Basic Information | |
---|---|
Family ID | F052464 |
Family Type | Metagenome |
Number of Sequences | 142 |
Average Sequence Length | 46 residues |
Representative Sequence | QPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 142 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 18.71 % |
% of genes near scaffold ends (potentially truncated) | 78.87 % |
% of genes from short scaffolds (< 2000 bps) | 76.76 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (55.634 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (22.535 % of family members) |
Environment Ontology (ENVO) | Unclassified (63.380 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.239 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 142 Family Scaffolds |
---|---|---|
PF00145 | DNA_methylase | 7.75 |
PF05772 | NinB | 7.75 |
PF01507 | PAPS_reduct | 6.34 |
PF01555 | N6_N4_Mtase | 4.93 |
PF05866 | RusA | 3.52 |
PF13392 | HNH_3 | 2.82 |
PF14549 | P22_Cro | 1.41 |
PF03237 | Terminase_6N | 1.41 |
PF05551 | zf-His_Me_endon | 1.41 |
PF12844 | HTH_19 | 0.70 |
PF00149 | Metallophos | 0.70 |
PF02767 | DNA_pol3_beta_2 | 0.70 |
PF11351 | GTA_holin_3TM | 0.70 |
COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 7.75 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 4.93 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 4.93 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 4.93 |
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 3.52 |
COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.37 % |
Unclassified | root | N/A | 5.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002447|JGI24768J34885_10093286 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
3300003277|JGI25908J49247_10010426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2896 | Open in IMG/M |
3300003393|JGI25909J50240_1114963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300004448|Ga0065861_1038140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300005581|Ga0049081_10241992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300005581|Ga0049081_10278593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300005581|Ga0049081_10297641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300005581|Ga0049081_10332208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300005582|Ga0049080_10075680 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
3300005582|Ga0049080_10285864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300006006|Ga0073916_1009872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300006805|Ga0075464_10112145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1577 | Open in IMG/M |
3300006805|Ga0075464_10260518 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
3300006920|Ga0070748_1115822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
3300007538|Ga0099851_1101629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1095 | Open in IMG/M |
3300007542|Ga0099846_1263611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300007547|Ga0102875_1235587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300007548|Ga0102877_1223523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300007559|Ga0102828_1024912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales | 1320 | Open in IMG/M |
3300007972|Ga0105745_1127496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
3300007973|Ga0105746_1149817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300008107|Ga0114340_1032900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2365 | Open in IMG/M |
3300008107|Ga0114340_1059681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2550 | Open in IMG/M |
3300008107|Ga0114340_1077438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1381 | Open in IMG/M |
3300008110|Ga0114343_1071588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
3300008114|Ga0114347_1030076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2465 | Open in IMG/M |
3300008116|Ga0114350_1043999 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
3300008117|Ga0114351_1049793 | All Organisms → Viruses → Predicted Viral | 2622 | Open in IMG/M |
3300008117|Ga0114351_1081119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1937 | Open in IMG/M |
3300008117|Ga0114351_1127298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1439 | Open in IMG/M |
3300008117|Ga0114351_1299217 | Not Available | 762 | Open in IMG/M |
3300008258|Ga0114840_1011874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1490 | Open in IMG/M |
3300008259|Ga0114841_1122613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1084 | Open in IMG/M |
3300008262|Ga0114337_1000667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 30766 | Open in IMG/M |
3300008264|Ga0114353_1371726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300008266|Ga0114363_1040038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3257 | Open in IMG/M |
3300008266|Ga0114363_1050360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1660 | Open in IMG/M |
3300008267|Ga0114364_1182599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300008448|Ga0114876_1027161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2859 | Open in IMG/M |
3300008448|Ga0114876_1076541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
3300008450|Ga0114880_1094012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1172 | Open in IMG/M |
3300008450|Ga0114880_1240380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300009068|Ga0114973_10021024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4052 | Open in IMG/M |
3300009079|Ga0102814_10224105 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
3300009155|Ga0114968_10347498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300009158|Ga0114977_10194619 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
3300009159|Ga0114978_10013646 | All Organisms → cellular organisms → Bacteria | 6165 | Open in IMG/M |
3300009159|Ga0114978_10147265 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
3300009159|Ga0114978_10286158 | Not Available | 1013 | Open in IMG/M |
3300009161|Ga0114966_10184256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
3300009161|Ga0114966_10491387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300009164|Ga0114975_10000777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23501 | Open in IMG/M |
3300009164|Ga0114975_10041613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2728 | Open in IMG/M |
3300009164|Ga0114975_10070575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2039 | Open in IMG/M |
3300009164|Ga0114975_10330975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
3300009164|Ga0114975_10352415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300009164|Ga0114975_10374212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
3300009181|Ga0114969_10028355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3883 | Open in IMG/M |
3300009183|Ga0114974_10292904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300009184|Ga0114976_10011132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5576 | Open in IMG/M |
3300009184|Ga0114976_10011518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5475 | Open in IMG/M |
3300009184|Ga0114976_10645755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300010160|Ga0114967_10198316 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
3300010160|Ga0114967_10320637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300010885|Ga0133913_11000962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2161 | Open in IMG/M |
3300010885|Ga0133913_12705498 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
3300010885|Ga0133913_13367082 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
3300011010|Ga0139557_1014448 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
3300011011|Ga0139556_1019413 | Not Available | 983 | Open in IMG/M |
3300011184|Ga0136709_1042092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300011335|Ga0153698_1173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 30968 | Open in IMG/M |
3300012663|Ga0157203_1005605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2373 | Open in IMG/M |
3300013004|Ga0164293_10947104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300013295|Ga0170791_10056305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300013372|Ga0177922_10814139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300013372|Ga0177922_11201230 | Not Available | 597 | Open in IMG/M |
3300017736|Ga0181365_1057684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300017747|Ga0181352_1027930 | All Organisms → Viruses → Predicted Viral | 1716 | Open in IMG/M |
3300017754|Ga0181344_1084141 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300017754|Ga0181344_1173944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
3300017761|Ga0181356_1234262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300017774|Ga0181358_1048656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1611 | Open in IMG/M |
3300017774|Ga0181358_1252263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300017777|Ga0181357_1291032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300017780|Ga0181346_1063545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1476 | Open in IMG/M |
3300017780|Ga0181346_1119447 | Not Available | 1010 | Open in IMG/M |
3300017780|Ga0181346_1253725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300017784|Ga0181348_1021979 | All Organisms → Viruses → Predicted Viral | 2714 | Open in IMG/M |
3300017784|Ga0181348_1149885 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300017785|Ga0181355_1175753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
3300017785|Ga0181355_1263702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300017785|Ga0181355_1381846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300020575|Ga0208053_1073763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales | 624 | Open in IMG/M |
3300021963|Ga0222712_10735370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. NFACC26 | 551 | Open in IMG/M |
3300022190|Ga0181354_1005801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3329 | Open in IMG/M |
3300022190|Ga0181354_1213859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300023174|Ga0214921_10123255 | All Organisms → Viruses → Predicted Viral | 1853 | Open in IMG/M |
3300025887|Ga0208544_10266814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300027146|Ga0255104_1077327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
3300027147|Ga0255113_1091441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
3300027608|Ga0208974_1174940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300027659|Ga0208975_1067978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
3300027659|Ga0208975_1149199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300027732|Ga0209442_1027884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2568 | Open in IMG/M |
3300027734|Ga0209087_1000356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30300 | Open in IMG/M |
3300027734|Ga0209087_1049219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1932 | Open in IMG/M |
3300027736|Ga0209190_1160113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
3300027759|Ga0209296_1013347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4848 | Open in IMG/M |
3300027772|Ga0209768_10056472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2045 | Open in IMG/M |
3300027785|Ga0209246_10121270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
3300027804|Ga0209358_10086302 | All Organisms → Viruses → Predicted Viral | 1768 | Open in IMG/M |
3300027804|Ga0209358_10121196 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
3300027808|Ga0209354_10422685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300027892|Ga0209550_10121508 | All Organisms → Viruses → Predicted Viral | 1913 | Open in IMG/M |
3300027969|Ga0209191_1027575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2756 | Open in IMG/M |
3300027969|Ga0209191_1133475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
3300028394|Ga0304730_1034015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2606 | Open in IMG/M |
3300028394|Ga0304730_1139732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
3300031758|Ga0315907_10099615 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
3300031758|Ga0315907_10217757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1594 | Open in IMG/M |
3300031758|Ga0315907_10514587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 945 | Open in IMG/M |
3300031758|Ga0315907_11281346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. NFACC26 | 507 | Open in IMG/M |
3300031784|Ga0315899_11775978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300031857|Ga0315909_10267971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1298 | Open in IMG/M |
3300031857|Ga0315909_10404190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
3300031857|Ga0315909_10447485 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300031873|Ga0315297_11554964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300032050|Ga0315906_10051814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4271 | Open in IMG/M |
3300032050|Ga0315906_10251927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1622 | Open in IMG/M |
3300032050|Ga0315906_10289334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1482 | Open in IMG/M |
3300032092|Ga0315905_10722513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 879 | Open in IMG/M |
3300032173|Ga0315268_11969076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300034013|Ga0334991_0376971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300034092|Ga0335010_0657298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300034102|Ga0335029_0345993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300034119|Ga0335054_0256700 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
3300034121|Ga0335058_0135942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1439 | Open in IMG/M |
3300034272|Ga0335049_0803162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300034356|Ga0335048_0079878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2015 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.54% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.72% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.97% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.15% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.34% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.34% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.23% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.82% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.82% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.11% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.41% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.41% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.41% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.70% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.70% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.70% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.70% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.70% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.70% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300006006 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_12-Aug-14 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24768J34885_100932861 | 3300002447 | Freshwater And Sediment | MDTQVQPKEIDDWLKQSVALVAGSVRGLGTNQRRIRYFGFEGKNEQTKE* |
JGI25908J49247_100104261 | 3300003277 | Freshwater Lake | DTQVQPKEIDDWLKQSVALVAGCVRGLATNQRRIRYFGFEGQNEQXKE* |
JGI25909J50240_11149632 | 3300003393 | Freshwater Lake | DDWLKQSVALVAGSVRGLGTNQRKVRYFAFERQNDEVTK* |
Ga0065861_10381402 | 3300004448 | Marine | MDTEIQSKEIDHWLEQSLALVAGCVRGLGTNQRKVRYFAFEGQNDKDTK* |
Ga0049081_102419921 | 3300005581 | Freshwater Lentic | KEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFERQNDEVTK* |
Ga0049081_102785931 | 3300005581 | Freshwater Lentic | TQVQPKEIDDWLCQSVALVAGCVRGLATNQRRIRYFGFEGQNEQTKE* |
Ga0049081_102976413 | 3300005581 | Freshwater Lentic | DWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0049081_103322081 | 3300005581 | Freshwater Lentic | MDTQIQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0049080_100756801 | 3300005582 | Freshwater Lentic | KQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0049080_102858641 | 3300005582 | Freshwater Lentic | KEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEATK* |
Ga0073916_10098721 | 3300006006 | Sand | MDTQVQPKEIDDWLKQSVALVAGSIAGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0075464_101121455 | 3300006805 | Aqueous | QPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0075464_102605181 | 3300006805 | Aqueous | RMAQTLPKEEIDDWLKQSVALVAGSVRGLATNQRRIRYFGFEGKNEQTKE* |
Ga0070748_11158222 | 3300006920 | Aqueous | MDTQIQPKEIDDWLNQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0099851_11016294 | 3300007538 | Aqueous | RMDTQVQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0099846_12636112 | 3300007542 | Aqueous | MDTQVQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0102875_12355871 | 3300007547 | Estuarine | VDTQVQQKEIDDWLKQSIALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0102877_12235232 | 3300007548 | Estuarine | MDTQVQPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0102828_10249122 | 3300007559 | Estuarine | MDTQIQSKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0105745_11274963 | 3300007972 | Estuary Water | RKQGMDTQVQSKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0105746_11498172 | 3300007973 | Estuary Water | MDTQIQPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114340_10329001 | 3300008107 | Freshwater, Plankton | KEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDKDTK* |
Ga0114340_10596819 | 3300008107 | Freshwater, Plankton | IDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEATK* |
Ga0114340_10774384 | 3300008107 | Freshwater, Plankton | IDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTKCQK* |
Ga0114343_10715881 | 3300008110 | Freshwater, Plankton | WLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114347_10300761 | 3300008114 | Freshwater, Plankton | LKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114350_10439993 | 3300008116 | Freshwater, Plankton | VDTQIQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQN |
Ga0114351_10497936 | 3300008117 | Freshwater, Plankton | VDTQVQPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEG |
Ga0114351_10811191 | 3300008117 | Freshwater, Plankton | TLQKLRSERVDTQIQQKEIDDWLKQSVALVAGSVRGLGTNQRRIRYFGFEKPHDEAAK* |
Ga0114351_11272981 | 3300008117 | Freshwater, Plankton | QSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114351_12992172 | 3300008117 | Freshwater, Plankton | VDTQIQPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEG |
Ga0114840_10118741 | 3300008258 | Freshwater, Plankton | IDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114841_11226131 | 3300008259 | Freshwater, Plankton | RVDTQIQPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114337_100066715 | 3300008262 | Freshwater, Plankton | VDTQVQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDKDTK* |
Ga0114353_13717261 | 3300008264 | Freshwater, Plankton | TLQGLRSERVDTQIQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114363_10400381 | 3300008266 | Freshwater, Plankton | QIQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFERQNDEVTK* |
Ga0114363_10503601 | 3300008266 | Freshwater, Plankton | VQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114364_11825993 | 3300008267 | Freshwater, Plankton | DDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVKK* |
Ga0114876_10271619 | 3300008448 | Freshwater Lake | VDTQIQQKEVDDWLKQSVALVAGSVRGLGTNQRRIRYFGFEKPHDEVTK* |
Ga0114876_10765414 | 3300008448 | Freshwater Lake | WLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTKCQK* |
Ga0114880_10940123 | 3300008450 | Freshwater Lake | WLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEATKCQK* |
Ga0114880_12403801 | 3300008450 | Freshwater Lake | KEIDDWLKQSIALVAGSVRGLGTNQRKVRYFAFEGQNDKDTK* |
Ga0114973_100210241 | 3300009068 | Freshwater Lake | KEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0102814_102241051 | 3300009079 | Estuarine | MDTQVQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114968_103474981 | 3300009155 | Freshwater Lake | LRSPRVDTQIQSKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFERQNDKDTK* |
Ga0114977_101946194 | 3300009158 | Freshwater Lake | VDTQIQQKEIDDWLNQSVALVAGCVRGLGTNQRKVRYFAYEGQNDEVTK* |
Ga0114978_100136461 | 3300009159 | Freshwater Lake | QSVALVAGCVRGLGTNQRKVRYFAFEGQNDEATK* |
Ga0114978_101472651 | 3300009159 | Freshwater Lake | PKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114978_102861581 | 3300009159 | Freshwater Lake | VDTQIQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDE |
Ga0114966_101842561 | 3300009161 | Freshwater Lake | QKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFERQNDEDTK* |
Ga0114966_104913873 | 3300009161 | Freshwater Lake | RSPRVDTQIQQKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114975_100007771 | 3300009164 | Freshwater Lake | VDTEIQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYF |
Ga0114975_100416131 | 3300009164 | Freshwater Lake | TRVDTEIQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFGFEKPHDEVTK* |
Ga0114975_100705757 | 3300009164 | Freshwater Lake | NQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114975_103309751 | 3300009164 | Freshwater Lake | VDTQIQQKEIDDWLNQSVALVAGCVRGLGTNQRKVRYFA |
Ga0114975_103524151 | 3300009164 | Freshwater Lake | LDTQVQQKEIDDWLNQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0114975_103742121 | 3300009164 | Freshwater Lake | PKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114969_100283551 | 3300009181 | Freshwater Lake | IQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDKDTK* |
Ga0114974_102929044 | 3300009183 | Freshwater Lake | WLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114976_100111321 | 3300009184 | Freshwater Lake | PKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEATK* |
Ga0114976_1001151816 | 3300009184 | Freshwater Lake | KQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0114976_106457551 | 3300009184 | Freshwater Lake | SPRVVTQIQPKEVDDWLKQSIALVAGSVRGLATNQRRVRYFGFEKPHE* |
Ga0114967_101983164 | 3300010160 | Freshwater Lake | RSPRVDTQIQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDKDTK* |
Ga0114967_103206371 | 3300010160 | Freshwater Lake | IQSKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFERQNDKDTK* |
Ga0133913_110009621 | 3300010885 | Freshwater Lake | IQPKEIDDWLKQSIALVAGCVRGLGTNQRKVRYFAFEGQNDKDTK* |
Ga0133913_127054985 | 3300010885 | Freshwater Lake | DDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0133913_133670824 | 3300010885 | Freshwater Lake | IQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDKDTK* |
Ga0139557_10144481 | 3300011010 | Freshwater | VDTQVQPKEIDDWLNQSVALVAGCVRGLGTNQRKVRYFAFE |
Ga0139556_10194131 | 3300011011 | Freshwater | VDTQVQPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQND |
Ga0136709_10420922 | 3300011184 | Freshwater | MDTEIQQKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0153698_11732 | 3300011335 | Freshwater | VDTQVQPKEIDDWLKQSVALVAGRVRGLGTNQRKVRYFGFEKPHDEVTK* |
Ga0157203_10056054 | 3300012663 | Freshwater | MDTQVQPKEIDDWLNQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0164293_109471041 | 3300013004 | Freshwater | RVDTQIQPKEIDDWLKQSVALVAGSVRGLAENQRRIRYFGFETTHDEVTK* |
Ga0170791_100563053 | 3300013295 | Freshwater | ERVDTQVQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0177922_108141393 | 3300013372 | Freshwater | QSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK* |
Ga0177922_112012301 | 3300013372 | Freshwater | VDTQIQPKEIDDWLKQSIALVAGSVRGLGTNQRKVRYFAFE |
Ga0181365_10576841 | 3300017736 | Freshwater Lake | LRSERVDSQIQPKEIDDWLNQSVALVAGSVRGLGTNQRKIRYFAFEGQNDEATK |
Ga0181352_10279301 | 3300017747 | Freshwater Lake | LNKSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0181344_10841411 | 3300017754 | Freshwater Lake | DDWLNQSLALVAGRVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0181344_11739443 | 3300017754 | Freshwater Lake | WLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0181356_12342621 | 3300017761 | Freshwater Lake | LQKLRSASVDTQVQPNEIDEWLKQSVALVAGSVRELAENQRRIRYFGFETTHDEVTK |
Ga0181358_10486565 | 3300017774 | Freshwater Lake | VDTQIQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFERQNDEVTK |
Ga0181358_11484261 | 3300017774 | Freshwater Lake | KQSLALVAGSVRGLAENQRRIRYFGFETTHDEVTK |
Ga0181358_12522633 | 3300017774 | Freshwater Lake | WLKQSVALVAGCVRGLGTNQRKVRYFAFERQNDEVTQ |
Ga0181357_12910321 | 3300017777 | Freshwater Lake | IQPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDKDTK |
Ga0181346_10635451 | 3300017780 | Freshwater Lake | EIDDWLNQSLALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0181346_11194472 | 3300017780 | Freshwater Lake | MDTQVQQKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNEQDTK |
Ga0181346_12537251 | 3300017780 | Freshwater Lake | LQKLRSPRVDTQVQQKEIDDWLKQSIAMVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0181348_10219791 | 3300017784 | Freshwater Lake | LRSPRVVEALPKEEIDDWLKQSVALVAGSVAGLAANQRRIRYFGFEKPHEQTKE |
Ga0181348_11498853 | 3300017784 | Freshwater Lake | LQKLRSPRVDTQVQQKEIDDWLKQSVAMVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0181355_11757533 | 3300017785 | Freshwater Lake | DDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0181355_12637023 | 3300017785 | Freshwater Lake | LRSPRVDTQIQPKEIDDWLKQSVALVAGCVRGLGANQRKVRYFAFEGQNDKDTK |
Ga0181355_13818461 | 3300017785 | Freshwater Lake | LQKLRSPRVDTQVQQKEIDDWLKQSIAMVAGCVRGLGTNQRKVRYFAFEGQNDEATK |
Ga0208053_10737633 | 3300020575 | Freshwater | TQVQQKEIDDWLNQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0222712_107353703 | 3300021963 | Estuarine Water | LRSERVDTQVQPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0181354_10058018 | 3300022190 | Freshwater Lake | KLRSPRVDTQIQPKEIDDWLKQSVALVAGCVRGLGANQRKVRYFAFEGQNDKDTK |
Ga0181354_12138593 | 3300022190 | Freshwater Lake | RSPRVDTQVQPKEIDDWLKQSIALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0214921_101232553 | 3300023174 | Freshwater | MDTQVQQKEIDDWLNQSLALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0208544_102668143 | 3300025887 | Aqueous | VQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEATK |
Ga0255104_10773271 | 3300027146 | Freshwater | LKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0255113_10914413 | 3300027147 | Freshwater | RVDTQIQSKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0208974_11749402 | 3300027608 | Freshwater Lentic | MDTQIQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0208975_10679781 | 3300027659 | Freshwater Lentic | EIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFERQNDEVTK |
Ga0208975_11491993 | 3300027659 | Freshwater Lentic | KQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0209442_10278841 | 3300027732 | Freshwater Lake | QQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEATK |
Ga0209087_100035639 | 3300027734 | Freshwater Lake | VDTQIQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEATK |
Ga0209087_10492191 | 3300027734 | Freshwater Lake | LKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0209190_11601134 | 3300027736 | Freshwater Lake | WLKQSVALVAGSVRGLGTNQRKVRYFAFERQNDEVTK |
Ga0209296_10133479 | 3300027759 | Freshwater Lake | VDTQIQQKEIDDWLNQSVALVAGCVRGLGTNQRKVRYFAYEGQNDEVTK |
Ga0209768_100564721 | 3300027772 | Freshwater Lake | DWLKQSIALVAGSVRGLGTNQRKVRYFAFEGQNDEATK |
Ga0209246_101212704 | 3300027785 | Freshwater Lake | IQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0209358_100863021 | 3300027804 | Freshwater Lake | LQGLRSERVDTQIQPKEIDDWLNKSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0209358_101211966 | 3300027804 | Freshwater Lake | SPRVDTQVQPKEIDDWLKQSIALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0209354_104226851 | 3300027808 | Freshwater Lake | KQSVALVAGCVRGLGTNQRKVRYFAFEGQNDKDTK |
Ga0209550_101215081 | 3300027892 | Freshwater Lake | QPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEATK |
Ga0209191_10275751 | 3300027969 | Freshwater Lake | VDTEIQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFGFEKPHDEVTK |
Ga0209191_11334751 | 3300027969 | Freshwater Lake | QVQQKEIDDWLNQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVAK |
Ga0304730_10340151 | 3300028394 | Freshwater Lake | RAFQGLRSPRVDTQIQPKEIDDWLKQSIALVAGCVRGLGTNQRKVRYFAFEGQNDKDTK |
Ga0304730_11397321 | 3300028394 | Freshwater Lake | LRSERVDTQVQPKEIDDWLNQSLALVAGCVRGLGTNQRKVRYFAFERQNDKDTK |
Ga0315907_100996158 | 3300031758 | Freshwater | EIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0315907_102177571 | 3300031758 | Freshwater | IQPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEATK |
Ga0315907_105145873 | 3300031758 | Freshwater | SPRVDTQVQPKEIDDWLCQSVALVAGCVRGLAANQRRIRYFGFEGQNEQTKE |
Ga0315907_112813461 | 3300031758 | Freshwater | EIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEATK |
Ga0315899_117759783 | 3300031784 | Freshwater | LRSERVDTQIQQKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0315909_102679711 | 3300031857 | Freshwater | LRSERVDTQIQPKEIDDWLCQSVALVAGCVRGLGTNQRKVRYFAFEGQNDKDTK |
Ga0315909_104041901 | 3300031857 | Freshwater | MDTQVQPKEIDDWLCQSVALVAGCVRGLGTNQRKVRYFAFEG |
Ga0315909_104474851 | 3300031857 | Freshwater | QPKEIDDWLCQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0315297_115549643 | 3300031873 | Sediment | LQELRSPRVDTQVQQKEIDDWLKQSVALVAGSVRGLAENQRRIRYFGFETTHDEATK |
Ga0315906_100518141 | 3300032050 | Freshwater | IQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0315906_102519274 | 3300032050 | Freshwater | EIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0315906_102893341 | 3300032050 | Freshwater | PKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEATK |
Ga0315905_107034351 | 3300032092 | Freshwater | QQKEIDDWLKQSVALVAGSVRGLGTNQRRIRYFGFEKPHDEAAK |
Ga0315905_107225133 | 3300032092 | Freshwater | DWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEAAK |
Ga0315268_119690761 | 3300032173 | Sediment | GMDTQVQSKEIDDWLKQSIALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0315275_110407291 | 3300032401 | Sediment | QKLRSKRVDTQIQPKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFETTHEQSQKD |
Ga0334991_0376971_388_537 | 3300034013 | Freshwater | MDTQVQPKEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0335010_0657298_393_521 | 3300034092 | Freshwater | KEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEATK |
Ga0335029_0345993_47_196 | 3300034102 | Freshwater | MDTQIQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0335054_0256700_863_1036 | 3300034119 | Freshwater | LQKLRSPRVDTQVQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0335058_0135942_514_663 | 3300034121 | Freshwater | MAQTLPKEEIDDWLKQSIALVAGSVRGLATNQRRIRYFGFEGKNEQTKE |
Ga0335049_0803162_200_349 | 3300034272 | Freshwater | MAQTLPKEEIDDWLKQSVALVAGCVRGLGTNQRKVRYFAFEGQNDEVTK |
Ga0335048_0079878_2_151 | 3300034356 | Freshwater | VDTQVQQKEIDDWLKQSVALVAGSVRGLGTNQRKVRYFAFEGQNDEVTK |
⦗Top⦘ |