Basic Information | |
---|---|
Family ID | F052465 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 142 |
Average Sequence Length | 43 residues |
Representative Sequence | GMLNNERDTLKRVSVLERLHQRYNTLRVARERLELLKEAKLP |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 142 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 38.85 % |
% of genes near scaffold ends (potentially truncated) | 55.63 % |
% of genes from short scaffolds (< 2000 bps) | 71.13 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (47.183 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (33.099 % of family members) |
Environment Ontology (ENVO) | Unclassified (70.423 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.831 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 142 Family Scaffolds |
---|---|---|
PF00271 | Helicase_C | 13.38 |
PF11351 | GTA_holin_3TM | 7.04 |
PF08291 | Peptidase_M15_3 | 4.23 |
PF00959 | Phage_lysozyme | 2.82 |
PF10926 | DUF2800 | 2.11 |
PF00176 | SNF2-rel_dom | 2.11 |
PF09374 | PG_binding_3 | 2.11 |
PF04851 | ResIII | 1.41 |
PF11753 | DUF3310 | 0.70 |
PF09636 | XkdW | 0.70 |
PF13539 | Peptidase_M15_4 | 0.70 |
PF16793 | RepB_primase | 0.70 |
PF02557 | VanY | 0.70 |
PF03237 | Terminase_6N | 0.70 |
PF13385 | Laminin_G_3 | 0.70 |
PF00182 | Glyco_hydro_19 | 0.70 |
PF06067 | DUF932 | 0.70 |
PF11651 | P22_CoatProtein | 0.70 |
COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
---|---|---|---|
COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.70 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.38 % |
Unclassified | root | N/A | 36.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000558|Draft_10040866 | Not Available | 3241 | Open in IMG/M |
3300004448|Ga0065861_1116077 | Not Available | 789 | Open in IMG/M |
3300004460|Ga0066222_1096568 | Not Available | 5146 | Open in IMG/M |
3300004693|Ga0065167_1050472 | Not Available | 686 | Open in IMG/M |
3300004806|Ga0007854_10482585 | Not Available | 500 | Open in IMG/M |
3300005581|Ga0049081_10072917 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
3300005581|Ga0049081_10168137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
3300005582|Ga0049080_10306949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300005662|Ga0078894_10420728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1206 | Open in IMG/M |
3300006119|Ga0007866_1003221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4116 | Open in IMG/M |
3300006805|Ga0075464_10105398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1624 | Open in IMG/M |
3300006805|Ga0075464_10124788 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
3300007540|Ga0099847_1182740 | Not Available | 615 | Open in IMG/M |
3300007542|Ga0099846_1116924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300007542|Ga0099846_1277617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300007734|Ga0104986_1752 | Not Available | 28664 | Open in IMG/M |
3300008119|Ga0114354_1057785 | Not Available | 1638 | Open in IMG/M |
3300008448|Ga0114876_1149442 | Not Available | 854 | Open in IMG/M |
3300009026|Ga0102829_1161259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300009068|Ga0114973_10029594 | All Organisms → cellular organisms → Bacteria | 3324 | Open in IMG/M |
3300009068|Ga0114973_10089490 | Not Available | 1759 | Open in IMG/M |
3300009068|Ga0114973_10172508 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
3300009068|Ga0114973_10607210 | Not Available | 560 | Open in IMG/M |
3300009081|Ga0105098_10095596 | All Organisms → Viruses → Predicted Viral | 1277 | Open in IMG/M |
3300009151|Ga0114962_10257392 | Not Available | 992 | Open in IMG/M |
3300009152|Ga0114980_10000287 | Not Available | 35808 | Open in IMG/M |
3300009152|Ga0114980_10000749 | All Organisms → cellular organisms → Bacteria | 23106 | Open in IMG/M |
3300009152|Ga0114980_10721797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300009154|Ga0114963_10118049 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
3300009154|Ga0114963_10266263 | Not Available | 966 | Open in IMG/M |
3300009159|Ga0114978_10085431 | Not Available | 2105 | Open in IMG/M |
3300009160|Ga0114981_10001689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14366 | Open in IMG/M |
3300009160|Ga0114981_10233803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
3300009163|Ga0114970_10123817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1578 | Open in IMG/M |
3300009163|Ga0114970_10225717 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
3300009163|Ga0114970_10644161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300009164|Ga0114975_10033112 | Not Available | 3091 | Open in IMG/M |
3300009164|Ga0114975_10233643 | Not Available | 1032 | Open in IMG/M |
3300009165|Ga0105102_10099379 | Not Available | 1364 | Open in IMG/M |
3300009165|Ga0105102_10631971 | Not Available | 594 | Open in IMG/M |
3300009169|Ga0105097_10351144 | Not Available | 817 | Open in IMG/M |
3300009170|Ga0105096_10411255 | Not Available | 698 | Open in IMG/M |
3300009180|Ga0114979_10722738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300009180|Ga0114979_10774881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300009183|Ga0114974_10559203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300009184|Ga0114976_10046060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2587 | Open in IMG/M |
3300009184|Ga0114976_10570279 | Not Available | 577 | Open in IMG/M |
3300009185|Ga0114971_10827145 | Not Available | 500 | Open in IMG/M |
3300010334|Ga0136644_10032465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3456 | Open in IMG/M |
3300010334|Ga0136644_10260228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
3300010368|Ga0129324_10095840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1285 | Open in IMG/M |
3300010885|Ga0133913_10048626 | All Organisms → Viruses | 11398 | Open in IMG/M |
3300010885|Ga0133913_10965263 | All Organisms → Viruses → Predicted Viral | 2207 | Open in IMG/M |
3300010885|Ga0133913_11047514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2105 | Open in IMG/M |
3300010885|Ga0133913_11416213 | Not Available | 1767 | Open in IMG/M |
3300011009|Ga0129318_10363560 | Not Available | 509 | Open in IMG/M |
3300011114|Ga0151515_10452 | Not Available | 18179 | Open in IMG/M |
3300011114|Ga0151515_10615 | Not Available | 15089 | Open in IMG/M |
3300011114|Ga0151515_10767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13404 | Open in IMG/M |
3300011116|Ga0151516_10876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13459 | Open in IMG/M |
3300011184|Ga0136709_1021070 | Not Available | 903 | Open in IMG/M |
3300011334|Ga0153697_1341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14992 | Open in IMG/M |
3300012000|Ga0119951_1073394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 886 | Open in IMG/M |
3300012012|Ga0153799_1043494 | Not Available | 837 | Open in IMG/M |
3300012012|Ga0153799_1055549 | Not Available | 724 | Open in IMG/M |
3300012017|Ga0153801_1003161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3193 | Open in IMG/M |
3300012352|Ga0157138_1003608 | Not Available | 2630 | Open in IMG/M |
3300012663|Ga0157203_1061249 | Not Available | 505 | Open in IMG/M |
3300012772|Ga0138287_1067377 | Not Available | 556 | Open in IMG/M |
3300013006|Ga0164294_10657523 | Not Available | 709 | Open in IMG/M |
3300013014|Ga0164295_10107521 | All Organisms → Viruses → Predicted Viral | 2071 | Open in IMG/M |
3300015050|Ga0181338_1049789 | Not Available | 612 | Open in IMG/M |
3300017716|Ga0181350_1004520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4025 | Open in IMG/M |
3300017716|Ga0181350_1124060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300017716|Ga0181350_1140699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300017736|Ga0181365_1042206 | All Organisms → Viruses → Predicted Viral | 1145 | Open in IMG/M |
3300017754|Ga0181344_1061364 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
3300017774|Ga0181358_1280610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300017777|Ga0181357_1122517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
3300017777|Ga0181357_1263524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300017778|Ga0181349_1006094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5076 | Open in IMG/M |
3300017778|Ga0181349_1122610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
3300017778|Ga0181349_1273426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300017778|Ga0181349_1296498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300017784|Ga0181348_1128395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
3300017784|Ga0181348_1331026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300017785|Ga0181355_1074658 | All Organisms → Viruses → Predicted Viral | 1422 | Open in IMG/M |
3300017785|Ga0181355_1369482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300020176|Ga0181556_1163233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
3300021519|Ga0194048_10301986 | Not Available | 576 | Open in IMG/M |
3300021962|Ga0222713_10000691 | Not Available | 37968 | Open in IMG/M |
3300022179|Ga0181353_1069635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300022190|Ga0181354_1167220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300022190|Ga0181354_1228662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300022407|Ga0181351_1062611 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
3300022407|Ga0181351_1112244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
3300022407|Ga0181351_1138418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
3300022752|Ga0214917_10138925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1311 | Open in IMG/M |
3300022752|Ga0214917_10258376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
3300024348|Ga0244776_10900980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300025091|Ga0209616_1019524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300025436|Ga0208103_1049915 | Not Available | 579 | Open in IMG/M |
3300025896|Ga0208916_10000413 | All Organisms → cellular organisms → Bacteria | 20412 | Open in IMG/M |
3300027659|Ga0208975_1038484 | All Organisms → Viruses → Predicted Viral | 1501 | Open in IMG/M |
3300027708|Ga0209188_1000513 | Not Available | 37246 | Open in IMG/M |
3300027710|Ga0209599_10117521 | Not Available | 702 | Open in IMG/M |
3300027712|Ga0209499_1003493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9549 | Open in IMG/M |
3300027733|Ga0209297_1367885 | Not Available | 516 | Open in IMG/M |
3300027734|Ga0209087_1278089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300027736|Ga0209190_1010954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5400 | Open in IMG/M |
3300027754|Ga0209596_1002297 | All Organisms → cellular organisms → Bacteria | 15822 | Open in IMG/M |
3300027763|Ga0209088_10140719 | Not Available | 1074 | Open in IMG/M |
3300027763|Ga0209088_10319031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300027782|Ga0209500_10097185 | Not Available | 1464 | Open in IMG/M |
3300027782|Ga0209500_10187901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
3300027956|Ga0209820_1119524 | Not Available | 721 | Open in IMG/M |
3300027963|Ga0209400_1003022 | Not Available | 12436 | Open in IMG/M |
3300027969|Ga0209191_1007170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6133 | Open in IMG/M |
3300027971|Ga0209401_1014089 | Not Available | 4281 | Open in IMG/M |
3300028025|Ga0247723_1003121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8425 | Open in IMG/M |
3300028025|Ga0247723_1113951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300028394|Ga0304730_1299166 | Not Available | 555 | Open in IMG/M |
3300029798|Ga0239581_1083565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300031746|Ga0315293_10112076 | All Organisms → Viruses → Predicted Viral | 2305 | Open in IMG/M |
3300031786|Ga0315908_10472361 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
3300031952|Ga0315294_10956471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300031999|Ga0315274_10331379 | Not Available | 1800 | Open in IMG/M |
3300032053|Ga0315284_11320615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300033233|Ga0334722_10444515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300033233|Ga0334722_10903634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300033816|Ga0334980_0264413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300033980|Ga0334981_0005195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7818 | Open in IMG/M |
3300033981|Ga0334982_0089487 | All Organisms → Viruses → Predicted Viral | 1637 | Open in IMG/M |
3300033993|Ga0334994_0060928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2320 | Open in IMG/M |
3300033996|Ga0334979_0560788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300034022|Ga0335005_0638509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300034023|Ga0335021_0204859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
3300034095|Ga0335022_0498826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300034284|Ga0335013_0501583 | Not Available | 726 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 33.10% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.15% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.34% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.23% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.23% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.23% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.82% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.11% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.11% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.41% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.41% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.41% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.41% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.70% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.70% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.70% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.70% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.70% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.70% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.70% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300029798 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Draft_100408668 | 3300000558 | Hydrocarbon Resource Environments | VLTLLDEERRVYRRSAVLERLHQRYCNLRAARERIEIMQEAQRP* |
Ga0065861_11160773 | 3300004448 | Marine | MVLEMLNHEKATEGRASILRRIHQRYNVLRVSRERIELLQEAKQP* |
Ga0066222_10965685 | 3300004460 | Marine | MVLEMLNHEKATEGRASILRRIHQRYNVLRVSRERIELLQQAKQP* |
Ga0065167_10504722 | 3300004693 | Freshwater | MVLEMLNHEKATEGRASILRRIHQRYNTLRVSRERIELLQEAKQP* |
Ga0007854_104825851 | 3300004806 | Freshwater | LKSERKGEKRLSILQRLHQRYNTLRVSRERVELIAEAKK* |
Ga0049081_100729171 | 3300005581 | Freshwater Lentic | NERQTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP* |
Ga0049081_101681374 | 3300005581 | Freshwater Lentic | THERANAKRVVVLERLHQRYTTLRASRERIELLHEARQP* |
Ga0049080_103069491 | 3300005582 | Freshwater Lentic | PTLTEEEVLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP* |
Ga0078894_104207284 | 3300005662 | Freshwater Lake | EEREGAKRVSMLQRLHQRYNTLRVARERLELLKGAIQP* |
Ga0007866_10032217 | 3300006119 | Freshwater | MLNAERVGAKRLSVLERLHQRYNTLRVARERIELLKEARNK* |
Ga0075464_101053983 | 3300006805 | Aqueous | MLAHERRNDKRAAVLQRLHQRYNTLRVARERIELLQEATKP* |
Ga0075464_101247883 | 3300006805 | Aqueous | MLNNERDTLKRVSMLERLHQRYNTLRVARERLELLKEAKLP* |
Ga0099847_11827401 | 3300007540 | Aqueous | EMLTHERTNERRVSVLQRLHQRYNTLRVSRERIELLQEAKQP* |
Ga0099846_11169243 | 3300007542 | Aqueous | MLTEERKNQRRVSVLQRLHQRYNTLRVSRERIELLQEAKQP* |
Ga0099846_12776171 | 3300007542 | Aqueous | MGMLNNERNTLKRVSVLERMHQRYNTLRVARERLELLKEAK |
Ga0102859_11563251 | 3300007708 | Estuarine | TEAEVLQMLQEEKADAQRIVVLERLHQRYNTLRVSRERIDLLNGAREGTK* |
Ga0104986_175223 | 3300007734 | Freshwater | MLNNERNTLKRVSMLERLHQRYNTLRVARERLELLKEAKLP* |
Ga0114354_10577856 | 3300008119 | Freshwater, Plankton | EMLTEEREVGKRVAVLERLHQRYTTLRAARERIEILQEARRP* |
Ga0114876_11494422 | 3300008448 | Freshwater Lake | MLTHERANAKRVVVLERLHQRYTTLRASRERIELLHEAKQP* |
Ga0102829_11612593 | 3300009026 | Estuarine | MLNNERNTLKRVSMLERLHQRYNTLRVARERLELLKEAKLT* |
Ga0114973_100295947 | 3300009068 | Freshwater Lake | MLEYERTNQRRVSVLERLHQRYNTLRVSRERIELLQEAKQP* |
Ga0114973_100894903 | 3300009068 | Freshwater Lake | MLTHERANAKRVVVLERLHQRYTTLRASRERIELLQEARQP* |
Ga0114973_101725081 | 3300009068 | Freshwater Lake | NNERNTLKRVSILERMHQRYNTLRVARERLELLKEAKLP* |
Ga0114973_106072102 | 3300009068 | Freshwater Lake | DEQMVLEMLNHERATESRASILRRIHQRYNVLRVSRERIELLQEAKQP* |
Ga0105098_100955963 | 3300009081 | Freshwater Sediment | MLMEERKNQRRVSVLQRLHQRYNTLRVSRERIELLQEAKHV* |
Ga0114962_102573921 | 3300009151 | Freshwater Lake | QEERVTYKRVVVLERLHQRYNTLRVARERIEILQEAVNDT* |
Ga0114980_100002871 | 3300009152 | Freshwater Lake | DEAKVLEMLLAERRSGKRVSVLERLHQRYTALRASRERIEILQEARRP* |
Ga0114980_100007497 | 3300009152 | Freshwater Lake | MLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP* |
Ga0114980_107217971 | 3300009152 | Freshwater Lake | KVLEMLLAERRSAKRVSVLERLHQRYTALRASRERIEILQEARRP* |
Ga0114963_101180494 | 3300009154 | Freshwater Lake | MLTEERVNQRRVSVLERLHQRYNTLRVSRERIEILQEAKQP* |
Ga0114963_102662635 | 3300009154 | Freshwater Lake | LDEQMVLEMLNHELATEGRASILRRIHQRYNVLRVSRERIELLQQAKQP* |
Ga0114978_100854314 | 3300009159 | Freshwater Lake | MGMLNNERNTLKRVSVLERLHQRYNTLRVARERLELLKEAKLP* |
Ga0114981_1000168926 | 3300009160 | Freshwater Lake | LPTLTEEEVLGLLNNERNTLKRVSILERMHQRYNTLRVARERLELLKEAKLP* |
Ga0114981_102338031 | 3300009160 | Freshwater Lake | HERANARRVVVLERLHQRYTTLRASRERIELLQEARQP* |
Ga0114970_101238171 | 3300009163 | Freshwater Lake | QLLKRVSVLERLHQRYNTLRVARERLELLKEAKLP* |
Ga0114970_102257171 | 3300009163 | Freshwater Lake | EVLGLLNNERNTLKRVSILERMHQRYNTLRVARERLELLKEAKLP* |
Ga0114970_106441611 | 3300009163 | Freshwater Lake | ANLRRIVVLERLHQRYNSLRVTRERIELFKEATTKWKRS* |
Ga0114975_100331122 | 3300009164 | Freshwater Lake | LSEEEVLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP* |
Ga0114975_102336434 | 3300009164 | Freshwater Lake | LTEEREGAKRVSMLQRLHQRYNTLRVARERLELLKGAIQP* |
Ga0105102_100993792 | 3300009165 | Freshwater Sediment | MLTHERVNAKRVVVLERLHQRYTTLRASRERIELLHEAKQP* |
Ga0105102_106319712 | 3300009165 | Freshwater Sediment | MLEHERANERRVSVLQRLHQRYNTLRVSRERIELLQEAKHV* |
Ga0105097_103511443 | 3300009169 | Freshwater Sediment | MLLEERKNQRRVSVLQRLHQRYNTLRVSRERIELLQEAKQP* |
Ga0105096_104112554 | 3300009170 | Freshwater Sediment | ANAKRVVVLERLHQRYTTLRASRERIELLHEAKQP* |
Ga0114979_107227383 | 3300009180 | Freshwater Lake | MLMEERKNQRRVSVLERLHQRYNTLRVSRERIELLQEAKHV* |
Ga0114979_107748811 | 3300009180 | Freshwater Lake | TEEEVLGLLNNERNTLKRVSILERMHQRYNTLRVARERLELLKEAKLP* |
Ga0114974_105592031 | 3300009183 | Freshwater Lake | MLNHERANAKRLVVLERLHQRYTMLGASRERIELLQEARRP* |
Ga0114976_100460609 | 3300009184 | Freshwater Lake | RNTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP* |
Ga0114976_105702792 | 3300009184 | Freshwater Lake | MLLLEQQTQKRITILERLHQRYNTLRVARERIELLQEATK* |
Ga0114971_108271452 | 3300009185 | Freshwater Lake | LDEQKVLEMLNHEKATEARASILRRIHQRYNVLRVSRERIELLQQAKQP* |
Ga0136644_100324653 | 3300010334 | Freshwater Lake | LALLTEERATGKRITVLERLHQRYNTLRVARERVEILKEATK* |
Ga0136644_102602285 | 3300010334 | Freshwater Lake | MVLEMLTHERESAKRVSVLERLHQRYTALRASRERIEILQEARRP* |
Ga0129324_100958404 | 3300010368 | Freshwater To Marine Saline Gradient | MLMEERKNQRRVSVLQRLHQRYNTLRVSRERIELLQEAKQP* |
Ga0133913_100486261 | 3300010885 | Freshwater Lake | ERANLRRIVVLERLHQRYNSLRVTRERIELFKEATTKWKRS* |
Ga0133913_109652636 | 3300010885 | Freshwater Lake | MLNHEKATEGRASILRRIHQRYNVLRVSRERIELLQQAKQ |
Ga0133913_110475141 | 3300010885 | Freshwater Lake | NEERANLRRIVVLERLHQRYNSLRVTRERIELFKEATTKWKRT* |
Ga0133913_114162134 | 3300010885 | Freshwater Lake | LSEEEVLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLE |
Ga0129318_103635603 | 3300011009 | Freshwater To Marine Saline Gradient | MGMLNNERDTLKRVSVLERLHQRYNTLRVARERLELLKEAKLP* |
Ga0151515_1045222 | 3300011114 | Freshwater | MLNNERNTLKRVSMLERMHQRYNTLRVARERLELLKEAKLP* |
Ga0151515_1061519 | 3300011114 | Freshwater | MLNAERANLRRVVVLERLHQRYNSLRITRERIELLKEATSKWKR* |
Ga0151515_1076724 | 3300011114 | Freshwater | MLTHERTNAKRVVVLERLHQRYTMLRASRERIELLQEARRP* |
Ga0151516_1087621 | 3300011116 | Freshwater | EEEVLDMLNNERNTLKRVSMLERMHQRYNTLRVARERLELLKEAKLP* |
Ga0136709_10210703 | 3300011184 | Freshwater | MLMEERKNQRRVSVLQRLHQRYNTLRVSRERIELLQEAKQ |
Ga0153697_134110 | 3300011334 | Freshwater | MLNEERVGRKRVVVLERLHQVYSAKRTARERIEILNEATNDKA* |
Ga0119951_10733942 | 3300012000 | Freshwater | MVLDMLNHEIATEGRASILRRIHQRYNVLRVSRERIELLQQAKQP* |
Ga0153799_10434946 | 3300012012 | Freshwater | TEEREVGKRVAVLERLHQRYTTLRAARERIEILQEARRP* |
Ga0153799_10555494 | 3300012012 | Freshwater | TEEREVGKRVAVLERLHQRYTTLRAARERIEILHEARRP* |
Ga0153801_100316112 | 3300012017 | Freshwater | LEMLTDEREVGKRVAVLERLHQRYTTLRAARERIEILQEARRP* |
Ga0157138_10036083 | 3300012352 | Freshwater | MLNAERNGAKRITILERLHQRYNTLRVMRERVELMKEATK* |
Ga0157203_10612491 | 3300012663 | Freshwater | ERATESRASILRRIHQRYNVLRVSRERIELLQEAKQP* |
Ga0138287_10673771 | 3300012772 | Freshwater Lake | MVLEMLNHELATEGRASILRRIHQRYNVLRVSRERIELLQQAKQP* |
Ga0164294_106575232 | 3300013006 | Freshwater | DEQMVLEMLNHERATESRASILRRIHQRYNTLRVSRERIELLQEAKQP* |
Ga0164295_101075215 | 3300013014 | Freshwater | LEMLNHEKATEARASILRRIHQHYNTLRVSRERIELLQQAKQP* |
Ga0181338_10497893 | 3300015050 | Freshwater Lake | MLNDERVNLRRVVVLERLHQRYNTLRVSRERVELLK* |
Ga0181350_100452012 | 3300017716 | Freshwater Lake | LEMLMEERKNQRRVSVLERLHQRYNTLRVSRERIELLQEAKHV |
Ga0181350_11240601 | 3300017716 | Freshwater Lake | KVLEMLTHERDSAKRVSVLERLHQRYTALRASRERIEILQEARRP |
Ga0181350_11406991 | 3300017716 | Freshwater Lake | NERDTLKRVSVLERLHQRYNTLRVARERLELLKEAKLP |
Ga0181365_10422063 | 3300017736 | Freshwater Lake | MLEHERKNQRRVSVLERLHQRYNTLRVSRERIELLQEAKHA |
Ga0181344_10613644 | 3300017754 | Freshwater Lake | QMVLEMLNHEKATEARASILRRIHQRYNTLRVSRERIELLQEAKQP |
Ga0181358_12806103 | 3300017774 | Freshwater Lake | LSEEEVLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEARLP |
Ga0181357_11225171 | 3300017777 | Freshwater Lake | ERKNQRRVSVLERLHQRYNTLRVSRERIELLQEAKHA |
Ga0181357_12635243 | 3300017777 | Freshwater Lake | VMGMLNNERDTLKRVSVLERLHQRYNTLRVARERLELLKEAKLP |
Ga0181349_100609411 | 3300017778 | Freshwater Lake | LRRIVVLERLHQRYNSLRVTRERIELFKEATTKWKRS |
Ga0181349_11226104 | 3300017778 | Freshwater Lake | EMLTHERESGKRVSVLERLHQRYTALRASRERIEILQEARRP |
Ga0181349_12734261 | 3300017778 | Freshwater Lake | LSEEEVLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP |
Ga0181349_12964981 | 3300017778 | Freshwater Lake | GMLNNERDTLKRVSVLERLHQRYNTLRVARERLELLKEAKLP |
Ga0181348_11283951 | 3300017784 | Freshwater Lake | EEVMGMLNNERDTLKRVSVLERLHQRYNTLRVARERLELLKEAKLP |
Ga0181348_13310261 | 3300017784 | Freshwater Lake | KLRRIVVLERLHQRYNSLRVTRERIELFKEATTKWKRS |
Ga0181355_10746587 | 3300017785 | Freshwater Lake | PTLSEEEVLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP |
Ga0181355_13694823 | 3300017785 | Freshwater Lake | PTLSEEEVLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEARLP |
Ga0181556_11632331 | 3300020176 | Salt Marsh | LTHERANAKRVVVLERLHQRYTTLRASRERIELLHEATQP |
Ga0194048_103019864 | 3300021519 | Anoxic Zone Freshwater | KLQEERVTYKRVVVLERLHQRYNTLRVARERIEILQEAVNDT |
Ga0222713_100006915 | 3300021962 | Estuarine Water | MLNNERQTLKRVSVLERMHQRYNTLRVARERLKLLKEAKLP |
Ga0181353_10696355 | 3300022179 | Freshwater Lake | NLRRIVVLERLHQRYNSLRVTRERMELFKEATTKWKRS |
Ga0181354_11672201 | 3300022190 | Freshwater Lake | RLQMLTDEREVGKRVAVLERLHQRYTTLRAARERIEILHEARRP |
Ga0181354_12286624 | 3300022190 | Freshwater Lake | TNLRRIVVLERLHQRYNSLRVTRERIELFKEATTKWKRS |
Ga0181351_10626115 | 3300022407 | Freshwater Lake | EEEVLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEARLP |
Ga0181351_11122441 | 3300022407 | Freshwater Lake | ILEMLTHERESAKRVSVLERLHQRYTALRASRERIEILQEARRP |
Ga0181351_11384181 | 3300022407 | Freshwater Lake | LEMLMEERKNQRRVSVLERLHQRYNTLRVSRERIELLQEAKHA |
Ga0214917_101389255 | 3300022752 | Freshwater | MVLEMLNHEKATEGRASILRRIHQRYNVLRVSRERIELLQQAKQP |
Ga0214917_102583761 | 3300022752 | Freshwater | RLPTLTEEEVLGLLNNERNTLKRVSILERMHQRYNTLRVARERLELLKEAKLP |
Ga0244776_109009801 | 3300024348 | Estuarine | VLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEARLP |
Ga0209616_10195243 | 3300025091 | Freshwater | MEERKNQRRVSVLQRLHQRYNTLRVSRERIELLQEAKQP |
Ga0208103_10499151 | 3300025436 | Freshwater | LNHEKATEGRASILRRIHQRYNVLRVSRERIELLQQAKQP |
Ga0208916_1000041321 | 3300025896 | Aqueous | MLNNERDTLKRVSMLERLHQRYNTLRVARERLELLKEAKLP |
Ga0208975_10384841 | 3300027659 | Freshwater Lentic | EEEVLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP |
Ga0209188_100051317 | 3300027708 | Freshwater Lake | MVLEMLNHELATEGRASILRRIHQRYNVLRVSRERIELLQQAKQP |
Ga0209599_101175213 | 3300027710 | Deep Subsurface | MLEHERANQRRVSVLQRLHQRYNTLRVSRERIELLQEAKQP |
Ga0209499_100349315 | 3300027712 | Freshwater Lake | MLTEERVNQRRVSVLERLHQRYNTLRVSRERIEILQEAKQP |
Ga0209297_13678853 | 3300027733 | Freshwater Lake | LALLAEERVTGKRVTVLERLHQRYNTLRVARERVELLKEATK |
Ga0209087_12780891 | 3300027734 | Freshwater Lake | DEALIMLNEERVGRKRVVVLERLHQVYSAKRTARERIEILNEATNDKA |
Ga0209190_101095413 | 3300027736 | Freshwater Lake | MLNNERQSLKRVSMLERLHQRYNTLRVARERLELLKEAKLP |
Ga0209596_10022974 | 3300027754 | Freshwater Lake | MLNNERNTLKRVSMLERLHQRYNTLRVARERLELLKEAKLP |
Ga0209088_101407195 | 3300027763 | Freshwater Lake | RMLHEEREGAKRVSMLQRLHQRYNTLRVARERLELLREAIQP |
Ga0209088_103190312 | 3300027763 | Freshwater Lake | MGMLNNERNTLKRVSVLERLHQRYNTLRVARERLELLKEAKLP |
Ga0209500_100971854 | 3300027782 | Freshwater Lake | MLNEERVGRKRVVVLERLHQVYSAKRTARERIEILNEATNDKA |
Ga0209500_101879014 | 3300027782 | Freshwater Lake | VLGLLNNERNTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP |
Ga0209354_102822084 | 3300027808 | Freshwater Lake | KTEAEVLQMLQEEKADAQRIVVLERLHQRYNTLRVSRERIDLLNGAREGTK |
Ga0209820_11195243 | 3300027956 | Freshwater Sediment | MLMEERKNQRRVSVLQRLHQRYNTLRVSRERIELLQEAKHV |
Ga0209400_10030227 | 3300027963 | Freshwater Lake | MVLEMLNHEKATEARASILRRIHQRYNVLRVSRERIELLQEAKQP |
Ga0209191_100717013 | 3300027969 | Freshwater Lake | MLNNERNTLKRVSMLERLHQRYNTLRVARERLELLREAKLP |
Ga0209401_10140897 | 3300027971 | Freshwater Lake | MVLEMLNHEKATEGRASILRRIHQRYNVLRVSRERIELLQEAKQP |
Ga0247723_100312122 | 3300028025 | Deep Subsurface Sediment | MLEHERANERRVSVLQRLHQRYNTLRVSRERIELLQEAKHV |
Ga0247723_11139511 | 3300028025 | Deep Subsurface Sediment | EEREGAKRVSMLQRLHQRYNTLRVARERLELLKGAIQP |
Ga0304729_10926854 | 3300028392 | Freshwater Lake | EEEVLRKLQEERVTYKRVVVLERLHQRYNTLRVARERIEILQEAVNDT |
Ga0304730_12991661 | 3300028394 | Freshwater Lake | HEKATEGRASILRRIHQRYNVLRVSRERIELLQQAKQP |
Ga0239581_10835651 | 3300029798 | Freshwater Lake | LALLEEELKNERRLSILRRLHQRYTALRADRERIEILTKAEKI |
Ga0315293_101120763 | 3300031746 | Sediment | MLTHERGNAKRVVVLERLHQRYTMLRASRERIELLQEAKQP |
Ga0315908_104723611 | 3300031786 | Freshwater | MLTHERESGKRVSVLERLHQRYTALRASRERIEILQEARRP |
Ga0315294_109564714 | 3300031952 | Sediment | DRLPTLSEEEVLGMLNNERQTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP |
Ga0315274_103313791 | 3300031999 | Sediment | VLALLNQEREISKRVSMLQRLHQRYTALRASRERIEILQEAIRP |
Ga0315284_113206151 | 3300032053 | Sediment | ERQTLKRVSVLERMHQRYNTLRVARERLELLKEAKLP |
Ga0334722_104445155 | 3300033233 | Sediment | DEVKVLEMLTDEREVGKRVAVLERLHQRYTTLRAARERIEILHEARRP |
Ga0334722_109036341 | 3300033233 | Sediment | LNEERANLRRIVVLERLHQRYNSLRVTRERIELFKEATTKWKRT |
Ga0334980_0264413_556_675 | 3300033816 | Freshwater | TEEREGAKRVSMLQRLHQRYNTLRVARERLELLKGAIQP |
Ga0334981_0005195_1_111 | 3300033980 | Freshwater | RAGAKRISIMERLHQRYTALRASRERMELFKEARAL |
Ga0334982_0089487_13_138 | 3300033981 | Freshwater | MLMEERKNQRRVSVLERLHQRYNTLRVSRERIELLQEAKHV |
Ga0334994_0060928_341_481 | 3300033993 | Freshwater | MEVLDLLNNERQTLKRVSMLERLHQRYNTLRVARERLELLKEAKLP |
Ga0334979_0560788_2_121 | 3300033996 | Freshwater | NNERQTLKRVSMLERLHQRYNTLRVARERLELLKEAKLP |
Ga0335005_0638509_1_129 | 3300034022 | Freshwater | DLLNNERQTLKRVSMLERLHQRYNTLRVARERLELLKEAKLP |
Ga0335021_0204859_981_1097 | 3300034023 | Freshwater | EEREVGKRVAVLERLHQRYTTLRAARERIEILQEARRP |
Ga0335022_0498826_3_122 | 3300034095 | Freshwater | MEERKNQRRVSVLERLHQRYNTLRVSRERIELLQEAKHV |
Ga0335013_0501583_607_726 | 3300034284 | Freshwater | THERESAKRVSVLERLHQRYTALRASRERIEILQEARRP |
⦗Top⦘ |