Basic Information | |
---|---|
Family ID | F052524 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 142 |
Average Sequence Length | 42 residues |
Representative Sequence | MAVQVTPHPSWVADLDATLEPSRQAILDTPVIIDASENQLVD |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 142 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.30 % |
% of genes near scaffold ends (potentially truncated) | 97.89 % |
% of genes from short scaffolds (< 2000 bps) | 87.32 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.887 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.465 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.592 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.155 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.43% β-sheet: 0.00% Coil/Unstructured: 68.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 142 Family Scaffolds |
---|---|---|
PF03551 | PadR | 72.54 |
PF03450 | CO_deh_flav_C | 4.23 |
PF00574 | CLP_protease | 3.52 |
PF11954 | DUF3471 | 2.82 |
PF14518 | Haem_oxygenas_2 | 1.41 |
PF13715 | CarbopepD_reg_2 | 0.70 |
PF02798 | GST_N | 0.70 |
PF01545 | Cation_efflux | 0.70 |
PF12034 | DUF3520 | 0.70 |
PF13646 | HEAT_2 | 0.70 |
PF02738 | MoCoBD_1 | 0.70 |
COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
---|---|---|---|
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 72.54 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 72.54 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 72.54 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 7.04 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 7.04 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.52 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.70 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.70 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.89 % |
Unclassified | root | N/A | 2.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001086|JGI12709J13192_1001840 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
3300001593|JGI12635J15846_10337428 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300002557|JGI25381J37097_1076785 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300002560|JGI25383J37093_10023276 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
3300002561|JGI25384J37096_10263571 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
3300002562|JGI25382J37095_10146593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 775 | Open in IMG/M |
3300002908|JGI25382J43887_10219145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 900 | Open in IMG/M |
3300002912|JGI25386J43895_10068393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 976 | Open in IMG/M |
3300004780|Ga0062378_10048297 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300005172|Ga0066683_10039375 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
3300005172|Ga0066683_10792797 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
3300005180|Ga0066685_11056187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
3300005184|Ga0066671_10293542 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300005187|Ga0066675_11326048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
3300005330|Ga0070690_101358848 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300005336|Ga0070680_102009058 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005447|Ga0066689_10580715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 708 | Open in IMG/M |
3300005451|Ga0066681_10093421 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
3300005454|Ga0066687_10197451 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1096 | Open in IMG/M |
3300005467|Ga0070706_100854780 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300005549|Ga0070704_100275389 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
3300005552|Ga0066701_10231913 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300005556|Ga0066707_11035311 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 500 | Open in IMG/M |
3300005557|Ga0066704_10116219 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
3300005557|Ga0066704_10121656 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1731 | Open in IMG/M |
3300005574|Ga0066694_10106194 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
3300005576|Ga0066708_10183755 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300005889|Ga0075290_1053508 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
3300006034|Ga0066656_10408267 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300006046|Ga0066652_101256042 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300006755|Ga0079222_11509588 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 630 | Open in IMG/M |
3300006755|Ga0079222_12397003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
3300006794|Ga0066658_10045522 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
3300006794|Ga0066658_10621509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
3300006797|Ga0066659_11614238 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006954|Ga0079219_10777849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 747 | Open in IMG/M |
3300007255|Ga0099791_10119372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1222 | Open in IMG/M |
3300007255|Ga0099791_10379386 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300007258|Ga0099793_10695011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
3300009012|Ga0066710_101266947 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1143 | Open in IMG/M |
3300009088|Ga0099830_10181424 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1637 | Open in IMG/M |
3300009088|Ga0099830_10598128 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 904 | Open in IMG/M |
3300009089|Ga0099828_10002513 | All Organisms → cellular organisms → Bacteria | 12623 | Open in IMG/M |
3300009089|Ga0099828_11302400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 643 | Open in IMG/M |
3300009090|Ga0099827_10949300 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300010159|Ga0099796_10373034 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300010301|Ga0134070_10246937 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300010301|Ga0134070_10449207 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300010320|Ga0134109_10176637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 779 | Open in IMG/M |
3300010326|Ga0134065_10084421 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300010329|Ga0134111_10108366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1071 | Open in IMG/M |
3300010364|Ga0134066_10059310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1008 | Open in IMG/M |
3300010371|Ga0134125_11413244 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300010371|Ga0134125_12085820 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
3300010399|Ga0134127_10102016 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
3300011269|Ga0137392_10051388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3103 | Open in IMG/M |
3300011271|Ga0137393_11762594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
3300011443|Ga0137457_1054951 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300012198|Ga0137364_10045864 | All Organisms → cellular organisms → Bacteria | 2888 | Open in IMG/M |
3300012198|Ga0137364_11464660 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012203|Ga0137399_10556791 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300012205|Ga0137362_10149319 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
3300012207|Ga0137381_10086833 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
3300012207|Ga0137381_11698981 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
3300012208|Ga0137376_10157557 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
3300012208|Ga0137376_11446718 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 578 | Open in IMG/M |
3300012210|Ga0137378_11837827 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 509 | Open in IMG/M |
3300012211|Ga0137377_11328467 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300012355|Ga0137369_10060181 | All Organisms → cellular organisms → Bacteria | 3267 | Open in IMG/M |
3300012355|Ga0137369_10074611 | All Organisms → cellular organisms → Bacteria | 2860 | Open in IMG/M |
3300012355|Ga0137369_10097178 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2426 | Open in IMG/M |
3300012357|Ga0137384_11430303 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300012361|Ga0137360_10818354 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300012385|Ga0134023_1018151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 535 | Open in IMG/M |
3300012918|Ga0137396_10180230 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
3300012930|Ga0137407_11224060 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300012944|Ga0137410_11650554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
3300012972|Ga0134077_10554385 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
3300012976|Ga0134076_10299345 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
3300012976|Ga0134076_10635482 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300014157|Ga0134078_10454552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 586 | Open in IMG/M |
3300015054|Ga0137420_1322345 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
3300015256|Ga0180073_1129751 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 544 | Open in IMG/M |
3300015358|Ga0134089_10039491 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
3300015359|Ga0134085_10070449 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300017654|Ga0134069_1036530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1520 | Open in IMG/M |
3300017656|Ga0134112_10041162 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1653 | Open in IMG/M |
3300018056|Ga0184623_10447710 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300018078|Ga0184612_10075809 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
3300018433|Ga0066667_10628653 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300018433|Ga0066667_10981639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 728 | Open in IMG/M |
3300018433|Ga0066667_11075795 | Not Available | 695 | Open in IMG/M |
3300018468|Ga0066662_10548936 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1067 | Open in IMG/M |
3300019882|Ga0193713_1119849 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300019885|Ga0193747_1143560 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 548 | Open in IMG/M |
3300020170|Ga0179594_10089979 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300021086|Ga0179596_10190914 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300024219|Ga0247665_1051305 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 574 | Open in IMG/M |
3300024330|Ga0137417_1291981 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300025324|Ga0209640_10340417 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300026295|Ga0209234_1290458 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300026296|Ga0209235_1073980 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300026296|Ga0209235_1155012 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300026297|Ga0209237_1020969 | All Organisms → cellular organisms → Bacteria | 3724 | Open in IMG/M |
3300026297|Ga0209237_1122013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1093 | Open in IMG/M |
3300026297|Ga0209237_1170690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 789 | Open in IMG/M |
3300026301|Ga0209238_1200048 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300026307|Ga0209469_1002773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8267 | Open in IMG/M |
3300026307|Ga0209469_1087184 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 914 | Open in IMG/M |
3300026313|Ga0209761_1036234 | All Organisms → cellular organisms → Bacteria | 2905 | Open in IMG/M |
3300026314|Ga0209268_1135090 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 609 | Open in IMG/M |
3300026325|Ga0209152_10297979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 603 | Open in IMG/M |
3300026329|Ga0209375_1266231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
3300026333|Ga0209158_1064335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1460 | Open in IMG/M |
3300026334|Ga0209377_1097329 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300026524|Ga0209690_1307723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
3300026536|Ga0209058_1343458 | Not Available | 516 | Open in IMG/M |
3300026537|Ga0209157_1201962 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 838 | Open in IMG/M |
3300026537|Ga0209157_1244664 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 716 | Open in IMG/M |
3300026538|Ga0209056_10460491 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 707 | Open in IMG/M |
3300026540|Ga0209376_1105366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1433 | Open in IMG/M |
3300026548|Ga0209161_10008516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 7868 | Open in IMG/M |
3300026552|Ga0209577_10170907 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
3300027643|Ga0209076_1011232 | All Organisms → cellular organisms → Bacteria | 2301 | Open in IMG/M |
3300027748|Ga0209689_1219958 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 814 | Open in IMG/M |
3300027775|Ga0209177_10295018 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
3300027875|Ga0209283_10696972 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300027886|Ga0209486_11038644 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
3300027903|Ga0209488_10668276 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300027903|Ga0209488_10858963 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300028536|Ga0137415_10639343 | Not Available | 876 | Open in IMG/M |
3300028536|Ga0137415_10658107 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 859 | Open in IMG/M |
3300028711|Ga0307293_10075906 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300028814|Ga0307302_10521889 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
3300028878|Ga0307278_10008491 | All Organisms → cellular organisms → Bacteria | 4849 | Open in IMG/M |
3300028884|Ga0307308_10235983 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 877 | Open in IMG/M |
3300031114|Ga0308187_10351858 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
3300031720|Ga0307469_10339962 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300032180|Ga0307471_100492398 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300032205|Ga0307472_100773891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 873 | Open in IMG/M |
3300033407|Ga0214472_11561386 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 562 | Open in IMG/M |
3300033417|Ga0214471_11179582 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 583 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.38% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.11% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.11% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.41% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.41% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.41% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.41% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.70% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.70% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.70% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12709J13192_10018404 | 3300001086 | Forest Soil | MAVQVTPHPTWVAELDSTLEPNRQAILDTPVIIDASENQLVDGQIQNFL |
JGI12635J15846_103374281 | 3300001593 | Forest Soil | MAVQVTPHPTWVAELDSTLEPNRQAILDTPVIIDASENQLVDGQIQNFLVG |
JGI25381J37097_10767851 | 3300002557 | Grasslands Soil | MAVQVTPHPSWVAELDSTLEPSRQAILDTPVIIDASENQLVDGQI |
JGI25383J37093_100232764 | 3300002560 | Grasslands Soil | MAVEITPHPPWVSELDATLEPSRQAILDTPVIVDASENQLVDGQI |
JGI25384J37096_102635712 | 3300002561 | Grasslands Soil | MSVQVTPHPAWVADLDATLDPSREAILDTNVIVHASENQLVD |
JGI25382J37095_101465931 | 3300002562 | Grasslands Soil | MSVQVTPHPAWVADLDATLDPSREAILDTNVIVHASENQL |
JGI25382J43887_102191451 | 3300002908 | Grasslands Soil | MSVQVTPHPAWVAELDATLEPKREQILDTPVIIHASENELIDGKIQNFLV |
JGI25386J43895_100683931 | 3300002912 | Grasslands Soil | MSVQVTPHPAWVAELDATLEPQREAILDTPVIIHASENALIDGKI |
Ga0062378_100482971 | 3300004780 | Wetland Sediment | MSVQVTPHPAWVSDLDSTLEPHRQAILDTPVIIDASENQLVDGQIQNFLVG |
Ga0066683_100393754 | 3300005172 | Soil | MAVEITPHPEWVAELDTTLEPSRQAILDTPVIIDASENQL |
Ga0066683_107927971 | 3300005172 | Soil | MSVQVTPHPSWVADLDAALDPSREAILDTKVIVHASENQLIDGKIQN |
Ga0066685_110561871 | 3300005180 | Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTPVIVDASENQLVDGRIQN |
Ga0066671_102935421 | 3300005184 | Soil | MSVQVTPHPAWVADLDAALDPSREAILDTRVIVHASENELVDG |
Ga0066675_113260481 | 3300005187 | Soil | MSVQVTPHPAWVAQMDVALDPTREAILNTRVIVDASENQLVEGMTQNFV |
Ga0070690_1013588482 | 3300005330 | Switchgrass Rhizosphere | MAVEITPHPAWVADLDATLEPSRQAILDTPVIVDASENQLIDGKIQNFLVSFY |
Ga0070680_1020090581 | 3300005336 | Corn Rhizosphere | MSVQVTPHPGWVAELDATLEPSRQAILDTPVIVDASENQLVDGQIQ |
Ga0066689_105807152 | 3300005447 | Soil | MSVQVTPHPAWVAELDATLEPRREAILDTDVIVHASENQLVDGKIQDF |
Ga0066681_100934213 | 3300005451 | Soil | MAVEITPHPSWVADLDATLEPSRQAILDTPVIVDASENQLVDGQIQNF |
Ga0066687_101974513 | 3300005454 | Soil | MSVQVTPHPAWVADLDAALDPSREAILDTPVIVHASENELVNGKIQNFLVA |
Ga0070706_1008547801 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVQVTPHPGWVAELDAALEPSRQAILDTPVIVDASENQLVDGQ |
Ga0070704_1002753891 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVEITPHPPWVAELDATLEPRRQAILDTQVIIDASENQLIEGQIQNFLVAF |
Ga0066701_102319131 | 3300005552 | Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTRVIVDAS |
Ga0066707_110353111 | 3300005556 | Soil | MSVQVTPHPKWVADLDAALDPSREAILNTRVIVDASENQLADGRIQN |
Ga0066704_101162193 | 3300005557 | Soil | MSVQVTPHPAWVADLDATLDPSREAILDTNVIVHASENQLVDGKIQDF |
Ga0066704_101216564 | 3300005557 | Soil | MSVQVTPHPAWVAELDATLEPHREAILDTPVIVHASENALINGKIQDFLVAFY |
Ga0066694_101061943 | 3300005574 | Soil | MSVQVTPHPPWVADLDSTLEPSRQAILDTPVIIDASENQLV |
Ga0066708_101837553 | 3300005576 | Soil | MSVQVTPHPAWVADLDATLDPRREAILDTRVIVHASENELID |
Ga0075290_10535081 | 3300005889 | Rice Paddy Soil | MSVQVTPHPRWVADLDAALDPGREAILNTQVIVDAS |
Ga0066656_104082672 | 3300006034 | Soil | MAVQVTPHPSWVADLDTTLEPSRQAILDTPVIIDASENQL |
Ga0066652_1012560421 | 3300006046 | Soil | MAVQVTPHPTWVAELDSTLEPSRQAILDTPVIIDAS |
Ga0079222_115095881 | 3300006755 | Agricultural Soil | MSVQVTPHPKWVADLDAALDPSREAILDTKVIVDAS |
Ga0079222_123970031 | 3300006755 | Agricultural Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTRVIVDASENQLV |
Ga0066658_100455225 | 3300006794 | Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTRVIVDASENQLVDGRIQNFLVNF |
Ga0066658_106215091 | 3300006794 | Soil | MSVQVTPHPSWVADLDATLDPSREAILDTKVIVHASENQ |
Ga0066659_116142382 | 3300006797 | Soil | MSVQVTPHPPWVADLDSTLEPSRQAILDTPVIIDASENQ |
Ga0079219_107778492 | 3300006954 | Agricultural Soil | MSVQVTPHPKWVADLDAALDPSREAILDTKVIVDASE |
Ga0099791_101193723 | 3300007255 | Vadose Zone Soil | MSVQVTPHPPWVADLDSTLEPSRQAILDTPVIIDASENQLVDGQIQ |
Ga0099791_103793862 | 3300007255 | Vadose Zone Soil | MSVQVTPHPPWVADLDSTLEPSRQAILDTPVIIDASEN |
Ga0099793_106950111 | 3300007258 | Vadose Zone Soil | MPVQVTPHPKWVADLDAVLDPGREAILDTPVIVDASENQLVDGQIQDFLVN |
Ga0066710_1012669471 | 3300009012 | Grasslands Soil | MSVQVTPHPAWVAELDATLEPQREAILDTPVIIHASENAL |
Ga0099830_101814243 | 3300009088 | Vadose Zone Soil | MPVQVTPHPKWVADLDAVLDPGREAILDTPVIVDASEN |
Ga0099830_105981281 | 3300009088 | Vadose Zone Soil | MSVQVTPHPAWVAELDATLEPKREQILDTPVIIHASENELID |
Ga0099828_1000251311 | 3300009089 | Vadose Zone Soil | MAVQVTPHPSWVAELDSTLEPSREAILDTPVIIDASENQLVDGQ |
Ga0099828_113024002 | 3300009089 | Vadose Zone Soil | MPVQVTPHPKWVADLDAVLDPGREAILDTPVIVDASENQLVDGQIQDFLVNFY |
Ga0099827_109493001 | 3300009090 | Vadose Zone Soil | MAVEITPHPPWVADLDATLEPSRQAILDTPVIIDASENQLVD |
Ga0099796_103730341 | 3300010159 | Vadose Zone Soil | MAVQVTPHPAWVAELDAALEPGRQAILDTPVIVDASENQL |
Ga0134070_102469371 | 3300010301 | Grasslands Soil | MAVQVTPHPAWVAELDTALEPSRQAILDTPVIVDASENQLVDGQI |
Ga0134070_104492071 | 3300010301 | Grasslands Soil | MAVQVTPHPSWVADLDTTLEPSRQAILDTPVIIDASEN |
Ga0134109_101766372 | 3300010320 | Grasslands Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTPVIVDASENQLVD |
Ga0134065_100844212 | 3300010326 | Grasslands Soil | MAVEITPHPEWVAELDTTLEPSRQAILDTPVIIDASENQLVDGQIQNF |
Ga0134111_101083661 | 3300010329 | Grasslands Soil | MSVQVTPHPSWVADLDATLDPSREAILDTKVIVHASENQLLDGR |
Ga0134066_100593101 | 3300010364 | Grasslands Soil | MSVQVTPHPPWVADLDATLDPRREAILDTRVIVHASENELIDGKIQNFL |
Ga0134125_114132441 | 3300010371 | Terrestrial Soil | MAVQVTPHPGWVAELDAALEPSRQAILDTPVIVDASENQL |
Ga0134125_120858202 | 3300010371 | Terrestrial Soil | MSVVVTPHPSWVAELDAALEPHREAILDTPVVVDASENHLIDGK |
Ga0134127_101020164 | 3300010399 | Terrestrial Soil | MAVQVTPHPTWVADLDSTLEPNRQAILDTQVIVDASENQLV |
Ga0137392_100513881 | 3300011269 | Vadose Zone Soil | MAVQVTPHPHWVADLDAALDPSREAILDTPVIIDA |
Ga0137393_117625941 | 3300011271 | Vadose Zone Soil | MAVQVTPHPHWVADLDAALDPSREAILDTPVIIDSSENQLVDGRIQN |
Ga0137457_10549513 | 3300011443 | Soil | MAVEITPHPAWVADLDATLEPSRQAILDTPVIVDASENQLV |
Ga0137364_100458644 | 3300012198 | Vadose Zone Soil | MAVQVTPHPSWVADLDAKLEPSRQSILDTPVIVHASENQLVD |
Ga0137364_114646601 | 3300012198 | Vadose Zone Soil | MAVEITPHPSWVADLDATLEPSRQAILDTPVIIDASENQL |
Ga0137399_105567913 | 3300012203 | Vadose Zone Soil | MSVQVTPHPPWVADLDTTLEPSRQAILDTPVIIDASEN |
Ga0137362_101493191 | 3300012205 | Vadose Zone Soil | MPVQVTPHPKWVADLDAVLDPGREAILDTPVIVDA |
Ga0137381_100868334 | 3300012207 | Vadose Zone Soil | MAVEITPHPPWVADLDATLEPSRQAILDTPVIIDASENQLVDGQIQ |
Ga0137381_116989812 | 3300012207 | Vadose Zone Soil | MSVQVTPHPAWVADLDATLDPSREAILDTNVIVHAS |
Ga0137376_101575574 | 3300012208 | Vadose Zone Soil | MAVEITPHPAWVADLDATLEPRRQAILDTPVIIDA |
Ga0137376_114467182 | 3300012208 | Vadose Zone Soil | MSVQVTPHPKWVADLDAALDPSREAILDTRVIVDASENQLADG |
Ga0137378_118378271 | 3300012210 | Vadose Zone Soil | MPVQVTPHPKWVADLDAALDPSREAILDTKVIVDASENQLA |
Ga0137377_113284671 | 3300012211 | Vadose Zone Soil | MAVQVTPHPSWVAELDSTLEPSRQAILDTPVIIDASENQLVDG |
Ga0137369_100601815 | 3300012355 | Vadose Zone Soil | MAVQVTPHPAWVADLDAALEPGRQAILDTPVIVDAS* |
Ga0137369_100746111 | 3300012355 | Vadose Zone Soil | MAVQVTPHPSWVADLDTTLEPSRQAILDTPVIIDASENQLVDGR |
Ga0137369_100971781 | 3300012355 | Vadose Zone Soil | MAVQVTPHPSWVADLDATLEPSRQAILDTPVIIDASENQLVD |
Ga0137384_114303031 | 3300012357 | Vadose Zone Soil | MAVEITPHPAWVADLDATLEPNRQAILDTPVIIDAS |
Ga0137360_108183541 | 3300012361 | Vadose Zone Soil | MAVQVTPHPPWVADLDATLEPSRQAILDTAVIIDASENQLVDG |
Ga0134023_10181513 | 3300012385 | Grasslands Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTRVIVDASENQLVTAASRISS* |
Ga0137396_101802303 | 3300012918 | Vadose Zone Soil | MSVQVTPHPPWVADLDTTLEPSRQAILDTPVIIDASE |
Ga0137407_112240601 | 3300012930 | Vadose Zone Soil | MAVQVTPHPNWVADLDTTLEPSRQAILDTPVIIDASENQLVD |
Ga0137410_116505542 | 3300012944 | Vadose Zone Soil | MAVQVTPHPAWVADLDAALEPGRQAILDTPVIVDASE |
Ga0134077_105543851 | 3300012972 | Grasslands Soil | MSVQVTPHPKWVADLDAALDPSREAILDTRVIVDASENQLADGRIQNFLVAF |
Ga0134076_102993452 | 3300012976 | Grasslands Soil | MTVQVTPHPPWVADLDAALEPHREAILDTKVVVEASENHLADGKVQNFLVAF |
Ga0134076_106354822 | 3300012976 | Grasslands Soil | MSVEITPNPNWVAELDATLEPNRQAILDTAVIVDASEN |
Ga0134078_104545521 | 3300014157 | Grasslands Soil | MSVQVTPHPPWVADLDAALDPSREAILDTRVIVHASENELVD |
Ga0137420_13223456 | 3300015054 | Vadose Zone Soil | MSVQVTPHPSWVAELDSTLEPSRQAILDTPVIIDASENQLVDGQIQ |
Ga0180073_11297512 | 3300015256 | Soil | MAVEITPHPSWVADLDARLEPSRQAILDTPVIVDASENQLVDGQIQNFLVGFY |
Ga0134089_100394913 | 3300015358 | Grasslands Soil | MTVQVTPHPPWVADLDAALEPHREAILDTKVVVEASENHL |
Ga0134085_100704493 | 3300015359 | Grasslands Soil | MSVQVTPHPKWVADLDAALDPGREAILDTRVIVDASENQLADGR |
Ga0134069_10365303 | 3300017654 | Grasslands Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTRVIVDASE |
Ga0134112_100411623 | 3300017656 | Grasslands Soil | MSVQVTPHPAWVADLDATLDPSREAILDTNVIVHASENQLVDG |
Ga0184623_104477102 | 3300018056 | Groundwater Sediment | MAVQVTPHPGWVAELDAALEPRRQAILDTPVIVDASENQLV |
Ga0184612_100758091 | 3300018078 | Groundwater Sediment | MAVQVTPHPAWVAELDAALEPSRQAILDTPVIVDASENQL |
Ga0066667_106286532 | 3300018433 | Grasslands Soil | MAVEITPHPEWVAELDTTLEPSRQAILDTPVIIDASENQLV |
Ga0066667_109816391 | 3300018433 | Grasslands Soil | MSVQVTPHPSWVADLDAALDPSREAILDTKVIVHASENQLIDGKIQNF |
Ga0066667_110757952 | 3300018433 | Grasslands Soil | VQVTPHPSWVASLNATLDPIQRAILDTPVIEDAAE |
Ga0066662_105489363 | 3300018468 | Grasslands Soil | MSVQVTPHPAWVAELDATLEPHREAILDTPVIVHASE |
Ga0193713_11198491 | 3300019882 | Soil | MAVQVTPHPAWVAELDTALEPSRQAILDTPVIVDASENQLVDGQIQNVLVGF |
Ga0193747_11435602 | 3300019885 | Soil | MSVKVTPHPAWVADLDTELEPHRKAILDTPVVVDASENR |
Ga0179594_100899791 | 3300020170 | Vadose Zone Soil | MAVQVTPHPDWVAVLDSKLEPSRQAILDTPVIVHASENQLVD |
Ga0179596_101909143 | 3300021086 | Vadose Zone Soil | MAVEITPHPAWVADLDATLEPNRQAILDTPVIIDASENQL |
Ga0247665_10513051 | 3300024219 | Soil | MTVQVTPHPKWVADLDAALDPSREAILDTRVIVDASENQLAD |
Ga0137417_12919812 | 3300024330 | Vadose Zone Soil | MAVQVTPHPSWVADFDTSLEPSRQAILDTPVIIDASEN |
Ga0209640_103404171 | 3300025324 | Soil | MAVQVTPHPSWVADLDAALEPSRLAILDTPVIVDASENQLVDGQI |
Ga0209234_12904582 | 3300026295 | Grasslands Soil | MAVQVTPHPSWVAELDSTLEPSRQAILDTPVIIDANCL |
Ga0209235_10739803 | 3300026296 | Grasslands Soil | MSVQVTPHPAWVAELDATLEPQREAILDTPVIIHASENALI |
Ga0209235_11550121 | 3300026296 | Grasslands Soil | MAVQVTPHPSWVAELDSTLEPSRQAILDTPVIIDASEN |
Ga0209237_10209691 | 3300026297 | Grasslands Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTRVIVDASENQ |
Ga0209237_11220131 | 3300026297 | Grasslands Soil | MSVQVTPHPAWVAELDATLEPHREAILDTPVIVHASEN |
Ga0209237_11706901 | 3300026297 | Grasslands Soil | MSVQVTPHPEWVVDLDRALEPHRLAVLTTPVVEHSAE |
Ga0209238_12000482 | 3300026301 | Grasslands Soil | MAVEITAHPAWVAELDGTLEPSRQAILDTPVIVDASENQLVDG |
Ga0209469_10027731 | 3300026307 | Soil | MSVQVTPHPAWVAELDATLEPQREAILDTPVIIHASENALIDGKIQD |
Ga0209469_10871841 | 3300026307 | Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTRVIVDASENQL |
Ga0209761_10362341 | 3300026313 | Grasslands Soil | MSVQVTPHPRWVADLDAALDPSREAILDTSVIVHASEN |
Ga0209268_11350901 | 3300026314 | Soil | MSVQVTPHPSWVADLDAALDPSREAILDTKVIVHASENQLIDGKIQNFLV |
Ga0209152_102979792 | 3300026325 | Soil | MSVQVTPHPAWVAELDATLEPQREAILDTPVIIHASENVLI |
Ga0209375_12662312 | 3300026329 | Soil | MSVLVTPHPRWVADLDAALDPSREAILDTSVIVHA |
Ga0209158_10643354 | 3300026333 | Soil | VDVTPHPAWVADLDAALEPTQEAILQTPVIEDAAEN |
Ga0209377_10973293 | 3300026334 | Soil | MSVQVTPHPKWVADLDAALDPSREAILNTRVIVDASENQL |
Ga0209690_13077231 | 3300026524 | Soil | MSVQVTPHPAWVADLDATLDPRREAILDTPVIVHASENELVD |
Ga0209058_13434582 | 3300026536 | Soil | VQVTPHPSWVASLNATLDPIQRAILDTPVIEDAAEN |
Ga0209157_12019621 | 3300026537 | Soil | MSVQVTPHPKWVADLDAALDPSREAILDTRVIVDA |
Ga0209157_12446642 | 3300026537 | Soil | MSVQVTPHPKWVADLDAALDPSREAILNTRVIVDASENQLADGRIQNFLVAF |
Ga0209056_104604911 | 3300026538 | Soil | MSVQVTPHPSWVAELDAALEPHREAILETPVVVEASENHLADGKVQNFLVAFY |
Ga0209376_11053661 | 3300026540 | Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTPVIVDASENQLVDGRIQDFLV |
Ga0209161_100085161 | 3300026548 | Soil | MSVQVTPHPAWVADLDATLDPRREAILDTPVIVHASENELVDGQIQNFLV |
Ga0209577_101709071 | 3300026552 | Soil | MSVQVTPHPPWVADLDATLEPSRQAILDTPVIIDASENQLVDGQI |
Ga0209076_10112321 | 3300027643 | Vadose Zone Soil | MSVQVTPHPPWVADLDTTLEPSRQAILDTPVIIDASENQLVDGQI |
Ga0209689_12199582 | 3300027748 | Soil | MSVQVTPHPAWVADLDATLDPSREAILDTNVIVHA |
Ga0209177_102950181 | 3300027775 | Agricultural Soil | MTVQVTPHPAWVADLDAALDPSREAILDTRVIVDASEN |
Ga0209283_106969721 | 3300027875 | Vadose Zone Soil | MAVQVTPHPSWVAELDSTLEPSRQAILDTPVIIDAS |
Ga0209486_110386442 | 3300027886 | Agricultural Soil | MSVLVTPHPRWVADLDAALDPGREAILDTPVIVHASENRLVDGKIQDF |
Ga0209488_106682761 | 3300027903 | Vadose Zone Soil | MAVEITPHPGWVADLDATLEPSRQAILDTPVIVDASENQLV |
Ga0209488_108589632 | 3300027903 | Vadose Zone Soil | MSVQVTPHPPWVADLDSTLEPSRQAILDTPVIIDASENQLVDG |
Ga0137415_106393432 | 3300028536 | Vadose Zone Soil | MSVQVTPHPAWVAELDATLEPQREAILDTPVIIHASENALIDGKIQAQIFTVHR |
Ga0137415_106581072 | 3300028536 | Vadose Zone Soil | MSVQVTPHPRWVADLDAALDPSREAILDTSVIVHASENQLVDGRI |
Ga0307293_100759063 | 3300028711 | Soil | MAVQVTPHPGWVAELDAALEPGRQAILDTPVIVDAS |
Ga0307302_105218892 | 3300028814 | Soil | MAVQVTPHPAWVAELDAALEPGRQAILDTPVIADASENQLIDGQI |
Ga0307278_100084916 | 3300028878 | Soil | MSVQVTPNPSWVADLDSTLEPRRQAILDTPVIIDASE |
Ga0307308_102359832 | 3300028884 | Soil | MSVQVTPHPKWVADLDAALDPSREAILDTPVIVDA |
Ga0308187_103518582 | 3300031114 | Soil | EESQMAVQVTPHPSWVADLDAALEPGRQAILDTPVIVDAS |
Ga0307469_103399623 | 3300031720 | Hardwood Forest Soil | MTVQVTPHPAWVADLDAALDPSREANHDTRVIVDAS |
Ga0307471_1004923981 | 3300032180 | Hardwood Forest Soil | MSVQVTPHPKWVADLDAVLDPSREAILDTPVIVDA |
Ga0307472_1007738911 | 3300032205 | Hardwood Forest Soil | MPVQVTPHPKWVADLDAVLDPSREAILDTPVIVDASENQLVDGQIQDFLVNF |
Ga0214472_115613861 | 3300033407 | Soil | MAVQVTPHPAWVADLDAALEPGRQAILDTPVIVDASENQLVN |
Ga0214471_111795821 | 3300033417 | Soil | MAVQVTPHPAWVADLDAALEPGRQAILDTPVIVDASENQLVNG |
⦗Top⦘ |