVQKDPIAVGVLGADRYLIARWGMEKLLPFETLKKAVPLILAWKYVTSPAGVMTMLAALGYLVWGLV*
Ga0134123_1282686213300010403Terrestrial SoilMFVETYRQESESIMAGGDARPIPYPKISAQDWRAWKLLLPFHAATIERTSAKRESLYFSHGIPYTLTTEVQKATEYFDKVEVWRKHDVQKDPIAVGVLGADRYLIARWGMEKLLPFETLKKAVPLILAWKYITSPAGMMTMLAALGYLVWGLV*
Ga0102750_1037954313300010870SoilQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0136264_1021040913300010874SoilMFVENYRQETSSIMAGGDSRPLPYPKLSNEDWRAWKLFLPFHAATIDRVSAKKESLYFSYGIPYALTGEIQKATQHFDKVEIWRKHDVQKDPIAVGVLGSDRYLIARWGMEKLLPFETLKKAVPLLLAWKYVVSPAGALAGLATLSYLAWGFLG*
Ga0126317_1010710813300011332SoilMFVENYRQESGASIMAGGDTRPLPYPKISDADWRVWKLFLPVRTMNLDRADTKKFGERGLNFTYGIPYALTGEIQKATEYFDKIEVWRKHEINKDPIAVGVIGAERYLIARWGMAKLIPFETIKKSAPWMRAWNYATGPAGALAGLLGLSLLAWGFLF*
Ga0126317_1026942513300011332SoilMFVENYRLENHGSIMAGGDAKLIPYPKISAEDWPVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATQLFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF*
Ga0126317_1065192313300011332SoilMFVETYRFGSDSIMLGGDARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATQYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLA*
Ga0126317_1071310123300011332SoilMFVETYRRENSGSIMAGGDARPIPYPKITQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGMLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0126317_1094163113300011332SoilMFVETFRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0127502_1001917913300011333SoilQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGILF*
Ga0127502_1064932613300011333SoilRMFVENYRQENAESIMAGGDAIPIPYPRISAEDWSVWNLFLPVRAMDMDREAVCRETSLHHFYGIPYALTGEIQKAAQYFDKVEVWRKTEINKDPIAVGVLGDERYLIARWGMEKLIPFESIKKVMPLILAWKYATSPLGVMTALGGLSFAAWALLL*
Ga0127502_1089273823300011333SoilMFVENYRQENVESIMAGGDARPIPYPKISAEDWRVWNVFLPVRVMDMDREAVCRETSLHHFYGIPYALTGEIQKASEYFDKVEVWRKTDINKDPIAVGVLGSDRYLIARWGMEKLLPFETIKKAVPLILAWKYATSPLGVMAALGGLSFAAWALLL*
Ga0127502_1117686513300011333SoilKNQEGGEIMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGLEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0127502_1123432413300011333SoilGGEIMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGLEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0127502_1131752913300011333SoilMFVETYRRENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF*
Ga0150984_10542470613300012469Avena Fatua RhizosphereMAGGDAKLIPYPKISAEDWQVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTSEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGIDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF
Ga0150984_10624243413300012469Avena Fatua RhizosphereMFVENYRLETHGSIMAGGDAKLIPYPKISAEDWQVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKVTELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGIDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF
Ga0157286_1027522313300012908SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFL
Ga0190265_1208165713300018422SoilVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGLEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLVWGMLF
Ga0190275_1220642313300018432SoilRQENSGSIMAGGDARPIPYPKISEEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Ga0190274_1128960223300018476SoilMFVETYRFGSDSIMLGGDARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLA
Ga0184641_147273413300019254Groundwater SedimentMFVENYRQETSSIMAGGDSRPLPYPKLSNEDWRAWKLFLPFHAATIDRVTAKKESLYFSYGIPYALTGEIQKATQYFDKVEIWRKHDVQKDPIAVGVLGSDRYLIARWGMEKLLPFETLKKAVPLLLAWKYVVSPAGALAGLATLSYLAWGFLG
Ga0190264_1102711613300019377SoilGEIMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Ga0180108_107183313300020066Groundwater SedimentESMFVETYRFGSDSIMLGGDARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATQYFDKIEVWRKENVQKDPIAVGIIGTDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYIVSPGGAMAGLAALGYLAWGLLA
Ga0206350_1158337813300020080Corn, Switchgrass And Miscanthus RhizosphereFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Ga0154015_148661013300020610Corn, Switchgrass And Miscanthus RhizosphereNKEGGEIMFVETYRQENSGSIMAGGDARPIPYPKIAQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Ga0209172_10001987343300025310Hot Spring SedimentMFVENYRLNESLMAGGDAVPAIPYPKLSQEDWRAWKLFLPFRSATIDGTTARTKEALYFSYGVPYSLTGEIQKATQYFDQVEIWRKHEVQKDPIAVGVLGSDRYLIARWGMEKLLPFNTIKKAVPLILAWKVIASPAGVIGSAAMGYLAWAFLL
Ga0209172_1019945013300025310Hot Spring SedimentMFVETYRQENAASIMGGGDARPIPYPKISDEDWRVWNLFLPFRSMNLDRVAAQNMKEESLHFSYGIPYAVTSEIQKATPYFDQIEVWRKREVNKDPIAVGVLGGERYLIARWGMEKLIPFSTIKKAVPLVLAWKYATSPLGALMSLFGAGLIAWSFLV
Ga0210115_104982813300025791Natural And Restored WetlandsMFVENYRQENAESIMAGGDAIPIPYPRISAEDWRVWNLFLPVRAMDMDREAVCRETSLHHFYGIPYALTGEIQKAAQYFDKVEVWRKTEINKDPIAVGVLGDERYLIARWGMEKLIPFESIKKAMPLILAWKYATSPLGVMTALGGLSFAAWALLL
Ga0207701_1011634633300025930Corn, Switchgrass And Miscanthus RhizosphereMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Ga0207641_1091778513300026088Switchgrass RhizosphereMFVETYRQESESIMAGGDARPIPYPKISAQDWRAWKLLLPFHAATIERTSAKRESLYFSHGIPYTLTTEVQKATEYFDKVEVWRKHDVQKDPIAVGVLGADRYLIARWGMEKLLPFETLKKAVPLILAWKYITSPAGVMTMLAALGYLVWGLV
Ga0207676_1179556613300026095Switchgrass RhizosphereSLMVGGDARAIPYPKITDEDWRAWKLFLPFHSETIDRASASKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGILGSDRYLVARWGMEKLLPFDSIKRAVPLILAWKYIVSPAGAMAGLAALGYVAWGFLA
Ga0207674_1021242013300026116Corn RhizosphereMFVETYRFGNDSLMVGGDARAIPYPKITDEDWRAWKLFLPFHSETIDRASASKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGILGSDRYLVARWGMEKLLPFDSIKRAVPLILAWRYIVSPAGAMAGLAALGYVAWGFLA
Ga0256867_1025196323300026535SoilNQIREGGESMFVENYRLENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSASINRVSARAIKEESLHFSYGVPYALTGEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGTAFLLWGMLL
Ga0209486_1011595623300027886Agricultural SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGILF
Ga0302047_1044679013300028554SoilQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Ga0247828_1094133913300028587SoilARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDISKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Ga0299907_1020559723300030006SoilMFVENYRLENSGSIMAGGDAKPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMDKLLPFDAIKKAVPLILAWKFATGPAGAMAGLLGMGFLAWGMFL
Ga0299907_1044633313300030006SoilMFVENYRQENAESIMAGGDARPIPYPKISAEDWRVWNVFLPVRVMDMDREAVCRETSLHHFYGIPYSLTGEIQKASEYFDKVEVWRKTEINKDPIAVGVLGGERYLIARWGMEKLIPFESIKKAMPLILAWKYATSPLGVMAALGGLSFVAWALLL
Ga0268386_1090723313300030619SoilMFVENYRLENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSASINRVSARAIKEESLHFSYGVPYALTGEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGTAFL
Ga0102757_1108160013300030785SoilMFVENYRQETSSIMAGGDSRPLPYPKLSNEDWRAWKLFLPFHAATIDRVSAKKESLYFSYGIPYALTGEVQKATQYFDKVEIWRKHDVQKDPIAVGVLGSDRYLIARWGMEKLLPFETLKKAVPLLLAWKYVVSPAGALAGLATLSYLAWGFLG
Ga0308205_104016513300030830SoilMFVENYRLENHGSIMAGGDAKLIPYPKISAEDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATQLFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGIFF
Ga0308206_106022823300030903SoilMFVENYRLENHGSIMAGGDAKLIPYPKISAEDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATQLFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF
Ga0308206_117868413300030903SoilMFVENYRLDTHGSIMAGGDAKLIPYPKISADDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGDRYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGM
Ga0308206_119377613300030903SoilMFVENYRLETHGSIMAGGDAKLIPYPKISAEDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGVDKLIPFSTIKKAAPLIQAWNYTTGPLGAMAGIMAAGLLAWGMFF
Ga0308200_105792823300030905SoilMFVENYRLETHGSIMAGGDAKLIPYPKISADDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGDRYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF
Ga0308190_114603713300030993SoilMFVENYRQETNFLMAGGDFRPLPYPKISNQDWRAWKLFLPVHAATIDRVSARRESLYFSYGIPYALTGEIKKATEYFDKVEIWRKHDIQKDPIAVGLLGSDRYLIARWGMEKLLPFNALKKTVPLVLAWKYLVSPAGALAGLAALSYLVWGLLV
Ga0102760_1064127213300031039SoilMFVENYRLETHGSIMAGGDAKLIPYPKISAEDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATDLFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF
Ga0102760_1072268813300031039SoilMFVENYRLETHGSIMAGGDAKLIPYPKISADDWRAWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGLLDGERYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF
Ga0102746_1099666413300031054SoilMAGGDAKLIPYPKISADDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF
Ga0102746_1105931413300031054SoilTKQKEGGEIMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEELQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Ga0308189_1018077113300031058SoilMFVENYRLETHGSIMAGGDAKLIPYPKISADDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGMDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLAWGMFF
Ga0308189_1023072113300031058SoilMFVENYRQETNFLMAGGDFRPLPYPKISNQDWRAWKLFLPFHAATIDRVSARRESLYFSYGIPYALTGEIKKATEYFDKVEIWRKHDIQKDPIAVGLLGSDRYLIARWGMEKLLPFNALKKTMPLILAWKYLVSPAGALAGLAALSYLVWGLLV
Ga0308189_1024782213300031058SoilMFVENYRQETSSIMAGGDSRPLPYPKLSTEDWRAWKLFLPFHAATIDKVSAKKESLYFSYGIPYALTGEIQKATQYFDKVEIWRKHDVQKDPIAVGVLGSDRYLIARWGMEKLLPFETLKKAVPLLLAWKYVVSPAGALAGLATLSYLAWGLLG
Ga0308204_1016996913300031092SoilAKTKEGGEIMFVETYRQENSGSIMAGGDARQIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEELQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMVGLVGMGFLAWGMLF
Ga0308204_1030531313300031092SoilMFVENYRLETHGSIMAGGDAKLIPYPKISAEDWRVWKMFLPVRSANFDRVATRYLKEESLHLSYGIPYALTGEVQKATELFDKIEVWRKRDVSKDPIAVGVLDGERYLIARWGVDKLIPFSTIKKAAPLIQAWNYATGPLGAMAGIMAAGLLA
Ga0308204_1033293013300031092SoilMFVENYRQETSSIMAGGDSRPLPYPKLSHEDWRAWKLFLPFHAATIDKVSAKKESLYFSYGIPYALTGEIQKATQYFDKVEIWRKHDVQKDPIAVGVLGSERYLIARWGMEKLLPFETLKKAVPLLLAWKYVVSPAGALAGLATLSYLAR
Ga0308197_1023347223300031093SoilMFVENYRQETNFVMAGGDFRPLPYPKISSQDWRAWKLFLPVHAATIDRVSARRESLYFSYGIPYALTGEIKKATEYFDKVEIWRKHDIQKDPIAVGLLGSDRYLIARWGMEKLLPFNALKKTVPLVLAWKYLVSPAGALAGLAALSYLVWGLLV
Ga0308197_1038921413300031093SoilMFVENYRQETSSIMAGGDSRPLPYPKLSTEDWRAWKLFLPFHAATIDKVSAKKESLYFSYGIPYALTGEIQKATQYFDKVEIWRKHDVQKDPIAVGVLGSDRYLIARWGMEKLLPFETLKKAVPLLLAWKYVVSPAGALAGLATLSYLAWGFLG
Ga0308199_120204413300031094SoilMFVENYRQETNFLMAGGDFRPLPYPKISNQDWRAWKLFLPVHAATIDRVSARRESLYFSYGIPYALTGEIKKATEYFDKVEIWRKHDIQKDPIAVGLLGSDRYLIARWGMEKLLPFNALKKTVPLVLAWKYLVSPAGVLAGLAALSYLVWGLLV
Ga0308187_1023499313300031114SoilMFVENYRQETNFIMAGGDFRPLPYPKLSNQDWRAWKLFLPFHAATIDRASARKESLYFSYGIPYALTGEIKKATEYFDKVEIWRKHDVQKDPIAVGLLGADRYLIARWGAEKLLPFDTLKKAMPLMLAWKYLASPVGAVAGLATLSYLVWGLLV
Ga0308187_1046690113300031114SoilMFVENYRQETSSIMAGGDSRPLPYPKLSNEDWRAWKLFLPFHAATIDRVTAKKESLYFSYGIPYALTGEIQKATQYFDKVEIWRKHDVQKDPIAVGVLGSDRYLIARWGMEKLLPFETLKKAVPLLLAWKYVVSPAGALAGLATLSYLAW
Ga0299914_1012612023300031228SoilMFVENYRLENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSASINRVSARAIKEESLHFSYGVPYALTGEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGTAFLLWGMLL
Ga0299914_1041145323300031228SoilMFVETYKRENSGSIMAGGDARPIPYPKISQEDWRAWTLFLPVRSANIDCRDAAGARESSLHFAYGIPYTLTEEVHKAAQLFDKIEVWRKPDVTKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYVTGPAGAVAGLLGMGFLAWGMFL
Ga0299913_1002945153300031229SoilMFVETYRRENSDSIMAGGDARPIPYPKISQEDWRAWTLFLPVRSANIDCRDAAGAREGSLHFAYGIPYALTEEVHKAARLFDKIEVWRKHDVTKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYVTGPAGAVAGLLGMGFLAWGMFL
Ga0299913_1042506813300031229SoilMFVENYRLENSGSIMAGGDAKPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFDAIKKAVPLILAWKFATGPAGAMAGLLGMGFLAWGMF
Ga0299913_1054670223300031229SoilVTTMFVENYRQENAESIMAGGDARPIPYPKISAEDWRVWNVFLPVRVMDMDREAVCRETSLHHFYGIPYSLTGEIQKASEYFDKVEVWRKTEINKDPIAVGVLGGERYLIARWGMEKLIPFESIKKAMPLILAWKYATSPLGVMAALGGLSFVAWALLL
Ga0307408_10037920813300031548RhizosphereMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLIGMGFLAWGMLF
Ga0307408_10082342913300031548RhizosphereMFVETYRFGSDSIMLGGDARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGTDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLG
Ga0310904_1113933813300031854SoilMFVETYRFGSDSLMVGGDAKAIPYPKITDEDWRAWKLFLPFHSETIDRASATKKSLDFSTGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFDSIKKAMPLMLAWK
Ga0310900_1042968623300031908SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGF
Ga0310885_1080390213300031943SoilARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLA
Ga0310884_1060953723300031944SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFEAIKKAVPLILAWKYATGPAGAMAGLVGMG
Ga0307409_10014874223300031995RhizosphereMFVETYRFGSDSIMLGGDARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGTDRYLVARWGMEKLLPFNTIKKAVPLMFAWKYVVSPGGAMAGLAALGYLAWGLLG
Ga0307414_1003489453300032004RhizosphereREGGEIMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLIGMGFLAWGMLF
Ga0307414_1066253213300032004RhizosphereMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMVGLVGMGFLAWGML
Ga0307414_1136614413300032004RhizosphereMFVETFRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLI
Ga0307411_1058257123300032005RhizosphereETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFESIKKAVPLILAWKYATGPAGAMAGLIGMGFLAWGMLF
Ga0310895_1045856513300032122SoilMFVETYRFGSDSLMVGGDAKAIPYPKITDEDWRAWKLFLPFHSETIDRASATKKSLDFSTGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFDSIKKAMPLMLAWKYIVSPAGAMAG
Ga0307472_10245049513300032205Hardwood Forest SoilRQESESIMAGGDARPIPYPKISAQDWRAWKLLLPFHAATIERTSAKRESLYFSHGIPYTLTTEVQKATEYFDKVEVWRKHDVQKDPIAVGVLGADRYLIARWGMEKLLPFETLKKAVPLILAWKYITSPAGMMTMLAALGYLVWGLV
Ga0316630_1170030013300033487SoilLMVGGDAKAIPYPKITDEDWRAWKLFLPFHSETIDRASATKKSLDFSTGIPYALTGEIQKATEHFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFDSIKKAMPLMLAWKYIVSPAGAMAGLAALGYLAWGFLA
Ga0247830_1059578213300033551SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDISKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Ga0314793_059985_29_4933300034668SoilMFVETYRFGSDSIMLGGDARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAVGIIGSDRYLVARWGMEKLLPFNTIKRAVPLMLAWKYIVSPGGAMAGLAALGYLAWGLLA
Ga0314800_015328_21_4853300034675SoilMFVETYRFGSDSIMLGGDARAIPYPKMTDEDWRAWRLFLPFHSETIDRSSATKESLYFSKGIPYALTGEIQKATEYFDKIEVWRKENVQKDPIAGGLIGSDRYLVARWGMEKLLPFNTIKKAVPLMLAWKYVVSPGGAMAGLAALGYLAWGLLA
Ga0314800_071308_115_5283300034675SoilPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDPIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF
Ga0314802_033976_64_5403300034677SoilMFVETYRQENSGSIMAGGDARPIPYPKISQEDWRVWTLFLPVRSANINRISARAIKEESLHFSYGIPYALTEEVQKATELFDKVEVWRKRDVSKDLIAVGVLDGERYLIARWGMEKLLPFETIKKAVPLILAWKYATGPAGAMAGLVGMGFLAWGMLF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.